BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K02

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     313   1e-104   Nicotiana sylvestris
ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     306   7e-102   Nicotiana tomentosiformis
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     301   7e-100   Nicotiana sylvestris
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     301   1e-99    Nicotiana tomentosiformis
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    300   3e-99    Solanum tuberosum [potatoes]
ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          300   4e-99    Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     298   1e-98    Solanum tuberosum [potatoes]
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          290   1e-95    Vitis vinifera
gb|KHG05622.1|  Proteasome subunit beta type-5                          288   1e-94    Gossypium arboreum [tree cotton]
gb|KJB15718.1|  hypothetical protein B456_002G192400                    288   1e-94    Gossypium raimondii
gb|KHG25400.1|  Proteasome subunit beta type-5                          287   2e-94    Gossypium arboreum [tree cotton]
gb|KDP26783.1|  hypothetical protein JCGZ_17941                         287   3e-94    Jatropha curcas
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          287   4e-94    
gb|KJB78067.1|  hypothetical protein B456_012G175200                    287   4e-94    Gossypium raimondii
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          286   5e-94    Pyrus x bretschneideri [bai li]
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     286   7e-94    Sesamum indicum [beniseed]
emb|CDP13326.1|  unnamed protein product                                288   7e-94    Coffea canephora [robusta coffee]
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5-like     286   7e-94    Cucumis sativus [cucumbers]
ref|XP_007045045.1|  N-terminal nucleophile aminohydrolases (Ntn ...    284   9e-94    
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          285   3e-93    Prunus mume [ume]
gb|EPS61043.1|  hypothetical protein M569_13757                         284   4e-93    Genlisea aurea
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          284   6e-93    Cucumis melo [Oriental melon]
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    284   6e-93    
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             283   1e-92    Prunus persica
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          283   1e-92    Beta vulgaris subsp. vulgaris [field beet]
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    283   1e-92    Spinacia oleracea
gb|KCW61971.1|  hypothetical protein EUGRSUZ_H04655                     279   3e-92    Eucalyptus grandis [rose gum]
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             281   8e-92    Eutrema salsugineum [saltwater cress]
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     280   2e-91    
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        280   3e-91    Eucalyptus grandis [rose gum]
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     279   5e-91    Pyrus x bretschneideri [bai li]
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             278   9e-91    Capsella rubella
ref|NP_189265.1|  proteasome subunit beta type-5-B                      278   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        278   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    278   2e-90    Populus euphratica
ref|XP_010105786.1|  Proteasome subunit beta type-5                     278   2e-90    Morus notabilis
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    277   2e-90    Tarenaya hassleriana [spider flower]
ref|XP_002312631.2|  20S proteasome beta subunit family protein         277   2e-90    
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                277   3e-90    Erythranthe guttata [common monkey flower]
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    276   4e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          276   4e-90    Nelumbo nucifera [Indian lotus]
emb|CDY26610.1|  BnaA09g46670D                                          276   5e-90    Brassica napus [oilseed rape]
emb|CDY21081.1|  BnaA08g24440D                                          276   6e-90    Brassica napus [oilseed rape]
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        276   7e-90    Brassica rapa
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    276   7e-90    Brassica rapa
emb|CDX98014.1|  BnaA06g07650D                                          276   7e-90    
emb|CDY16054.1|  BnaC08g40690D                                          276   7e-90    Brassica napus [oilseed rape]
emb|CDY34594.1|  BnaC03g56940D                                          276   7e-90    Brassica napus [oilseed rape]
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        276   8e-90    Tarenaya hassleriana [spider flower]
emb|CDY19402.1|  BnaC05g09110D                                          275   2e-89    Brassica napus [oilseed rape]
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             274   3e-89    Eutrema salsugineum [saltwater cress]
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    274   4e-89    Camelina sativa [gold-of-pleasure]
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     273   6e-89    Phoenix dactylifera
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             273   1e-88    
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     272   2e-88    Nelumbo nucifera [Indian lotus]
ref|XP_006842100.1|  hypothetical protein AMTR_s00078p00083100          271   4e-88    
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     271   4e-88    Glycine max [soybeans]
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     271   5e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     271   8e-88    Elaeis guineensis
gb|KDO81953.1|  hypothetical protein CISIN_1g022125mg                   268   1e-87    Citrus sinensis [apfelsine]
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             270   2e-87    Phaseolus vulgaris [French bean]
gb|KHN31904.1|  Proteasome subunit beta type-5                          270   2e-87    Glycine soja [wild soybean]
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     270   2e-87    Elaeis guineensis
gb|ACU23791.1|  unknown                                                 270   2e-87    Glycine max [soybeans]
gb|ABK25888.1|  unknown                                                 269   3e-87    Picea sitchensis
gb|ACP43315.1|  20S proteasome beta subunit 5                           269   4e-87    Citrus maxima [buntan]
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    268   6e-87    Citrus sinensis [apfelsine]
gb|KDO81951.1|  hypothetical protein CISIN_1g022125mg                   269   7e-87    Citrus sinensis [apfelsine]
ref|XP_002315619.1|  20S proteasome beta subunit family protein         268   1e-86    Populus trichocarpa [western balsam poplar]
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    268   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    268   1e-86    Brassica rapa
gb|AFK46055.1|  unknown                                                 268   1e-86    Lotus japonicus
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             268   1e-86    Citrus clementina [clementine]
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    268   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        267   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     267   2e-86    Phoenix dactylifera
ref|XP_006484069.1|  PREDICTED: proteasome subunit beta type-5-B-...    268   2e-86    Citrus sinensis [apfelsine]
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     267   2e-86    Cucumis sativus [cucumbers]
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    267   2e-86    Glycine max [soybeans]
gb|ABK25785.1|  unknown                                                 267   2e-86    Picea sitchensis
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    267   3e-86    Populus euphratica
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       267   3e-86    Cucumis sativus [cucumbers]
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg             266   3e-86    
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             266   3e-86    Capsella rubella
ref|XP_006438070.1|  hypothetical protein CICLE_v10032238mg             267   4e-86    
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             266   4e-86    
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     266   5e-86    Fragaria vesca subsp. vesca
ref|XP_003602092.1|  Proteasome subunit beta type                       265   8e-86    Medicago truncatula
ref|NP_172765.1|  20S proteasome beta subunit E1                        265   1e-85    Arabidopsis thaliana [mouse-ear cress]
gb|AAK92808.1|  putative proteasome epsilon chain precursor             265   2e-85    Arabidopsis thaliana [mouse-ear cress]
gb|AFK34329.1|  unknown                                                 264   4e-85    Medicago truncatula
gb|ACJ85344.1|  unknown                                                 263   4e-85    Medicago truncatula
gb|AFK38197.1|  unknown                                                 263   5e-85    Medicago truncatula
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative         263   6e-85    
ref|XP_010440898.1|  PREDICTED: proteasome subunit beta type-5-B-...    256   1e-83    
ref|NP_001184978.1|  20S proteasome beta subunit E1                     252   4e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAT44125.1|  20S proteasome beta subunit E                           245   1e-79    Saussurea medusa
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     248   4e-79    Elaeis guineensis
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    245   1e-77    Oryza brachyantha
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     244   2e-77    Phoenix dactylifera
gb|AFW85805.1|  hypothetical protein ZEAMMB73_646691                    241   4e-77    
gb|ACU51028.1|  20S proteasome beta5 subunit                            242   2e-76    Conocephalum conicum
ref|XP_001759925.1|  predicted protein                                  241   2e-76    
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    241   3e-76    
ref|NP_001132821.1|  uncharacterized protein LOC100194311               241   4e-76    Zea mays [maize]
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    239   1e-75    Setaria italica
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          239   3e-75    Sorghum bicolor [broomcorn]
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       238   4e-75    Oryza sativa Japonica Group [Japonica rice]
gb|EEE65108.1|  hypothetical protein OsJ_20167                          238   9e-75    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056842.1|  Os06g0153800                                       237   1e-74    
gb|EEC80034.1|  hypothetical protein OsI_21721                          237   1e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             232   1e-72    Selaginella moellendorffii
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             232   1e-72    Selaginella moellendorffii
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    228   7e-71    Brachypodium distachyon [annual false brome]
gb|AAT80906.1|  26S proteasome beta subunit                             221   9e-71    Lemna minor
gb|AAU82107.1|  20S proteasome beta 5 subunit                           226   3e-70    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ97061.1|  predicted protein                                      224   1e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001751936.1|  predicted protein                                  215   2e-66    
dbj|BAG92607.1|  unnamed protein product                                213   6e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003061052.1|  predicted protein                                  209   9e-64    Micromonas pusilla CCMP1545
gb|ABD61730.2|  26S proteasome beta subunit                             203   2e-63    Lupinus albus
ref|XP_007514496.1|  predicted protein                                  209   3e-63    Bathycoccus prasinos
gb|EMS57921.1|  Proteasome subunit beta type-5                          206   5e-63    Triticum urartu
ref|XP_001421201.1|  predicted protein                                  208   5e-63    Ostreococcus lucimarinus CCE9901
ref|XP_002506817.1|  predicted protein                                  207   1e-62    Micromonas commoda
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...    205   5e-62    Ostreococcus tauri
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        219   7e-62    
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983              201   1e-60    Chlorella variabilis
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5         200   5e-60    Coccomyxa subellipsoidea C-169
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5         199   1e-59    Chlamydomonas reinhardtii
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437              198   1e-59    Volvox carteri f. nagariensis
ref|XP_011396916.1|  Proteasome subunit beta type-5-B                   197   7e-59    Auxenochlorella protothecoides
ref|XP_002889983.1|  hypothetical protein ARALYDRAFT_888660             187   6e-57    
gb|KDD75121.1|  proteasome subunit protein                              189   2e-56    Helicosporidium sp. ATCC 50920
ref|NP_001265983.1|  proteasome subunit beta type-5-like                187   8e-56    Cicer arietinum [garbanzo]
gb|ABQ50544.1|  hypothetical protein                                    186   2e-55    Brassica rapa
gb|EIE77859.1|  proteasome component PRE2                               184   8e-54    Rhizopus delemar RA 99-880
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        179   4e-53    Prunus persica
gb|EPB87271.1|  proteasome component PRE2                               181   6e-53    Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN10935.1|  20S proteasome subunit                                 181   6e-53    Mucor ambiguus
emb|CEP17612.1|  hypothetical protein                                   181   6e-53    Parasitella parasitica
ref|XP_002678668.1|  predicted protein                                  182   7e-53    Naegleria gruberi strain NEG-M
emb|CEG76258.1|  Putative Proteasome subunit beta type                  180   1e-52    Rhizopus microsporus
emb|CEG76257.1|  Putative Proteasome subunit beta type                  180   3e-52    Rhizopus microsporus
emb|CEJ04297.1|  Putative Proteasome subunit beta type                  177   3e-52    Rhizopus microsporus
emb|CAC43326.1|  putative beta5 proteasome subunit                      176   6e-52    Nicotiana tabacum [American tobacco]
ref|XP_005537552.1|  20S core proteasome subunit beta 5                 179   1e-51    Cyanidioschyzon merolae strain 10D
gb|ABE68720.1|  20S proteasome beta subunit                             176   1e-51    Arachis hypogaea [goober]
emb|CDH56820.1|  20s proteasome subunit                                 177   2e-51    Lichtheimia corymbifera JMRC:FSU:9682
emb|CBY21147.1|  unnamed protein product                                178   2e-51    Oikopleura dioica
ref|XP_006957104.1|  20S proteasome subunit                             178   2e-51    Wallemia mellicola CBS 633.66
ref|XP_002290272.1|  proteasome subunit beta type 5 precursor           176   5e-51    Thalassiosira pseudonana CCMP1335
ref|XP_009265754.1|  Proteasome component PRE2                          177   6e-51    Wallemia ichthyophaga EXF-994
gb|KFH71396.1|  20S proteasome subunit beta 5                           176   6e-51    Mortierella verticillata NRRL 6337
ref|XP_009038619.1|  hypothetical protein AURANDRAFT_28593              176   9e-51    Aureococcus anophagefferens
ref|XP_001730616.1|  hypothetical protein MGL_2412                      176   9e-51    Malassezia globosa CBS 7966
gb|EJU05281.1|  proteasome-domain-containing protein                    177   1e-50    Dacryopinax primogenitus
ref|XP_008036606.1|  proteasome component pts1                          176   1e-50    Trametes versicolor FP-101664 SS1
gb|AAS01050.1|  putative proteasome 20S beta5 subunit                   171   2e-50    Brassica napus [oilseed rape]
emb|CCU99044.1|  unnamed protein product                                174   4e-50    Malassezia sympodialis ATCC 42132
ref|XP_002111558.1|  hypothetical protein TRIADDRAFT_55706              174   4e-50    Trichoplax adhaerens
ref|XP_002162379.2|  PREDICTED: proteasome subunit beta type-5-like     174   4e-50    Hydra vulgaris
ref|XP_007863011.1|  20S proteasome subunit                             175   6e-50    Gloeophyllum trabeum ATCC 11539
emb|CCM00020.1|  predicted protein                                      174   6e-50    Fibroporia radiculosa
emb|CCO27714.1|  20S proteasome subunit beta 5                          174   6e-50    Rhizoctonia solani AG-1 IB
gb|KDQ60928.1|  hypothetical protein JAAARDRAFT_125152                  175   6e-50    Jaapia argillacea MUCL 33604
ref|XP_007006996.1|  hypothetical protein TREMEDRAFT_34309              174   7e-50    Tremella mesenterica DSM 1558
ref|XP_007395513.1|  hypothetical protein PHACADRAFT_255622             174   7e-50    Phanerochaete carnosa HHB-10118-sp
gb|AAM18885.1|AF391293_2  unknown                                       173   7e-50    Branchiostoma floridae
gb|KIY65291.1|  proteasome-domain-containing protein                    174   8e-50    Cylindrobasidium torrendii FP15055 ss-10
gb|KDE05583.1|  proteasome component PRE2                               174   8e-50    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_007385467.1|  N-terminal nucleophile aminohydrolase              174   1e-49    Punctularia strigosozonata HHB-11173 SS5
ref|XP_002730946.1|  PREDICTED: proteasome subunit beta type-5-like     173   1e-49    Saccoglossus kowalevskii
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                  173   1e-49    
ref|XP_003332961.2|  20S proteasome subunit beta 5                      173   1e-49    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_005713380.1|  20S core proteasome subunit beta 5                 173   1e-49    Chondrus crispus [carageen]
gb|EJK48257.1|  hypothetical protein THAOC_32963                        172   2e-49    Thalassiosira oceanica
gb|KEP54479.1|  proteasome subunit beta type-5 protein                  173   2e-49    Rhizoctonia solani 123E
ref|XP_007326468.1|  hypothetical protein AGABI1DRAFT_111072            173   2e-49    Agaricus bisporus var. burnettii JB137-S8
gb|EUC61688.1|  proteasome subunit beta type-5 protein                  173   2e-49    Rhizoctonia solani AG-3 Rhs1AP
emb|CCF49354.1|  probable PRE2-20S core proteasome subunit (beta5)      174   2e-49    Ustilago hordei
gb|ACP43316.1|  20S proteasome beta subunit 5                           170   2e-49    Citrus maxima [buntan]
ref|XP_006457891.1|  20S proteasome subunit                             173   2e-49    Agaricus bisporus var. bisporus H97
gb|KII89158.1|  hypothetical protein PLICRDRAFT_109139                  173   2e-49    Plicaturopsis crispa FD-325 SS-3
ref|XP_007418509.1|  20S proteasome subunit                             172   3e-49    Melampsora larici-populina 98AG31
gb|KIK59625.1|  hypothetical protein GYMLUDRAFT_201809                  172   3e-49    Gymnopus luxurians FD-317 M1
emb|CBN74512.1|  conserved unknown protein                              172   3e-49    Ectocarpus siliculosus
gb|KDQ33416.1|  hypothetical protein PLEOSDRAFT_1110569                 173   3e-49    Pleurotus ostreatus PC15
gb|KIK08153.1|  hypothetical protein K443DRAFT_672633                   172   3e-49    Laccaria amethystina LaAM-08-1
gb|KDR73611.1|  hypothetical protein GALMADRAFT_124865                  173   3e-49    Galerina marginata CBS 339.88
gb|KIJ17479.1|  hypothetical protein PAXINDRAFT_168130                  173   3e-49    Paxillus involutus ATCC 200175
ref|XP_007100520.1|  PREDICTED: proteasome subunit beta type-5 is...    169   4e-49    
ref|XP_001875479.1|  20S proteasome subunit                             172   4e-49    Laccaria bicolor S238N-H82
gb|KIM65350.1|  hypothetical protein SCLCIDRAFT_542814                  172   4e-49    Scleroderma citrinum Foug A
gb|EMS25821.1|  20S proteasome subunit beta 5                           172   4e-49    Rhodotorula toruloides NP11
ref|XP_002179855.1|  predicted protein                                  172   4e-49    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007361365.1|  N-terminal nucleophile aminohydrolase              172   5e-49    Dichomitus squalens LYAD-421 SS1
ref|XP_007764597.1|  20S proteasome subunit                             172   5e-49    Coniophora puteana RWD-64-598 SS2
gb|KJA27011.1|  hypothetical protein HYPSUDRAFT_35526                   172   6e-49    Hypholoma sublateritium FD-334 SS-4
ref|XP_007850837.1|  proteasome component pre2 precursor                172   6e-49    
gb|KDQ18004.1|  hypothetical protein BOTBODRAFT_104582                  172   7e-49    Botryobasidium botryosum FD-172 SS1
gb|KIL00906.1|  hypothetical protein PAXRUDRAFT_821100                  172   7e-49    Paxillus rubicundulus Ve08.2h10
ref|XP_007880004.1|  hypothetical protein PFL1_04286                    172   7e-49    Anthracocystis flocculosa PF-1
ref|XP_007449603.1|  PREDICTED: proteasome subunit beta type-5 is...    169   7e-49    Lipotes vexillifer [baiji]
ref|XP_004283229.1|  PREDICTED: proteasome subunit beta type-5 is...    169   7e-49    
ref|XP_002911819.1|  proteasome component pts1                          172   8e-49    Coprinopsis cinerea okayama7#130
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                  171   8e-49    Capitella teleta
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5          170   8e-49    Otolemur garnettii
emb|CDO73558.1|  hypothetical protein BN946_scf185014.g28               172   9e-49    Trametes cinnabarina
gb|KIJ69319.1|  hypothetical protein HYDPIDRAFT_79749                   171   1e-48    Hydnomerulius pinastri MD-312
ref|XP_008156743.1|  PREDICTED: proteasome subunit beta type-5 is...    168   1e-48    
gb|EAW66194.1|  proteasome (prosome, macropain) subunit, beta typ...    166   1e-48    Homo sapiens [man]
emb|CAA66313.1|  LMP7-like protein                                      169   1e-48    Botryllus schlosseri
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5          169   2e-48    Dasypus novemcinctus
gb|ELU16739.1|  hypothetical protein CAPTEDRAFT_41193                   166   2e-48    Capitella teleta
gb|EST08741.1|  20S proteasome, regulatory subunit beta type PSMB...    172   2e-48    Kalmanozyma brasiliensis GHG001
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative         170   2e-48    Acanthamoeba castellanii str. Neff
ref|XP_007321997.1|  hypothetical protein SERLADRAFT_475676             171   2e-48    Serpula lacrymans var. lacrymans S7.9
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like     169   2e-48    Myotis brandtii
gb|KIO13433.1|  hypothetical protein M404DRAFT_122218                   170   2e-48    Pisolithus tinctorius Marx 270
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5          169   2e-48    Galeopterus variegatus [Malayan flying lemur]
emb|CDI55907.1|  probable PRE2-20S core proteasome subunit (beta5...    171   3e-48    Melanopsichium pennsylvanicum 4
ref|XP_009541838.1|  subunit beta type peptidase T1A, 20S proteasome    170   3e-48    Heterobasidion irregulare TC 32-1
ref|XP_005267928.1|  PREDICTED: proteasome subunit beta type-5 is...    166   3e-48    
gb|EWM22648.1|  proteasome subunit beta type 5                          169   3e-48    Nannochloropsis gaditana
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...    167   3e-48    
ref|XP_004755395.1|  PREDICTED: proteasome subunit beta type-5 is...    167   3e-48    
dbj|BAA06097.1|  proteasome subunit X                                   167   3e-48    Homo sapiens [man]
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223             169   3e-48    Lottia gigantea
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...    167   3e-48    
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371              168   3e-48    Helobdella robusta
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...    169   4e-48    Physeter catodon
ref|XP_007989006.1|  PREDICTED: proteasome subunit beta type-5 is...    167   4e-48    Chlorocebus sabaeus
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5          167   4e-48    
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...    167   4e-48    synthetic construct
ref|XP_003363600.1|  PREDICTED: proteasome subunit beta type-5 is...    167   4e-48    
ref|XP_004347536.2|  hypothetical protein CAOG_04785                    170   4e-48    Capsaspora owczarzaki ATCC 30864
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510              169   4e-48    Batrachochytrium dendrobatidis JAM81
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5          168   4e-48    Carlito syrichta
gb|EPS96804.1|  hypothetical protein FOMPIDRAFT_1025230                 169   4e-48    Fomitopsis pinicola FP-58527 SS1
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5          168   5e-48    Myotis davidii
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5          168   5e-48    Tupaia chinensis
gb|KIY43500.1|  N-terminal nucleophile aminohydrolase                   169   5e-48    Fistulina hepatica ATCC 64428
ref|XP_009209435.1|  PREDICTED: proteasome subunit beta type-5 is...    166   5e-48    Papio anubis [baboon]
gb|KIP12266.1|  hypothetical protein PHLGIDRAFT_17679                   169   5e-48    Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...    168   6e-48    Orcinus orca [Orca]
gb|EIF47547.1|  proteasome component pre2 precursor                     169   6e-48    Brettanomyces bruxellensis AWRI1499
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...    168   6e-48    Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...    168   6e-48    Eptesicus fuscus
ref|XP_005560889.1|  PREDICTED: proteasome subunit beta type-5 is...    166   6e-48    
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...    168   6e-48    Lipotes vexillifer [baiji]
ref|XP_011391773.1|  putative proteasome core particle subunit be...    169   7e-48    Ustilago maydis 521
emb|CDQ73519.1|  unnamed protein product                                167   7e-48    Oncorhynchus mykiss
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5          168   7e-48    Myotis lucifugus
ref|XP_003954551.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    166   7e-48    
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5          168   8e-48    Saimiri boliviensis boliviensis
emb|CAD62626.1|  unnamed protein product                                166   8e-48    Homo sapiens [man]
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5          168   8e-48    Ovis aries [domestic sheep]
gb|KIK46362.1|  hypothetical protein CY34DRAFT_420304                   169   8e-48    Suillus luteus UH-Slu-Lm8-n1
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like     168   8e-48    
ref|XP_003260674.1|  PREDICTED: proteasome subunit beta type-5 is...    166   8e-48    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like     168   9e-48    Haplochromis burtoni
ref|NP_001138404.1|  proteasome subunit beta type-5 isoform 3           166   9e-48    Homo sapiens [man]
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like     168   9e-48    Pundamilia nyererei
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5          167   9e-48    Felis catus [cat]
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...    167   9e-48    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5          167   9e-48    Ochotona princeps [southern American pika]
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...    167   9e-48    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...    167   9e-48    Condylura cristata
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5          167   9e-48    Peromyscus maniculatus bairdii
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5          168   1e-47    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003036093.1|  hypothetical protein SCHCODRAFT_81440              169   1e-47    Schizophyllum commune H4-8
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like     168   1e-47    Oreochromis niloticus
ref|XP_007300583.1|  N-terminal nucleophile aminohydrolase              169   1e-47    Stereum hirsutum FP-91666 SS1
gb|KIM79653.1|  hypothetical protein PILCRDRAFT_823192                  169   1e-47    Piloderma croceum F 1598
ref|XP_006040730.1|  PREDICTED: proteasome subunit beta type-5-like     165   1e-47    
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...    167   1e-47    Oryctolagus cuniculus [domestic rabbit]
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit               169   1e-47    Tilletiaria anomala UBC 951
dbj|BAA08204.1|  proteasome subunit RCX                                 166   1e-47    Rattus rattus [house rat]
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5          167   1e-47    
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                  165   1e-47    
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5          167   1e-47    
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...    167   1e-47    
ref|XP_007319616.1|  hypothetical protein SERLADRAFT_470232             169   1e-47    
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...    165   1e-47    
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...    167   1e-47    
gb|KIL61310.1|  hypothetical protein M378DRAFT_861259                   168   1e-47    
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5          167   1e-47    
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5          167   1e-47    
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5          167   1e-47    
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5          167   1e-47    
ref|XP_004609529.1|  PREDICTED: proteasome subunit beta type-5          167   1e-47    
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5          167   1e-47    
ref|XP_010887405.1|  PREDICTED: proteasome subunit beta type-5 is...    164   2e-47    
gb|AAY98499.1|  LMP X                                                   167   2e-47    
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5          167   2e-47    
ref|XP_005139397.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    167   2e-47    
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5          167   2e-47    
ref|NP_001099197.2|  proteasome subunit beta type-5                     167   2e-47    
ref|XP_009242876.1|  PREDICTED: proteasome subunit beta type-5-like     167   2e-47    
gb|KFH65162.1|  20S proteasome subunit beta 5                           167   2e-47    
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like     167   2e-47    
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5          167   2e-47    
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5          166   3e-47    
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1              166   3e-47    
gb|AAB87680.1|  proteasome subunit X                                    165   3e-47    
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...    166   3e-47    
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5          167   3e-47    
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...    166   3e-47    
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...    166   3e-47    
emb|CAD97956.1|  hypothetical protein                                   166   3e-47    
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5          166   3e-47    
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5          166   3e-47    
ref|NP_001247774.1|  proteasome subunit beta type-5                     166   3e-47    
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5          166   3e-47    
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...    166   3e-47    
ref|XP_005707411.1|  20S proteasome subunit beta 5                      167   3e-47    
ref|NP_001032701.1|  proteasome subunit beta type-5                     166   3e-47    
gb|KIJ35744.1|  hypothetical protein M422DRAFT_180410                   164   3e-47    
gb|KIW62885.1|  proteasome subunit beta type-5                          167   3e-47    
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5          166   3e-47    
ref|XP_005809292.1|  PREDICTED: proteasome subunit beta type-5-like     166   3e-47    
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5          166   3e-47    
ref|XP_007723577.1|  proteasome component PRE2                          167   3e-47    
ref|XP_005825075.1|  20S proteasome subunit beta type 5                 167   3e-47    
gb|ELR56586.1|  Proteasome subunit beta type-5                          166   3e-47    
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5          166   3e-47    
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5          166   3e-47    
ref|XP_002132107.1|  PREDICTED: proteasome subunit beta type-5          166   4e-47    
gb|AAD53518.1|AF155578_1  proteasome subunit beta 5                     166   4e-47    
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...    166   4e-47    
gb|ADO27969.1|  proteasome subunit beta type-5                          166   4e-47    
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5          166   4e-47    
emb|CCA68455.1|  probable PRE2-20S core proteasome subunit (beta5...    167   4e-47    
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5          166   5e-47    
ref|XP_004994692.1|  LMP X protein                                      167   5e-47    
ref|NP_571226.1|  proteasome subunit beta type-5                        166   5e-47    
dbj|GAC98484.1|  20S proteasome subunit                                 171   5e-47    
emb|CAQ14651.1|  proteasome (prosome, macropain) subunit, beta ty...    166   5e-47    
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5          166   5e-47    
dbj|BAE93066.1|  low molecular mass polypeptide                         164   5e-47    
gb|AAI53590.1|  Psmb5 protein                                           166   5e-47    
ref|XP_001626004.1|  predicted protein                                  166   5e-47    
gb|KIW59603.1|  proteasome subunit beta type-5                          166   5e-47    
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5          166   5e-47    
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5          166   5e-47    
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor                164   6e-47    
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5          166   6e-47    
ref|XP_628966.1|  proteasome subunit beta type 5                        166   6e-47    
gb|AAI55951.1|  LOC100127332 protein                                    165   6e-47    
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5          165   7e-47    
ref|XP_011276949.1|  Proteasome subunit beta type-5                     166   7e-47    
emb|CBQ69839.1|  probable PRE2-20S core proteasome subunit (beta5)      167   7e-47    
gb|KIW80298.1|  hypothetical protein Z517_06913                         166   7e-47    
ref|XP_010887395.1|  PREDICTED: proteasome subunit beta type-5 is...    164   7e-47    
gb|AAB33092.1|  proteasome subunit MB1                                  164   7e-47    
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5    165   7e-47    
ref|XP_007552653.1|  PREDICTED: proteasome subunit beta type-5          166   7e-47    
gb|KIX98319.1|  proteasome subunit beta type-5                          166   7e-47    
ref|NP_035316.1|  proteasome subunit beta type-5                        165   7e-47    
ref|XP_008431210.1|  PREDICTED: proteasome subunit beta type-5          166   8e-47    
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...    163   8e-47    
ref|XP_008731643.1|  proteasome component PRE2                          166   8e-47    
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...    165   8e-47    
gb|KIW29970.1|  proteasome subunit beta type-5                          166   8e-47    
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5          166   8e-47    
ref|XP_007739562.1|  proteasome component PRE2                          166   8e-47    
ref|XP_001509497.1|  PREDICTED: proteasome subunit beta type-5          165   9e-47    
ref|XP_007761346.1|  proteasome component PRE2                          166   9e-47    
emb|CAF97719.1|  unnamed protein product                                165   9e-47    
ref|XP_009160370.1|  proteasome component PRE2                          166   9e-47    
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5          165   9e-47    
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5          165   9e-47    
ref|XP_010870425.1|  PREDICTED: proteasome subunit beta type-5-like     165   1e-46    
gb|KFH47961.1|  Proteasome subunit beta type-like protein               166   1e-46    
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5-like     165   1e-46    
gb|EPQ17641.1|  Proteasome subunit beta type-5                          167   1e-46    
emb|CBK22690.2|  unnamed protein product                                165   1e-46    
gb|KIW10869.1|  proteasome subunit beta type-5                          166   1e-46    
ref|XP_007730075.1|  proteasome component PRE2                          165   1e-46    
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...    165   1e-46    
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5          165   1e-46    
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5          165   1e-46    
emb|CDQ73245.1|  unnamed protein product                                165   1e-46    
ref|XP_006746559.1|  PREDICTED: proteasome subunit beta type-5          161   1e-46    
gb|KIW41006.1|  proteasome subunit beta type-5                          165   2e-46    
gb|ACH85299.1|  proteasome (prosome, macropain) subunit beta type 5     164   2e-46    
gb|ACM08263.1|  Proteasome subunit beta type-5 precursor                164   2e-46    
gb|ACI67172.1|  Proteasome subunit beta type-5 precursor                164   2e-46    
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5          164   2e-46    
gb|KJE01830.1|  proteasome subunit beta type-5                          165   2e-46    
gb|KIV81807.1|  proteasome subunit beta type-5                          165   2e-46    
ref|XP_006696296.1|  hypothetical protein CTHT_0059780                  165   2e-46    
ref|XP_571562.1|  proteasome component pts1                             165   2e-46    
gb|EDL31171.1|  mCG118255                                               163   2e-46    
ref|XP_003194765.1|  proteasome component                               165   2e-46    
gb|KIR99960.1|  proteasome subunit beta type-5                          165   2e-46    
gb|ACM08758.1|  Proteasome subunit beta type-5 precursor                164   2e-46    
ref|XP_002835466.1|  hypothetical protein                               165   2e-46    
ref|XP_005994469.1|  PREDICTED: proteasome subunit beta type-5-like     164   2e-46    
emb|CDK27355.1|  unnamed protein product                                164   2e-46    
gb|AFR96090.1|  proteasome component PRE2                               166   2e-46    
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5          164   2e-46    
dbj|GAA98585.1|  hypothetical protein E5Q_05272                         165   3e-46    
ref|XP_007821942.1|  hypothetical protein MAA_05753                     164   3e-46    
gb|KIJ26450.1|  hypothetical protein M422DRAFT_236567                   165   3e-46    
emb|CCX09778.1|  Similar to Proteasome component PRE2; acc. no. P...    164   3e-46    
ref|XP_011441202.1|  PREDICTED: proteasome subunit beta type-5-like     164   3e-46    
dbj|GAM85683.1|  hypothetical protein ANO11243_036910                   164   4e-46    
emb|CDQ86611.1|  unnamed protein product                                163   4e-46    
dbj|BAB26942.1|  unnamed protein product                                163   4e-46    
emb|CDR40695.1|  CYFA0S05e03378g1_1                                     164   4e-46    
ref|XP_008121563.1|  PREDICTED: proteasome subunit beta type-5          164   4e-46    
ref|XP_003287743.1|  proteasome subunit beta type 5                     163   4e-46    
gb|KIK31131.1|  hypothetical protein PISMIDRAFT_73645                   161   5e-46    
gb|AAL74417.1|  proteosome PSMB5/8 protein                              161   5e-46    
dbj|BAA10932.1|  LMPX of lamprey                                        163   5e-46    
gb|KEF54386.1|  proteasome component PRE2                               164   5e-46    
ref|XP_007439509.1|  PREDICTED: proteasome subunit beta type-5          163   5e-46    
ref|XP_006883201.1|  PREDICTED: proteasome subunit beta type-5          163   6e-46    
ref|XP_008718323.1|  hypothetical protein HMPREF1541_05764              163   6e-46    
gb|KGB75936.1|  proteasome component pts1                               165   7e-46    
gb|ETS60462.1|  hypothetical protein PaG_05302                          168   9e-46    
gb|KHN95162.1|  proteasome component PRE2 precursor                     163   1e-45    
gb|KIV93101.1|  proteasome subunit beta type-5                          163   1e-45    
gb|EMD38457.1|  20S proteasome subunit                                  164   1e-45    
dbj|BAA10931.1|  LMPX of hagfish                                        162   1e-45    
emb|CAA66312.1|  LMP7-like protein                                      162   1e-45    
gb|EWC46740.1|  proteasome component PRE2                               162   1e-45    
gb|KEQ89998.1|  proteasome-domain-containing protein                    162   2e-45    
gb|KEQ99430.1|  hypothetical protein AUEXF2481DRAFT_76056               162   2e-45    
ref|XP_005778345.1|  hypothetical protein EMIHUDRAFT_443537             162   2e-45    
gb|KEQ71620.1|  proteasome-domain-containing protein                    162   2e-45    
gb|KEQ58949.1|  proteasome-domain-containing protein                    162   2e-45    
ref|NP_001270574.1|  uncharacterized protein LOC101865806               162   2e-45    
gb|KIJ26736.1|  hypothetical protein M422DRAFT_216150                   162   2e-45    
gb|KIJ44798.1|  hypothetical protein M422DRAFT_67460                    162   2e-45    
ref|XP_007264066.1|  N-terminal nucleophile aminohydrolase              162   2e-45    
gb|KIX03620.1|  hypothetical protein Z518_07173                         162   2e-45    
dbj|GAK66792.1|  proteasome-domain-containing protein                   168   2e-45    
gb|KFY29536.1|  hypothetical protein V493_02281                         163   2e-45    
dbj|BAA10935.1|  nurse shark LMPX                                       161   3e-45    
ref|XP_006175925.1|  PREDICTED: proteasome subunit beta type-5          161   3e-45    
dbj|GAC77344.1|  20S proteasome, regulatory subunit beta type PSM...    168   3e-45    
ref|XP_007347836.1|  proteasome-domain-containing protein               162   4e-45    
ref|XP_011123539.1|  hypothetical protein AOL_s00083g57                 161   4e-45    
ref|XP_005110562.1|  PREDICTED: proteasome subunit beta type-5-like     161   4e-45    
emb|CCE40402.1|  hypothetical protein CPAR2_104380                      161   4e-45    
ref|XP_005290231.1|  PREDICTED: proteasome subunit beta type-5          160   5e-45    
ref|XP_009226325.1|  proteasome component PRE2                          161   5e-45    
gb|AHF22837.1|  PSMB8 proteasome subunit beta type 8                    160   7e-45    
gb|ELR08191.1|  20S proteasome subunit beta 5                           161   7e-45    
ref|XP_455453.1|  hypothetical protein                                  160   7e-45    
gb|EKD04801.1|  proteasome component                                    160   7e-45    
gb|EJT45706.1|  proteasome component                                    160   7e-45    
ref|XP_003388964.1|  PREDICTED: proteasome subunit beta type-5-like     160   7e-45    
ref|XP_002494106.1|  Beta 5 subunit of the 20S proteasome, respon...    160   8e-45    
ref|NP_593825.1|  20S proteasome component beta 5                       160   8e-45    
gb|KEZ44601.1|  Proteasome subunit beta type-5                          160   9e-45    
ref|XP_003851747.1|  proteasome core particle subunit beta 5            160   9e-45    
ref|XP_004181237.1|  hypothetical protein TBLA_0F01760                  160   9e-45    
ref|XP_007928014.1|  hypothetical protein MYCFIDRAFT_55997              160   9e-45    
gb|ACM09015.1|  Proteasome subunit beta type-5 precursor                160   9e-45    
gb|EMF13044.1|  proteasome subunit beta type-5 precursor                160   9e-45    
ref|XP_714824.1|  hypothetical protein CaO19.2233                       160   1e-44    
emb|CEJ94974.1|  Putative Proteasome subunit beta type                  160   1e-44    
gb|KGR00284.1|  proteasome component PRE2                               160   1e-44    
ref|XP_008027551.1|  hypothetical protein SETTUDRAFT_163798             160   1e-44    
gb|KGQ95684.1|  proteasome component PRE2                               160   1e-44    
ref|XP_007806219.1|  Proteasome component PRE2                          160   1e-44    
ref|XP_007683699.1|  hypothetical protein COCMIDRAFT_83732              160   1e-44    
ref|XP_008301219.1|  PREDICTED: proteasome subunit beta type-8          160   1e-44    
gb|KGK36555.1|  hypothetical protein JL09_g4296                         160   1e-44    
ref|XP_007676937.1|  hypothetical protein BAUCODRAFT_70978              160   1e-44    
ref|XP_003303688.1|  hypothetical protein PTT_16006                     160   1e-44    
ref|XP_002435468.1|  20S proteasome, regulatory subunit beta, put...    160   1e-44    
gb|EEH19404.1|  proteasome component PRE2                               160   1e-44    
ref|XP_007584467.1|  putative proteasome component pre2 protein         160   1e-44    
ref|XP_001745267.1|  hypothetical protein                               159   1e-44    
ref|XP_002418590.1|  macropain subunit, putative; multicatalytic ...    160   1e-44    
ref|XP_006963913.1|  proteasome catalytic subunit 3                     160   2e-44    
ref|XP_001384894.1|  hypothetical protein PICST_36375                   160   2e-44    
ref|XP_002618149.1|  proteasome component PRE2 precursor                160   2e-44    
gb|EKG17638.1|  Peptidase T1A proteasome beta-subunit                   160   2e-44    
ref|XP_003667884.1|  hypothetical protein NDAI_0A04860                  160   2e-44    
emb|CCE27886.1|  probable 20S core proteasome subunit PRE2              160   2e-44    
ref|XP_003845348.1|  similar to proteasome subunit beta type-5          160   2e-44    
ref|NP_001117007.1|  proteasome subunit beta type 7b                    159   2e-44    
gb|ABQ01989.1|  proteasome subunit beta type 8                          159   2e-44    
gb|ADL27419.1|  proteasome subunit beta type                            159   2e-44    
gb|ACI67854.1|  Proteasome subunit beta type-8 precursor                159   2e-44    
ref|XP_008329167.1|  PREDICTED: proteasome subunit beta type-8 is...    159   2e-44    
ref|XP_006036581.1|  PREDICTED: proteasome subunit beta type-5          159   2e-44    
dbj|BAO38798.1|  proteasome component PRE2                              159   2e-44    
emb|CDQ57423.1|  unnamed protein product                                159   2e-44    
ref|XP_001932350.1|  proteasome subunit beta type-5 precursor           159   2e-44    
gb|EFA82937.1|  proteasome subunit beta type 5                          159   2e-44    
emb|CDF89695.1|  ZYBA0S04-10418g1_1                                     159   2e-44    
emb|CDH13818.1|  Proteasome component PRE2                              159   2e-44    
dbj|BAD89554.1|  proteasome subunit                                     159   2e-44    



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP+RGESSELFD+IP  PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLRGESSELFDDIPSSPSFQIPNTTNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   306 bits (785),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD IP  PSFQIP+  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGIPSSPSFQIPDTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   301 bits (772),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAPI+GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPIKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP++GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   300 bits (767),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE  AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPRAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G +SEL       PSF++PN TDFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTVPLFGANSELLGGFSAAPSFELPNTTDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE  AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLEPAAPVSGAPSELVDGFSAAPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPVWGAPSELVDGFSAGPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G + ELF+     PSF++P  TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLFGATGELFNGFSTAPSFELPVTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   287 bits (734),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESXAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   287 bits (734),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESHAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   286 bits (733),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDF GL+ +AP++G + +L +EI   PSF++P   DFDGFQK A+QMVKPAKGTTTL
Sbjct  1    MMKIDFGGLDPSAPLKGNTDDLHNEILAAPSFKLPITADFDGFQKAAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  160



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   288 bits (738),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            VTM++IDFSGLE  + +RG  +EL   +   P FQIPN  DFDGFQK+++QMVKPAKGTT
Sbjct  66   VTMMKIDFSGLEPNSLLRGNPNELLSGLSTAPEFQIPNTNDFDGFQKESVQMVKPAKGTT  125

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  126  TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  185

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            CRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  186  CRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  227



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004171974.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   286 bits (732),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G + E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPLFGPTMEAMEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            H+LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HKLANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_007045045.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY00877.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=213

 Score =   284 bits (726),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   285 bits (728),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   284 bits (727),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++ID SGL+  AP++G S +L DEI   PSF++P   DFDGFQK A+QMVKPAKGTTTL
Sbjct  2    MMKIDLSGLDPLAPVKGNSDDLDDEIMAAPSFKLPTTVDFDGFQKAAVQMVKPAKGTTTL  61

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIF +GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  62   AFIFDKGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  121

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISVAGASKLL NILYSYRGMGLSVGTMIAGW
Sbjct  122  LHELANKRRISVAGASKLLGNILYSYRGMGLSVGTMIAGW  161



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   284 bits (726),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G   E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPMFGPRMEALEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR 
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRR  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   284 bits (726),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAP+   S+ +FD +   PSF++PN  DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPLFRSSNVIFDGLQMTPSFELPNALDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILY+YRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYNYRGMGLSVGTMIAGW  159



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAPI   S  +FD +   PSF +PN TDFDGFQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPIFRRSDFVFDGLQMTPSFDLPNPTDFDGFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILY+YRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYNYRGMGLSVGTMIAGW  159



>gb|KCW61971.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=201

 Score =   279 bits (714),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   281 bits (719),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPMIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   280 bits (715),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   P+F++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPAFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   278 bits (711),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D     PSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSAPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTA + G S+E  D +   PSF +P+  D DGF K+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTASLFGASNEFHDGLSTAPSFDLPSNVDLDGFLKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLES  P+ G +  SE+ D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGLESNVPMFGRNCESEMLDGLSDVPSFDLPLANDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++ID SGL+ +AP++  + +L +EI   PSF +P   DFDGFQK +IQMVKPA+GTTTL
Sbjct  1    MMKIDLSGLDPSAPMKRNTDDLDNEILATPSFALPTTVDFDGFQKASIQMVKPARGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRIS+AGASK+LANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISIAGASKMLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            ++ID SGLES  P+ G  +EL D     PSF++P  TDFDGFQK+A Q +KPAKGTTTLA
Sbjct  1    MKIDLSGLESAFPLFGGGNELSDGFSAAPSFELPCSTDFDGFQKEAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   276 bits (707),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   276 bits (706),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   276 bits (706),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFTTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   276 bits (706),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   276 bits (705),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTVGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   276 bits (705),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   276 bits (705),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFESSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   276 bits (705),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG EST P+ G    +E+ D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFESTLPMFGGNTETEMLDGLSSVPSFDLPFTKDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVPGASKLLANMLYSYRGMGLSVGTMIAGW  161



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPA+GTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPARGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPLIGFGSSNDMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   274 bits (701),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG+MAGG+ADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGSMAGGSADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   273 bits (699),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 145/162 (90%), Gaps = 3/162 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D    VPSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSVPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS-SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            LAFIFKEGVMVAADSRASMGGYI  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   LAFIFKEGVMVAADSRASMGGYICMSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            CRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  CRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  162



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   272 bits (696),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES +P+    +E  +     PSF++P  TDFDGFQKDA Q +KPAKGTTTLA
Sbjct  1    MKLDLSGLESASPLFAVGNEFSNGFSAAPSFELPCTTDFDGFQKDAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLL NILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLTNILYSYRGMGLSVGTMIAGW  159



>ref|XP_006842100.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
 gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGL S AP    + EL +    +PSFQ+PN  DFD FQK A+QMVKPAKGTTTLA
Sbjct  6    MRLDTSGLNSLAPAHVVNDELCEGFMSLPSFQLPNSADFDTFQKKAVQMVKPAKGTTTLA  65

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPY++GT+AGGAADCQFWHRNLG+KCRL
Sbjct  66   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYLIGTLAGGAADCQFWHRNLGIKCRL  125

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  126  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  164



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGL+S   I G + + L +++   PSFQ+P  +DFDGFQKDAIQMVKPAKGTTTL
Sbjct  1    MKLDLSGLQSFTSIPGGAVDGLGEDLFAAPSFQLPACSDFDGFQKDAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   271 bits (692),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL+S  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQSFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|KDO81953.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=212

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    S++   +   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPSLLAPQSDVVGALSAAPSFDLPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   PSF +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPSFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP+ G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPLSGSIDDVCSDLSAHQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FVFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGT+AGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTVAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   269 bits (688),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +  +  L D     PSF+IPN  DFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQLSNDNLCDVFSPTPSFEIPNDADFDGFQKAAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINPY+LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   269 bits (687),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   268 bits (686),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|KDO81951.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=302

 Score =   269 bits (688),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 3/162 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESS-ELFD--EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            ++ D SGLEST+ + G +  EL D       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTSSVFGTAGRELVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            CRLHELANKRRISV GASKLLANIL+SYRGMGLSVGTMIAGW
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSYRGMGLSVGTMIAGW  162



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIF EG MVAA SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFIEGAMVAAASRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPKLVAPGNDVVGEFTAPPSFELPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASK+LANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKMLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP  G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPRSGLIDDVCSDLSAQQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_006484069.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X1 [Citrus 
sinensis]
Length=302

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004159677.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   267 bits (682),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             HEL NKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  RHELENKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  160



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   267 bits (682),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   P F +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPFFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   267 bits (682),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +     L D     PSF+IPN TDFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQRSDDNLCDVFSPSPSFKIPNDTDFDGFQKAALQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINP++LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPHLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSIGTMIAGW  159



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 141/162 (87%), Gaps = 3/162 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDE---IPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            ++ D SGLESTA + G +   F +       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTASVFGTAGREFVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGG ADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGGADCQFWHRNLGIK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            CRLHELANKRRISV GASKLLANIL+SYRGMGLSVGTMIAGW
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSYRGMGLSVGTMIAGW  162



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   267 bits (683),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  17   MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  76

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  77   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCR  136

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             HEL NKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  137  RHELENKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  176



>ref|XP_006438071.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51311.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=271

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKEASNMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_006438070.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51310.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=302

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  159



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKEAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   266 bits (680),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIP----RVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            M ++DFS L++TAP+ G+SS      P      PSF++P   DFDGFQK+A  MVK  KG
Sbjct  1    MRQLDFSSLQTTAPLLGDSSGFSGGFPGDFSAAPSFEVPVTDDFDGFQKEARDMVKSKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  121  IKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  164



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   265 bits (678),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  158



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDVLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGW  161



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   264 bits (674),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISS SVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSHSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  158



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   263 bits (673),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LANKRRISV GASKLLANILYSYRGMG SVGTMIAGW
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGSSVGTMIAGW  158



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   263 bits (673),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LANKRRISV GASKLLANILYSYRGMG SVGTMIAGW
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGSSVGTMIAGW  158



>ref|XP_002514943.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
 gb|EEF47497.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
Length=249

 Score =   263 bits (671),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 2/161 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG ESTAP+ G   SSE+ +      SF++P  +DFDGFQ +A Q +K AKGTTT
Sbjct  1    MKLDTSGFESTAPLFGASSSSEMVNGFSAPASFELPVTSDFDGFQSEAKQTLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RLHELANKRRISV GASKLLANILY+YRGMGLSVGTM+AGW
Sbjct  121  RLHELANKRRISVTGASKLLANILYNYRGMGLSVGTMVAGW  161



>ref|XP_010440898.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=160

 Score =   256 bits (654),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  299
            G ++E+FD +  VPSF +P  TDFDGFQK +++MVKPAKGTTTLAFIFKEGVMVAADSRA
Sbjct  7    GSNNEMFDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTTLAFIFKEGVMVAADSRA  66

Query  300  SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGAS  479
            SMGGYISS S+K IIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GAS
Sbjct  67   SMGGYISSPSMK-IIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGAS  125

Query  480  KLLANILYSYRGMGLSVGTMIAGW  551
            KLLAN+LYSYRGM LSVGTMIAGW
Sbjct  126  KLLANMLYSYRGMRLSVGTMIAGW  149



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   252 bits (643),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 142/185 (77%), Gaps = 26/185 (14%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS------------------------SQSVKKIIEINP  356
            LAFIFK GVMVAADSRASMGGYIS                        SQSVKKIIEINP
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISVSSLKNSSKNMHPFDIVDFGRNTTSQSVKKIIEINP  120

Query  357  YMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGT  536
            YMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGT
Sbjct  121  YMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGT  180

Query  537  MIAGW  551
            MIAGW
Sbjct  181  MIAGW  185



>gb|AAT44125.1| 20S proteasome beta subunit E [Saussurea medusa]
Length=150

 Score =   245 bits (626),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++DF GLES+AP+ G + + L D     PSF +P  +DFDGFQK +IQMVKPAKGTTTL
Sbjct  1    MKLDFGGLESSAPLYGGNDDVLSDGFSTAPSFDLPVTSDFDGFQKSSIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAA+SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAANSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSY  509
            LHELANKRRISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES AP+ G   +L  E+   PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFAPLHGGMDDLHGELWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINP+M+ T+AGGAADC FWHRNLGVKCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPHMIATVAGGAADCIFWHRNLGVKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +EL NKRRISVAGASKLL N+LYSYRGM LSVGTMIAGW
Sbjct  121  YELENKRRISVAGASKLLTNMLYSYRGMELSVGTMIAGW  159



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 139/163 (85%), Gaps = 4/163 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIR--GESSE--LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D S +E+   +R  GE  +  +F     +P+ ++P   DFDGFQK+A +++K  KGT
Sbjct  1    MKLDVSAMENNFAVRCGGEDDDGGIFGAGADLPAMELPTCADFDGFQKEAKELMKNKKGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+
Sbjct  61   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGI  120

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            KCRLHELANKRRISVAGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  121  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSIGTMIAGW  163



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES A   GE  +L  E    PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFASFHGEMDDLHGEFWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINPYM+ T+AGGAADC FWHRNLG+KCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPYMIATVAGGAADCIFWHRNLGMKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  548
            +EL NKRRISVAGASKLL N+LYSYRGMGLS+GTM+AG
Sbjct  121  YELENKRRISVAGASKLLTNMLYSYRGMGLSIGTMVAG  158



>gb|AFW85805.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=203

 Score =   241 bits (615),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 3/164 (2%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  165



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 131/164 (80%), Gaps = 5/164 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-----LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            +R+DF+GL+     R  S +      +D I   PSF +P + D DGF+K A+ MVKP  G
Sbjct  1    MRLDFAGLDPVTLRRPSSGDGGFDVAYDSIGSAPSFNLPAVADLDGFEKAAVDMVKPLHG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAF+FKEGV+VAADSRASMG YISSQ VKKI+EINPY+LGTMAGGAADCQFW RNLG
Sbjct  61   TTTLAFVFKEGVIVAADSRASMGNYISSQDVKKILEINPYLLGTMAGGAADCQFWQRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             +CRLHEL NKRRISV GASKLLAN LYSYRGMGLS+GTMIAGW
Sbjct  121  TRCRLHELGNKRRISVTGASKLLANTLYSYRGMGLSMGTMIAGW  164



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PSF++P + D DGFQK A+QMVKPAKGTTTLAF+FK GV+VAADSRASMG YISSQSVKK
Sbjct  27   PSFELPAVADLDGFQKAAVQMVKPAKGTTTLAFVFKHGVIVAADSRASMGNYISSQSVKK  86

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            I+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISV GASKLLAN LYSYRGM
Sbjct  87   ILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVTGASKLLANTLYSYRGM  146

Query  519  GLSVGTMIAGW  551
            GLS+GTMIAGW
Sbjct  147  GLSMGTMIAGW  157



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 3/164 (2%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  165



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   241 bits (615),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 3/164 (2%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  165



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 131/163 (80%), Gaps = 4/163 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI----RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D S LE+   +     G+      E P VPS  +P   DFDGFQ     MVK  KGT
Sbjct  3    MKLDMSALETNFAVPCGDDGDGMYFSAEAPDVPSMVLPTCADFDGFQAATKDMVKNKKGT  62

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG 
Sbjct  63   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGN  122

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  123  KCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  165



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +3

Query  75   VRIDFSGLES-----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            +++D S LE+     T P   + +      P VPS  +P   DFDGFQ D   MVK  KG
Sbjct  3    MKVDMSALETNFANMTFPAS-DDTYFSAGAPDVPSMVLPTCDDFDGFQADTKAMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  122  NKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  165



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 136/164 (83%), Gaps = 5/164 (3%)
 Frame = +3

Query  75   VRIDFSGLEST----APIRGESSELFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+     A  R +   LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGREDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  164



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   238 bits (606),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+    +    E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAQAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  164



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 134/164 (82%), Gaps = 5/164 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  164



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 134/164 (82%), Gaps = 5/164 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  164



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  5    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  64

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  65   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  124

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LANKRRISVAGASKLLAN LYSYRGMGLS+GTMIAGW
Sbjct  125  LANKRRISVAGASKLLANTLYSYRGMGLSMGTMIAGW  161



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  3    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  62

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  63   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  122

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            LANKRRISVAGASKLLAN LYSYRGMGLS+GTMIAGW
Sbjct  123  LANKRRISVAGASKLLANTLYSYRGMGLSMGTMIAGW  159



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   228 bits (580),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +3

Query  75   VRIDFSGLES---TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            +R+D S LE+    AP       +F       + + P   DFDGFQK    MV   KGTT
Sbjct  1    MRLDVSALENHHFAAPGNEFGGGVFAADTEELAMEFPTCNDFDGFQKATKDMVNNKKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG K
Sbjct  61   TLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGTK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            CRLHELANKRRIS+AG+SK+LANILYSYRGMGLS+GTMIAG+
Sbjct  121  CRLHELANKRRISIAGSSKMLANILYSYRGMGLSIGTMIAGF  162



>gb|AAT80906.1| 26S proteasome beta subunit [Lemna minor]
Length=116

 Score =   221 bits (564),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/110 (95%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            VKPAKGTTTLAFIFKEGV+V+ADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF
Sbjct  1    VKPAKGTTTLAFIFKEGVIVSADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  60

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            WHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  61   WHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSIGTMIAGW  110



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCNDFDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMG
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMG  154

Query  522  LSVGTMIAGW  551
            LS+GTMIAG+
Sbjct  155  LSIGTMIAGF  164



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGFQK    MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCDDFDGFQKATKAMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMG
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMG  154

Query  522  LSVGTMIAGW  551
            LS+GTMIAG+
Sbjct  155  LSIGTMIAGF  164



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  189  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGFQK A+Q+VKPAKGTTTLAF+FK GV+VAADS ASMG  ISSQSVKKI+EINPY+LG
Sbjct  1    LDGFQKAAVQLVKPAKGTTTLAFVFKHGVIVAADSSASMGNSISSQSVKKILEINPYLLG  60

Query  369  TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  548
            TMAGGAADCQFW RNLG +CRLHELANKR ISV GASKLLAN LYSYRGMGL +GTMIAG
Sbjct  61   TMAGGAADCQFWQRNLGTRCRLHELANKRHISVTGASKLLANTLYSYRGMGLFMGTMIAG  120

Query  549  W  551
            W
Sbjct  121  W  121



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   213 bits (543),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
            M+K  KGTTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MLKHKKGTTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  399  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            FWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGW
Sbjct  61   FWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGW  111



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score =   209 bits (533),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 127/163 (78%), Gaps = 4/163 (2%)
 Frame = +3

Query  75   VRIDFSGLES-TAPIRGESSELFDEIP---RVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++DFS L++ T  I  E +E   EI       +F++P + ++D FQ++ +  VKP  GT
Sbjct  1    MKLDFSVLDAPTRKIDAEIAECAAEINSDVHAQNFKLPMVENYDSFQREVVDYVKPNHGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  61   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  120

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +CRLHEL N +RISV+GASKLL+N LY YRG GLS+GTM+AGW
Sbjct  121  QCRLHELENGKRISVSGASKLLSNTLYGYRGQGLSMGTMVAGW  163



>gb|ABD61730.2| 26S proteasome beta subunit [Lupinus albus]
Length=127

 Score =   203 bits (517),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            +TLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+
Sbjct  1    STLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGI  60

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            KCRLHELANKRRISV GASKLLANILYSYR MG SVGTMIAGW
Sbjct  61   KCRLHELANKRRISVTGASKLLANILYSYRRMGYSVGTMIAGW  103



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 124/171 (73%), Gaps = 11/171 (6%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIP---------RVPSFQIPNITDFDGFQKDAIQ  218
            +T + +DFS L+   P+R E+ EL   +              F IP + DF  FQKD ++
Sbjct  1    MTSLNLDFSVLDR--PVRKEADELTSTLENDVLCGINTHDQYFTIPRVEDFSRFQKDVVE  58

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
             VKP  GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQ
Sbjct  59   HVKPQHGTTTLGFIFEHGIIIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQ  118

Query  399  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            FW RNLG++CRLHEL   +RI+V GASKLLAN LY YRG GLS+GTM+AGW
Sbjct  119  FWQRNLGIQCRLHELETGKRITVTGASKLLANTLYGYRGRGLSMGTMVAGW  169



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   206 bits (523),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
            MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  399  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            FWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG+
Sbjct  61   FWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAGF  111



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 126/165 (76%), Gaps = 10/165 (6%)
 Frame = +3

Query  81   IDFSGLESTAPIRG--------ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            +DFS L++TA  RG        ES +  D      +F+ P + DF+GFQ++ I  VKP  
Sbjct  6    LDFSFLDATA--RGSMASKHVDESLDAIDGNMHECNFKAPAVEDFEGFQREVINYVKPNH  63

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAFIF+ G++VA DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  64   GTTTLAFIFEHGIVVAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  123

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            G++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS+GTM+AGW
Sbjct  124  GIQCRLHELENGKRITVRAASKLLANTLYSYKGKGLSMGTMVAGW  168



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  75   VRIDFSGLES----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D+S L++    T  I  + +          +F++P + ++D FQ++ +  VKP  GT
Sbjct  4    LKLDYSVLDAPQRATDRIEADCAREIHGDVHAQNFKLPMVENYDEFQREVVDYVKPNHGT  63

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  64   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  123

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +CRLHEL N +RISVAGASKLLAN LY YRG GLS+GTM+AGW
Sbjct  124  QCRLHELENGKRISVAGASKLLANTLYGYRGQGLSMGTMVAGW  166



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +3

Query  75   VRIDFSGLEST------APIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            V +D S L  T         R E+ +         +F  P + DFD FQ++ I  VKPA 
Sbjct  3    VNLDLSFLHDTERGAASTKYRDEALQGVSNSVHASNFTAPAVEDFDAFQREVINYVKPAH  62

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  63   GTTTLGFIFEHGIVIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  122

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            G++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS+GTMIAGW
Sbjct  123  GIQCRLHELENGKRITVRAASKLLANTLYSYKGRGLSMGTMIAGW  167



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   219 bits (557),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  189   FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             FDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLG
Sbjct  1285  FDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLG  1344

Query  369   TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  548
             TMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG
Sbjct  1345  TMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAG  1404

Query  549   W  551
             +
Sbjct  1405  F  1405



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFD---EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            M+++D S LE  A    E   L         V SF +P + D D F+++ ++ VKP  GT
Sbjct  1    MMKLDLSCLEPAAGAGREPCGLEAAGVSGVAVDSFPLPAVADIDSFEREVVEYVKPNHGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNLG 
Sbjct  61   TTLGFIFQGGVIIAVDSRASQGSYISSQTVKKVIEINPHLLGTMAGGAADCQFWERNLGR  120

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +CRL+ELAN +RI+V GASKLLAN ++SYRGMGLS+GTM+AGW
Sbjct  121  QCRLYELANGKRITVRGASKLLANTMFSYRGMGLSMGTMVAGW  163



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 124/164 (76%), Gaps = 5/164 (3%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKG  239
            M ++DFS L S  P+  +S    +++  + S    F +P + D D F+ + +  VKP  G
Sbjct  1    MDKLDFSALCSR-PLSEKSGACVEDVASITSAVQDFPLPQVQDVDRFENEVMSYVKPNHG  59

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTL FIFK GV++A DSRASMG YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG
Sbjct  60   TTTLGFIFKYGVIIAVDSRASMGSYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLG  119

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             +CRL+EL N +RISV  ASKLLAN+++SY+G GLS+GTM+AG+
Sbjct  120  QQCRLYELNNGKRISVRAASKLLANVMFSYKGYGLSMGTMVAGY  163



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            SF +P + D D F+++ ++MVKP  GTTTL FIF+ GV++A DSRA+MG YISSQ+VKK+
Sbjct  34   SFPLPAVQDVDKFEREVVEMVKPCHGTTTLGFIFQHGVIIAVDSRATMGAYISSQTVKKV  93

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEIN ++LGTMAGGAADCQFW RNLG++CRL+EL N +RI+V  ASKLL+N+++SYRGMG
Sbjct  94   IEINKFLLGTMAGGAADCQFWQRNLGMQCRLYELNNGKRITVRAASKLLSNVMFSYRGMG  153

Query  522  LSVGTMIAGW  551
            LS+GTM+AGW
Sbjct  154  LSMGTMVAGW  163



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = +3

Query  78   RIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++D   LE  A  +G     +L  ++P   SF +P + D D F+++ ++MVKP  GTTTL
Sbjct  4    KLDLGILEPNAGRKGPGLGPDLQLDVP-TASFPLPAVQDLDKFEREVVEMVKPCHGTTTL  62

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
             FIF+ GV++A DSRA+MG +ISSQ+VKK+IEIN +++GTMAGGAADCQFW RNLG++CR
Sbjct  63   GFIFQHGVIIAVDSRATMGSFISSQTVKKVIEINKHLIGTMAGGAADCQFWQRNLGMRCR  122

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            L+EL N +RI+V  ASKLLAN ++SYRGMGLS+GTM+AGW
Sbjct  123  LYELNNGKRITVCAASKLLANTMFSYRGMGLSMGTMVAGW  162



>ref|XP_011396916.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
 gb|KFM24035.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
Length=277

 Score =   197 bits (500),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 112/135 (83%), Gaps = 3/135 (2%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  335
            + +F +P + D D F+K+ ++ VKP+ GTTTL FIF+ GV+VA DSRAS G YISSQ+VK
Sbjct  31   IDAFPLPAVADLDSFEKEVVEYVKPSHGTTTLGFIFQGGVIVAVDSRASQGSYISSQTVK  90

Query  336  KIIEINPYMLGTMAGGAADCQFWHRNLG---VKCRLHELANKRRISVAGASKLLANILYS  506
            K+IEINP++LGTMAGGAADCQFW RNLG   V CRL+EL N +RI+V GASKLLAN ++S
Sbjct  91   KVIEINPFLLGTMAGGAADCQFWERNLGRQVVWCRLYELNNGKRITVRGASKLLANTMFS  150

Query  507  YRGMGLSVGTMIAGW  551
            YRGMGLS+GTM+AGW
Sbjct  151  YRGMGLSMGTMVAGW  165



>ref|XP_002889983.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66242.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score =   187 bits (475),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +3

Query  276  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR  455
            MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLH LANKR
Sbjct  1    MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHALANKR  60

Query  456  RISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RISV+GASKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  61   RISVSGASKLLANMLYSYRGMGLSVGTMIAGW  92



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  189  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGF++  ++ VKP+ GTTTL FIF+ GV++A DSRAS G Y+SSQ+VKK+IEINPY+LG
Sbjct  9    LDGFERSVVEYVKPSHGTTTLGFIFQGGVIIAVDSRASQGSYLSSQTVKKVIEINPYLLG  68

Query  369  TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  548
            TMAGGAADCQFW RNLG +CRL+EL   RRI+V  ASKLLAN ++SYRGMGLS+GTMIAG
Sbjct  69   TMAGGAADCQFWERNLGRQCRLYELKEGRRITVKAASKLLANTMFSYRGMGLSMGTMIAG  128

Query  549  W  551
            W
Sbjct  129  W  129



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 107/159 (67%), Gaps = 34/159 (21%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFPSLISHGNDVVGEFEAPPSFELPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAAD                                  CQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAAD----------------------------------CQFWHRNLGIKCRL  86

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  87   HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGW  125



>gb|ABQ50544.1| hypothetical protein [Brassica rapa]
Length=218

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 108/144 (75%), Gaps = 7/144 (5%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  299
            G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTTLAFIFKEGVMVAADSRA
Sbjct  7    GSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTTLAFIFKEGVMVAADSRA  66

Query  300  SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR-LHELANK------RR  458
            SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K   L+ + N+       R
Sbjct  67   SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKGPGLYYVDNEGGRLKGDR  126

Query  459  ISVAGASKLLANILYSYRGMGLSV  530
             SV   S     +L S     +SV
Sbjct  127  FSVGSGSPYAYGVLDSGYKFDMSV  150



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score =   184 bits (466),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPA------KGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            PSF +P I +   F ++      P        GTTTLAF F+ GV+VA DSRA+MG YIS
Sbjct  37   PSFDVPAIHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIS  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSYRGMGLSVGTMIAGW  551
            YSY+GMGLS+GTM+ GW
Sbjct  157  YSYKGMGLSMGTMVTGW  173



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +3

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            +SRASMGGYISSQSV+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV
Sbjct  1    NSRASMGGYISSQSVEKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISV  60

Query  468  AGASKLLANILYSYRGMGLSVGTMIAGW  551
             GASKLLANILYSYRGMGLSVGTMIAGW
Sbjct  61   TGASKLLANILYSYRGMGLSVGTMIAGW  88



>gb|EPB87271.1| proteasome component PRE2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=277

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 106/141 (75%), Gaps = 14/141 (10%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSYRGMGLSVGTMIAGW  551
            AN++Y+Y+GMGLS+GTM+ GW
Sbjct  153  ANMVYAYKGMGLSMGTMVTGW  173



>dbj|GAN10935.1| 20S proteasome subunit [Mucor ambiguus]
Length=277

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 106/141 (75%), Gaps = 14/141 (10%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSYRGMGLSVGTMIAGW  551
            AN++Y+Y+GMGLS+GTM+ GW
Sbjct  153  ANMVYAYKGMGLSMGTMVTGW  173



>emb|CEP17612.1| hypothetical protein [Parasitella parasitica]
Length=277

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 106/141 (75%), Gaps = 14/141 (10%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            P+F IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PAFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQHGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSYRGMGLSVGTMIAGW  551
            AN++Y+Y+GMGLS+GTM+ GW
Sbjct  153  ANMVYAYKGMGLSMGTMVTGW  173



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 128/186 (69%), Gaps = 11/186 (6%)
 Frame = +3

Query  21   P*VESTPSFYSRYLVVTMVRIDFSGLESTAPIRGESSELFDEIPRVP-------SFQIPN  179
            P  ++T SF     + +++  DF+ L S  P   ++  L D    +         F +P 
Sbjct  5    PSTKTTKSFKQGANLSSVLSSDFTSL-SIGPQDEDNVILQDPCLDISYGLDGQQGFALPP  63

Query  180  ITDFDGF--QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEIN  353
              +  GF  QK+ ++    AKGTTTL F+F +G+++A DSRASMG YISSQ+VKK+IEIN
Sbjct  64   SLNNSGFIHQKEKLEKTY-AKGTTTLGFVFNKGIVIAVDSRASMGNYISSQNVKKVIEIN  122

Query  354  PYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVG  533
            PY+LGTMAGGAADCQFW R LG++CRL+EL NKRRISVA ASKLL+NI+Y Y+  GLS+G
Sbjct  123  PYLLGTMAGGAADCQFWERYLGMQCRLYELRNKRRISVAAASKLLSNIVYQYKDHGLSMG  182

Query  534  TMIAGW  551
            TMIAGW
Sbjct  183  TMIAGW  188



>emb|CEG76258.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=246

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPA------KGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F +P + +   F ++      P        GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSYRGMGLSVGTMIAGW  551
            YSY+GMGLS+GTM+ GW
Sbjct  157  YSYKGMGLSMGTMVTGW  173



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPA------KGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F +P + +   F ++      P        GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSYRGMGLSVGTMIAGW  551
            YSY+GMGLS+GTM+ GW
Sbjct  157  YSYKGMGLSMGTMVTGW  173



>emb|CEJ04297.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=206

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +3

Query  171  IPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEI  350
            + N+TD    ++     +K   GTTTLAF F+ GV+VA DSRA+MG YI+SQ+VKK+IEI
Sbjct  11   LRNVTD----EESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIASQTVKKVIEI  66

Query  351  NPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSV  530
            NPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+GMGLS+
Sbjct  67   NPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYKGMGLSM  126

Query  531  GTMIAGW  551
            GTM+ GW
Sbjct  127  GTMVTGW  133



>emb|CAC43326.1| putative beta5 proteasome subunit [Nicotiana tabacum]
Length=174

 Score =   176 bits (445),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRR SVAGA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRTSVAGA  60

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLANILYSYRGMGLSVGTMIAGW
Sbjct  61   SKLLANILYSYRGMGLSVGTMIAGW  85



>ref|XP_005537552.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81516.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
Length=299

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
             +PR  S   P + D    ++++  +VK   GTTTLAF+F++G++VA DSRASMG YI S
Sbjct  41   RVPRGASIA-PRLRDVLRDEQNS-SLVKFLHGTTTLAFVFRDGIIVAVDSRASMGQYIGS  98

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILY  503
             +VKKIIEINPY+LGTMAGGAADC FW R LG++CRLHEL ++ RISVA ASKLLANI+Y
Sbjct  99   GTVKKIIEINPYLLGTMAGGAADCSFWERYLGMRCRLHELQHRERISVAAASKLLANIVY  158

Query  504  SYRGMGLSVGTMIAGW  551
             Y+GMGLS+GTMIAGW
Sbjct  159  EYKGMGLSMGTMIAGW  174



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GA
Sbjct  26   ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGA  85

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLANILYSYRGMGLSVGTMIAGW
Sbjct  86   SKLLANILYSYRGMGLSVGTMIAGW  110



>emb|CDH56820.1| 20s proteasome subunit [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14360.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=277

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 104/137 (76%), Gaps = 6/137 (4%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F IP++ +   F +           +K   GTTTLAF F+ GV+VA DSRA+MG YI 
Sbjct  37   PTFDIPDVHNPVDFLRSVTDEDSPDYKIKIQHGTTTLAFQFQGGVIVAVDSRATMGNYIG  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASKLL N++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKLLGNMV  156

Query  501  YSYRGMGLSVGTMIAGW  551
            YSY+GMGLS+GTMI GW
Sbjct  157  YSYKGMGLSMGTMITGW  173



>emb|CBY21147.1| unnamed protein product [Oikopleura dioica]
 emb|CBY40350.1| unnamed protein product [Oikopleura dioica]
Length=287

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P F  P +     F  D    +K   GTT LAF FK GVMVA DSRA+ GGYI+SQ VKK
Sbjct  52   PPFSNPQLHLDQNFGDDKPVKIKFNHGTTCLAFKFKHGVMVATDSRATAGGYIASQEVKK  111

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADCQFW R L ++CRL+EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  112  VIEINPYLLGTMAGGAADCQFWERVLAMECRLYELRNKERISVAAASKLLANMVYQYKGM  171

Query  519  GLSVGTMIAGW  551
            GLS+GTM+ GW
Sbjct  172  GLSMGTMVCGW  182



>ref|XP_006957104.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
 gb|EIM23071.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
Length=288

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +P+  +PN  D  GF       Q+D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  29   IPTLDLPNTADPTGFLRTYTDDQQDPSCRIKINHGTTTLAFKFKGGVIVAVDSRATAGSY  88

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK L+N
Sbjct  89   VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKYLSN  148

Query  495  ILYSYRGMGLSVGTMIAGW  551
            I YSY+G GLS+GTMI GW
Sbjct  149  ITYSYKGKGLSMGTMICGW  167



>ref|XP_002290272.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92024.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
Length=276

 Score =   176 bits (447),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 8/129 (6%)
 Frame = +3

Query  165  FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKII  344
            F++PN+ D  G        VK AKGTTTLAF F  G++V+ DSR++MG YI+S +VKK+I
Sbjct  50   FEVPNVADVSG--------VKFAKGTTTLAFKFNGGIIVSVDSRSTMGAYIASGTVKKVI  101

Query  345  EINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGL  524
            EINP++LGTMAGGAADC FW RNLG++CRL+EL NK+RI+VA ASKLLAN + SYRG GL
Sbjct  102  EINPFLLGTMAGGAADCSFWERNLGMQCRLYELRNKKRITVASASKLLANTMSSYRGYGL  161

Query  525  SVGTMIAGW  551
            S+GTMI GW
Sbjct  162  SMGTMITGW  170



>ref|XP_009265754.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
 gb|EOR04743.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
Length=287

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 109/156 (70%), Gaps = 11/156 (7%)
 Frame = +3

Query  117  RGESSELFDEIPR----VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIF  263
            RG  + L D+       +P+ Q+PN  D  GF       Q D    +K   GTTTLAF +
Sbjct  12   RGIDAALHDDFEGGSGGMPTLQLPNTADPTGFLREYTDEQNDPSCRIKINHGTTTLAFKY  71

Query  264  KEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHEL  443
            K GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL
Sbjct  72   KGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHEL  131

Query  444  ANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             N+ RISVA ASK L+NI YSY+G GLS+GTMI GW
Sbjct  132  RNRERISVAAASKYLSNITYSYKGKGLSMGTMICGW  167



>gb|KFH71396.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=278

 Score =   176 bits (447),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 106/137 (77%), Gaps = 5/137 (4%)
 Frame = +3

Query  156  VPSFQIP---NITDFDGFQKDAI--QMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            +P+F IP   N TDF     DA     ++   GTTTLAF F+ G++VA DSRAS G YI+
Sbjct  38   LPAFDIPMVANPTDFLRAHTDASAENRIRIQHGTTTLAFKFQGGIIVAVDSRASGGSYIA  97

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASK+L+N++
Sbjct  98   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKILSNMV  157

Query  501  YSYRGMGLSVGTMIAGW  551
            Y Y+GMGLS+GTMI GW
Sbjct  158  YDYKGMGLSMGTMITGW  174



>ref|XP_009038619.1| hypothetical protein AURANDRAFT_28593 [Aureococcus anophagefferens]
 gb|EGB06876.1| hypothetical protein AURANDRAFT_28593 [Aureococcus anophagefferens]
Length=287

 Score =   176 bits (446),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  195  GFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q VK AKGTTTLAF F  GV+++ DSR++MG YI+SQ+VKK+IEINP++LGTM
Sbjct  53   GYGTDHHQDVKFAKGTTTLAFKFNGGVIISVDSRSTMGPYIASQTVKKVIEINPFLLGTM  112

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            AGGAADC FW RNLG +CR+ EL NKRR+SVA ASK+LAN +YSYRG GLS+GTM+ GW
Sbjct  113  AGGAADCSFWERNLGTQCRMFELRNKRRVSVAAASKMLANTMYSYRGRGLSMGTMVCGW  171



>ref|XP_001730616.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
 gb|EDP43402.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
Length=295

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS  +   TD D  + DA   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PSRFLAQYTDVDSTRPDA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+GM
Sbjct  95   VIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGM  154

Query  519  GLSVGTMIAGW  551
            GLS+GTMI GW
Sbjct  155  GLSMGTMICGW  165



>gb|EJU05281.1| proteasome-domain-containing protein [Dacryopinax sp. DJM-731 
SS1]
Length=315

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 106/139 (76%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF++P++ D   F +       D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  49   IPSFKVPSLADPSAFLRMHTDDYADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIECRLHELRNRERISVAAASKFLSN  168

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  169  LVYSYKGMGLSMGTMICGW  187



>ref|XP_008036606.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
 gb|EIW60150.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
Length=310

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF+IP + D   F         D    +K   GTTTLAF +K GV+VA DSRA+ G Y
Sbjct  48   VPSFKIPAVADPSSFLRMHTDDHADPSCRIKIKHGTTTLAFRYKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  168  LVYSYKGMGLSMGTMICGW  186



>gb|AAS01050.1| putative proteasome 20S beta5 subunit [Brassica napus]
Length=150

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAAD QFWHRNLG+KCRLHELANKRRISV+GA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADRQFWHRNLGIKCRLHELANKRRISVSGA  60

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN+LYSYRGMGLSVGTMIAGW
Sbjct  61   SKLLANMLYSYRGMGLSVGTMIAGW  85



>emb|CCU99044.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=268

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P   +   TD D   ++A   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PGRFLAQFTDVDSTNQNA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+GM
Sbjct  95   VIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGM  154

Query  519  GLSVGTMIAGW  551
            GLS+GTMI GW
Sbjct  155  GLSMGTMICGW  165



>ref|XP_002111558.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
 gb|EDV25525.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
Length=276

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 106/145 (73%), Gaps = 6/145 (4%)
 Frame = +3

Query  132  ELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK-----GTTTLAFIFKEGVMVAADSR  296
            EL   + +  SFQ+P + D   F K   +     K     GTTTLAF FK GV+VAADSR
Sbjct  34   ELRTHLSKELSFQVPPM-DPQVFLKSINERENGVKIQFLHGTTTLAFKFKNGVIVAADSR  92

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMG YI SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  93   ASMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSFWERVLAERCRVYELRNKERISVAAA  152

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  153  SKLLANMVYYYKGMGLSMGTMICGW  177



>ref|XP_002162379.2| PREDICTED: proteasome subunit beta type-5-like [Hydra vulgaris]
Length=277

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQ---MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            +F +PN++D   F  +       ++   GTTTLAF FK GV+VA DSRAS G YI+SQ+V
Sbjct  44   NFPLPNVSDVSQFLNEYTNGDTKIQFHHGTTTLAFKFKHGVIVAVDSRASAGSYIASQTV  103

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CRL++L NK RISVA ASKLLAN++Y Y+
Sbjct  104  KKVIEINPYLLGTMAGGAADCAFWQRVLAKECRLYQLRNKERISVAAASKLLANMVYQYK  163

Query  513  GMGLSVGTMIAGW  551
            GMGLS+GTMI GW
Sbjct  164  GMGLSMGTMICGW  176



>ref|XP_007863011.1| 20S proteasome subunit [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58001.1| 20S proteasome subunit [Gloeophyllum trabeum ATCC 11539]
Length=312

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P + D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPSFSVPAVHDPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  168  LVYSYKGMGLSMGTMICGW  186



>emb|CCM00020.1| predicted protein [Fibroporia radiculosa]
Length=302

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 112/163 (69%), Gaps = 7/163 (4%)
 Frame = +3

Query  84   DFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGT  242
            + SG E  + +   S    +    +P+F IP++ D   F         D    +K   GT
Sbjct  22   EISGDEDVSDVMWGSEGFGNLAKEIPTFAIPSVPDPAAFLRLHTDDHADPSCRIKIKHGT  81

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAF +K GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+
Sbjct  82   TTLAFRYKGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETFLGI  141

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMI GW
Sbjct  142  ECRLHELRNRERISVAAASKFLSNLVYSYKGMGLSMGTMICGW  184



>emb|CCO27714.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
 emb|CEL51643.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
Length=302

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF IP + D   F         D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  45   VPSFTIPRVPDPTAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMIAGW
Sbjct  165  LVYSYKGMGLSMGTMIAGW  183



>gb|KDQ60928.1| hypothetical protein JAAARDRAFT_125152 [Jaapia argillacea MUCL 
33604]
Length=318

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  46   IPSFSVPSVHDPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  105

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  165

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  166  LVYSYKGMGLSMGTMICGW  184



>ref|XP_007006996.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
 gb|EIW67092.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
Length=287

 Score =   174 bits (440),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 105/146 (72%), Gaps = 8/146 (5%)
 Frame = +3

Query  138  FDEIPRVPSFQIPNITD--------FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADS  293
             DE+ R+   QIP + D         D    +    +K A GTTTLAF FK G++VA DS
Sbjct  28   LDEMGRIKGMQIPRVPDPTAFLNLYTDSMSSNPEAKIKLAHGTTTLAFRFKGGIIVAVDS  87

Query  294  RASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAG  473
            RA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRL+EL NK RISVA 
Sbjct  88   RATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMRCRLYELRNKERISVAA  147

Query  474  ASKLLANILYSYRGMGLSVGTMIAGW  551
            ASK+L+NI+Y Y+G GLS+GTMI GW
Sbjct  148  ASKILSNIVYGYKGRGLSMGTMICGW  173



>ref|XP_007395513.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55176.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
Length=300

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP F IP + D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  43   VPKFNIPAVPDPSAFLRLHTDDFADPSCRIKIKHGTTTLAFRFRGGVIVAVDSRATAGSY  102

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  103  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  162

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  163  LVYSYKGMGLSMGTMICGW  181



>gb|AAM18885.1|AF391293_2 unknown [Branchiostoma floridae]
Length=275

 Score =   173 bits (439),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 109/148 (74%), Gaps = 5/148 (3%)
 Frame = +3

Query  123  ESSELFDEIPRVPSFQIPNITDFDGFQK-----DAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            + S++ + +  +  F IP +TD   F K     +    ++   GTTTLAF F+ GV+VA 
Sbjct  28   DESDVLNNLWSLDKFSIPAVTDPAEFLKPFTTGEGNVKIEFDHGTTTLAFKFQHGVIVAV  87

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  88   DSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISV  147

Query  468  AGASKLLANILYSYRGMGLSVGTMIAGW  551
            A ASKLLANI+Y+Y+GMGLS+GTMI GW
Sbjct  148  AAASKLLANIVYNYKGMGLSMGTMIVGW  175



>gb|KIY65291.1| proteasome-domain-containing protein [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=308

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F         D    +K A GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  47   VPTFTVPNLPDPSAFLRLHTDDHADPNCKIKIAHGTTTLAFRFKGGVIVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  107  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKFLSN  166

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++Y Y+GMGLS+GTM+ GW
Sbjct  167  LVYGYKGMGLSMGTMVCGW  185



>gb|KDE05583.1| proteasome component PRE2 [Microbotryum violaceum p1A1 Lamole]
Length=308

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF +P + D   F         D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  46   MPSFDLPTLQDPTAFLQLHTDDSSDPSCRIKINHGTTTLAFRFKGGIIVAVDSRATAGSY  105

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  165

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  166  LVYSYKGMGLSMGTMICGW  184



>ref|XP_007385467.1| N-terminal nucleophile aminohydrolase [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN07174.1| N-terminal nucleophile aminohydrolase [Punctularia strigosozonata 
HHB-11173 SS5]
Length=317

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPNFSVPNVPDPAAFLRLHTDDHADPSCRIKIKHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++Y Y+GMGLS+GTMI GW
Sbjct  168  LVYGYKGMGLSMGTMICGW  186



>ref|XP_002730946.1| PREDICTED: proteasome subunit beta type-5-like [Saccoglossus 
kowalevskii]
Length=277

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 15/160 (9%)
 Frame = +3

Query  87   FSGLESTAPIRGESSELFDEIPRVPSFQIPNITD----FDGFQK-DAIQMVKPAKGTTTL  251
            F  L++  P      E ++E    P F +P + D       F+K D+   ++   GTTTL
Sbjct  26   FEALDNVEP------EFYNE----PKFTLPQVADPAEYLKQFEKEDSDVKIRFHHGTTTL  75

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF F+ GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR
Sbjct  76   AFKFQHGVIVAVDSRATAGPFIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLSQQCR  135

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            ++EL NK RISVA ASKLLAN++Y+Y+GMGLS+GTMI GW
Sbjct  136  IYELRNKERISVAAASKLLANMVYNYKGMGLSMGTMICGW  175



>gb|ESA00717.1| hypothetical protein GLOINDRAFT_338395 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64892.1| proteasome core particle subunit beta 5 [Rhizophagus irregularis 
DAOM 197198w]
Length=288

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 115/160 (72%), Gaps = 13/160 (8%)
 Frame = +3

Query  84   DFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKD----AIQMVKPAKGTTTL  251
            DF G ++    +G S   FD    VPS   PN T+F     D    A   +K   GTTTL
Sbjct  23   DFVGFDAA---KGFSLPTFD----VPS--CPNPTEFLKAHTDENSTAEYQIKLEHGTTTL  73

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            +F F+ G++VA DSRAS G +I++Q+VKK+IEINPY+LGTMAGGAADC FW R LG +CR
Sbjct  74   SFKFQGGIIVAVDSRASAGSFIATQTVKKVIEINPYLLGTMAGGAADCIFWQRELGRRCR  133

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            L+EL NK RISVA ASKLLAN++Y+Y+GMGLS+GTM+AGW
Sbjct  134  LYELRNKERISVAAASKLLANMVYAYKGMGLSMGTMVAGW  173



>ref|XP_003332961.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP88542.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=289

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 103/138 (75%), Gaps = 6/138 (4%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            VP F +P + D   F       + A   +K   GTTTLAF F+ G++VA DSRA+ G YI
Sbjct  41   VPRFDLPGVKDPVSFLRTHTDDRSADAKIKIKHGTTTLAFRFQHGIIVAVDSRATAGSYI  100

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINP++LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK L+N+
Sbjct  101  ASGTVKKVIEINPFLLGTMAGGAADCQYWETYLGIQCRLHELRNKSRISVAAASKYLSNL  160

Query  498  LYSYRGMGLSVGTMIAGW  551
            +YSY+GMGLS+GTMI GW
Sbjct  161  VYSYKGMGLSMGTMICGW  178



>ref|XP_005713380.1| 20S core proteasome subunit beta 5 [Chondrus crispus]
 emb|CDF33577.1| 20S core proteasome subunit beta 5 [Chondrus crispus]
Length=286

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAI------QMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
            S  +P +     F +DA         ++ A GTTTLAF FK G++VA DSRASMG YI S
Sbjct  35   SLVVPQVDRPSSFLRDAFANVPEKDRIRFAHGTTTLAFSFKGGIIVAVDSRASMGQYIGS  94

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILY  503
             +VKKIIEINPY+LGTMAGGAADC FW R+LG +C+L+EL NK RISVA ASKLLAN +Y
Sbjct  95   GTVKKIIEINPYLLGTMAGGAADCSFWERDLGRRCKLYELRNKERISVAAASKLLANTVY  154

Query  504  SYRGMGLSVGTMIAGW  551
             Y+GMGLS+GTMI GW
Sbjct  155  YYKGMGLSMGTMICGW  170



>gb|EJK48257.1| hypothetical protein THAOC_32963 [Thalassiosira oceanica]
Length=248

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  207  DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGA  386
            D  Q VK AKGTTTLAF F  G++V+ DSR++MG YI+S +VKK+IEINP++LGTMAGGA
Sbjct  28   DQGQEVKFAKGTTTLAFKFNGGIIVSVDSRSTMGAYIASGTVKKVIEINPFLLGTMAGGA  87

Query  387  ADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            ADC FW RNLG++CR++EL NK+RISVA ASKLLAN + SYRG GLS+GTMI GW
Sbjct  88   ADCSFWERNLGIQCRMYELRNKKRISVAAASKLLANTMRSYRGYGLSMGTMITGW  142



>gb|KEP54479.1| proteasome subunit beta type-5 protein [Rhizoctonia solani 123E]
Length=302

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP + D  GF         D    +K   GTTTLAF FK G++V  DSRA+ G Y
Sbjct  45   VPAFNIPRVPDPIGFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGIIVCVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMIAGW
Sbjct  165  LVYSYKGMGLSMGTMIAGW  183



>ref|XP_007326468.1| hypothetical protein AGABI1DRAFT_111072 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM82453.1| hypothetical protein AGABI1DRAFT_111072 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=311

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 104/142 (73%), Gaps = 7/142 (5%)
 Frame = +3

Query  147  IPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            I  +P+F++P + D   F         D    +K   GTTTLAF FK GV+VA DSRA+ 
Sbjct  46   IKGIPAFKVPAVADPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATA  105

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  485
            G Y++S +VKK+IEINPY+LGTMAGGAADCQFW   LG+ CRLHEL N+ RISV+ ASK 
Sbjct  106  GSYVASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHELRNRERISVSAASKY  165

Query  486  LANILYSYRGMGLSVGTMIAGW  551
            L+N++YSY+GMGLS+GTMI GW
Sbjct  166  LSNLVYSYKGMGLSMGTMICGW  187



>gb|EUC61688.1| proteasome subunit beta type-5 protein [Rhizoctonia solani AG-3 
Rhs1AP]
Length=302

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP + D  GF         D    +K   GTTTLAF FK G++V  DSRA+ G Y
Sbjct  45   VPAFNIPRVPDPIGFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGIIVCVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMIAGW
Sbjct  165  LVYSYKGMGLSMGTMIAGW  183



>emb|CCF49354.1| probable PRE2-20S core proteasome subunit (beta5) [Ustilago hordei]
Length=325

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 110/156 (71%), Gaps = 12/156 (8%)
 Frame = +3

Query  114  IRGESSELFDEIPRVP-SFQIPNI---------TDFDGFQKDAIQMVKPAKGTTTLAFIF  263
            + G +   +D++   P  F +PN+         TD D    +    +K A GTTTLAF F
Sbjct  21   MHGSTGAAYDQLMGAPGQFDLPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRF  78

Query  264  KEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHEL  443
            K G++V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL
Sbjct  79   KGGIIVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHEL  138

Query  444  ANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             NK RISVA ASK L+N++YSY+GMGLS+GTMI GW
Sbjct  139  RNKERISVAAASKYLSNLVYSYKGMGLSMGTMICGW  174



>gb|ACP43316.1| 20S proteasome beta subunit 5 [Citrus maxima]
Length=194

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
            GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLL
Sbjct  1    GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLL  60

Query  489  ANILYSYRGMGLSVGTMIAGW  551
            ANILYSYRGMGLSVGTMIAGW
Sbjct  61   ANILYSYRGMGLSVGTMIAGW  81



>ref|XP_006457891.1| 20S proteasome subunit [Agaricus bisporus var. bisporus H97]
 gb|EKV49845.1| 20S proteasome subunit [Agaricus bisporus var. bisporus H97]
Length=311

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 104/142 (73%), Gaps = 7/142 (5%)
 Frame = +3

Query  147  IPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            I  +P+F++P + D   F         D    +K   GTTTLAF FK GV+VA DSRA+ 
Sbjct  46   IKGIPAFKVPAVADPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATA  105

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  485
            G Y++S +VKK+IEINPY+LGTMAGGAADCQFW   LG+ CRLHEL N+ RISV+ ASK 
Sbjct  106  GSYVASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHELRNRERISVSAASKY  165

Query  486  LANILYSYRGMGLSVGTMIAGW  551
            L+N++YSY+GMGLS+GTMI GW
Sbjct  166  LSNLVYSYKGMGLSMGTMICGW  187



>gb|KII89158.1| hypothetical protein PLICRDRAFT_109139 [Plicaturopsis crispa 
FD-325 SS-3]
Length=318

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 101/139 (73%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F         D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  48   VPTFSVPNVPDPSSFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N  RISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNHERISVSAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++Y Y+GMGLS+GTMI GW
Sbjct  168  LVYGYKGMGLSMGTMICGW  186



>ref|XP_007418509.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
 gb|EGF98220.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
Length=296

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 104/142 (73%), Gaps = 6/142 (4%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGF------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            E   VP+F+ P + D   F       +     +K   GTTTLAF FK G++VA DSRA+ 
Sbjct  40   ESDPVPTFEFPAVDDPAAFLRAHTDDRSPDSRIKIRHGTTTLAFRFKHGIVVAVDSRATA  99

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  485
            G YI+S +VKK+IEINP++LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK 
Sbjct  100  GSYIASGTVKKVIEINPFLLGTMAGGAADCQYWETYLGMQCRLHELRNKSRISVAAASKH  159

Query  486  LANILYSYRGMGLSVGTMIAGW  551
            L+N++YSY+GMGLS+GTMI GW
Sbjct  160  LSNLVYSYKGMGLSMGTMICGW  181



>gb|KIK59625.1| hypothetical protein GYMLUDRAFT_201809 [Gymnopus luxurians FD-317 
M1]
Length=303

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  47   VPNFTVPSVPDPSAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LGV CRLHEL N+ RISV+ ASK L+N
Sbjct  107  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGVHCRLHELRNRERISVSAASKYLSN  166

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  167  LVYSYKGMGLSMGTMICGW  185



>emb|CBN74512.1| conserved unknown protein [Ectocarpus siliculosus]
Length=286

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  195  GFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q +K AKGTTTLAF F+ G++V+ DSR++MG YI+S +VKK+IEINPY+LGTM
Sbjct  54   GYGTDHAQDIKFAKGTTTLAFKFQGGIIVSVDSRSTMGPYIASGTVKKVIEINPYLLGTM  113

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            AGGAADC FW RNLG++CR++EL NK RISVA ASKLL+N +  YRG GLS+GTM+AGW
Sbjct  114  AGGAADCSFWERNLGIQCRMYELRNKERISVAAASKLLSNTMSQYRGYGLSMGTMVAGW  172



>gb|KDQ33416.1| hypothetical protein PLEOSDRAFT_1110569 [Pleurotus ostreatus 
PC15]
Length=307

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP++ D   F +       D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  48   VPTFSIPSVADPTAFLRLHTDDSSDPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNRERISVSAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++Y Y+GMGLS+GTMI GW
Sbjct  168  LVYGYKGMGLSMGTMICGW  186



>gb|KIK08153.1| hypothetical protein K443DRAFT_672633 [Laccaria amethystina LaAM-08-1]
Length=302

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  37   VPTFSIPDVADPTSFLQMHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  96

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  97   VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  156

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  157  LVYSYKGMGLSMGTMICGW  175



>gb|KDR73611.1| hypothetical protein GALMADRAFT_124865 [Galerina marginata CBS 
339.88]
Length=314

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 102/138 (74%), Gaps = 7/138 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            P+F +PN+ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G YI
Sbjct  49   PTFSVPNVADPTSFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSYI  108

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N+
Sbjct  109  ASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSNL  168

Query  498  LYSYRGMGLSVGTMIAGW  551
            +YSY+GMGLS+GTMI GW
Sbjct  169  VYSYKGMGLSMGTMICGW  186



>gb|KIJ17479.1| hypothetical protein PAXINDRAFT_168130 [Paxillus involutus ATCC 
200175]
Length=315

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  49   VPSFMVPSVPDPAAFLRLHTDDHADPSCKIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  109  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNRERISVSAASKYLSN  168

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  169  LVYSYKGMGLSMGTMICGW  187



>ref|XP_007100520.1| PREDICTED: proteasome subunit beta type-5 isoform X4 [Physeter 
catodon]
Length=199

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  I    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLIAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>ref|XP_001875479.1| 20S proteasome subunit [Laccaria bicolor S238N-H82]
 gb|EDR14920.1| 20S proteasome subunit [Laccaria bicolor S238N-H82]
Length=307

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  41   VPTFSIPDVADPTSFLQLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  100

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  101  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  160

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  161  LVYSYKGMGLSMGTMICGW  179



>gb|KIM65350.1| hypothetical protein SCLCIDRAFT_542814 [Scleroderma citrinum 
Foug A]
Length=306

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 115/180 (64%), Gaps = 25/180 (14%)
 Frame = +3

Query  87   FSGLESTAPIRGESSELFDEIPRV------------------PSFQIPNITDFDGF----  200
            F+GL S   +R  ++ + D+   +                  PSF +P++ D   F    
Sbjct  8    FTGLSSNVELRRRNATVVDDDEDISDAMWGSLGGFGSLASGAPSFTVPSVPDPAAFLRLH  67

Query  201  ---QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGT  371
                 D    +K   GTTTLAF ++ GV+VA DSRA+ G YI+S +VKK+IEINPY+LGT
Sbjct  68   TDDHADPSCRIKIQHGTTTLAFRYQGGVIVAVDSRATAGNYIASGTVKKVIEINPYLLGT  127

Query  372  MAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            MAGGAADCQFW   LG+ CRLHEL N+ RISV+ ASK L+N++YSY+GMGLS+GTMI GW
Sbjct  128  MAGGAADCQFWETYLGMHCRLHELRNRERISVSAASKYLSNLVYSYKGMGLSMGTMICGW  187



>gb|EMS25821.1| 20S proteasome subunit beta 5 [Rhodosporidium toruloides NP11]
 emb|CDR38163.1| RHTO0S03e04852g1_1 [Rhodosporidium toruloides]
Length=298

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F++P   D   F +       D    +K   GTTTLAF F+ G++VA DSRA+ G Y
Sbjct  47   VPNFEMPATIDPTSFLQLHTDDASDPSCRIKINHGTTTLAFKFQGGIVVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N  RISVA ASK LAN
Sbjct  107  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNHERISVAAASKYLAN  166

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  167  LVYSYKGMGLSMGTMICGW  185



>ref|XP_002179855.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48841.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=283

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGF--QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            ++P VP   +   ++F       DA Q VK AKGTTTLAF F  G++V+ DSR++MG YI
Sbjct  41   DVPNVPDPALYCRSNFASACGNADAGQEVKFAKGTTTLAFKFNGGIIVSVDSRSTMGYYI  100

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINP++LGTMAGGAADC FW RNLG++CRL+EL N RRI+VA ASKLLAN+
Sbjct  101  ASGTVKKVIEINPFLLGTMAGGAADCSFWERNLGMECRLYELRNGRRITVAAASKLLANV  160

Query  498  LYSYRGMGLSVGTMIAGW  551
            + +YRG GLS+GTMI GW
Sbjct  161  MSAYRGYGLSMGTMITGW  178



>ref|XP_007361365.1| N-terminal nucleophile aminohydrolase [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF66103.1| N-terminal nucleophile aminohydrolase [Dichomitus squalens LYAD-421 
SS1]
Length=314

 Score =   172 bits (437),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP F++P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPMFKLPSVPDPTSFLRMHTDDHADPSCRIKIKHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  168  LVYSYKGMGLSMGTMICGW  186



>ref|XP_007764597.1| 20S proteasome subunit [Coniophora puteana RWD-64-598 SS2]
 gb|EIW84942.1| 20S proteasome subunit [Coniophora puteana RWD-64-598 SS2]
Length=314

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF++P + D   F         D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  48   VPSFEVPAVPDPSAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++Y Y+GMGLS+GTMI GW
Sbjct  168  LVYGYKGMGLSMGTMICGW  186



>gb|KJA27011.1| hypothetical protein HYPSUDRAFT_35526 [Hypholoma sublateritium 
FD-334 SS-4]
Length=319

 Score =   172 bits (436),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 7/138 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            PSF +P+I D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G YI
Sbjct  49   PSFNVPDIPDPTSFLRLHTDDHADPSCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSYI  108

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N+
Sbjct  109  ASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSNL  168

Query  498  LYSYRGMGLSVGTMIAGW  551
            +YSY+GMGLS+GTMI GW
Sbjct  169  VYSYKGMGLSMGTMICGW  186



>ref|XP_007850837.1| proteasome component pre2 precursor [Moniliophthora roreri MCA 
2997]
 gb|ESK89859.1| proteasome component pre2 precursor [Moniliophthora roreri MCA 
2997]
Length=297

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  45   VPTFGVPSVPDPSAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  105  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNRERISVSAASKYLSN  164

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  165  LVYSYKGMGLSMGTMICGW  183



>gb|KDQ18004.1| hypothetical protein BOTBODRAFT_104582 [Botryobasidium botryosum 
FD-172 SS1]
Length=308

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF+IP + D   F       + D    +K   GTTTLAF F+ G++VA DSRA+ G Y
Sbjct  45   IPSFEIPRVPDPTNFLRMHTDDRNDPSCRIKIQHGTTTLAFRFQGGIIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++Y Y+GMGLS+GTMIAGW
Sbjct  165  LVYGYKGMGLSMGTMIAGW  183



>gb|KIL00906.1| hypothetical protein PAXRUDRAFT_821100 [Paxillus rubicundulus 
Ve08.2h10]
Length=314

 Score =   172 bits (436),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPSFMVPSVPDPAAFLRLHTDDHADPSCKIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  168  LVYSYKGMGLSMGTMICGW  186



>ref|XP_007880004.1| hypothetical protein PFL1_04286 [Pseudozyma flocculosa PF-1]
 gb|EPQ27959.1| hypothetical protein PFL1_04286 [Pseudozyma flocculosa PF-1]
Length=331

 Score =   172 bits (437),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +3

Query  144  EIPRV-PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            E+P V P+  +   TD D     A   +K + GTTTLAF F+ G++VA DSRA+ G YI+
Sbjct  47   ELPNVDPATFLSQYTDVDSSNPGA--KIKLSHGTTTLAFRFRGGIIVAVDSRATAGSYIA  104

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK L+N++
Sbjct  105  SGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKYLSNLV  164

Query  501  YSYRGMGLSVGTMIAGW  551
            YSY+GMGLS+GTMI GW
Sbjct  165  YSYKGMGLSMGTMICGW  181



>ref|XP_007449603.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Lipotes 
vexillifer]
Length=203

 Score =   169 bits (427),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>ref|XP_004283229.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Orcinus 
orca]
Length=203

 Score =   169 bits (427),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>ref|XP_002911819.1| proteasome component pts1 [Coprinopsis cinerea okayama7#130]
 gb|EFI28325.1| proteasome component pts1 [Coprinopsis cinerea okayama7#130]
Length=313

 Score =   172 bits (435),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 102/139 (73%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P + D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  49   VPTFTVPALPDPTAFLRLHTDDHADPSCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL NK RISV+ ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNKERISVSAASKFLSN  168

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  169  LVYSYKGMGLSMGTMICGW  187



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score =   171 bits (432),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 106/139 (76%), Gaps = 8/139 (6%)
 Frame = +3

Query  156  VPSFQIP-------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
              +F+IP       ++  F     D I+ ++ A GTTTLAF FK GV+VA DSRA+ G +
Sbjct  38   TETFEIPQNFNPGEDLKQFTEGNDDNIK-IRIAHGTTTLAFKFKHGVIVAVDSRATAGDW  96

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +  +CR++EL NK RISVA ASKLLAN
Sbjct  97   IASQTVKKVIEINPYLLGTMAGGAADCQYWERVVARQCRIYELRNKERISVAAASKLLAN  156

Query  495  ILYSYRGMGLSVGTMIAGW  551
            I+Y+Y+GMGLS+GTMI GW
Sbjct  157  IVYNYKGMGLSMGTMICGW  175



>ref|XP_003801967.1| PREDICTED: proteasome subunit beta type-5 [Otolemur garnettii]
Length=263

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 109/145 (75%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P+ PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPKSPSDGLSLVAPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>emb|CDO73558.1| hypothetical protein BN946_scf185014.g28 [Trametes cinnabarina]
Length=311

 Score =   172 bits (435),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F++P + D   F         D    +K   GTTTLAF ++ GV+VA DSRA+ G Y
Sbjct  48   VPTFKVPAVPDPTSFLRMHTDDHADPSCRIKIKHGTTTLAFRYQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  168  LVYSYKGMGLSMGTMICGW  186



>gb|KIJ69319.1| hypothetical protein HYDPIDRAFT_79749 [Hydnomerulius pinastri 
MD-312]
Length=315

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
             PSF +P++ D   F         D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  52   TPSFMVPSVPDPAAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  111

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  112  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  171

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  172  LVYSYKGMGLSMGTMICGW  190



>ref|XP_008156743.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Eptesicus 
fuscus]
Length=201

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 112/161 (70%), Gaps = 9/161 (6%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            S LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTT
Sbjct  5    SVLESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEEP--KIEILHGTTT  62

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +C
Sbjct  63   LAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC  122

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            R++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  123  RIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  163



>gb|EAW66194.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_b [Homo sapiens]
Length=148

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  108



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 116/167 (69%), Gaps = 14/167 (8%)
 Frame = +3

Query  72   MVRIDFSGLESTAPI-----RGESSELFDEIPRV--PSFQIPNITDFDGFQKDAIQMVKP  230
            M  I+   L++ AP+     R +  E   +IP V  P+  +  +TD         + +K 
Sbjct  1    MAMIEECSLDAFAPLSLKAPRDDGVEF--QIPEVINPALHLRELTD-----SKYGKGIKF  53

Query  231  AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHR  410
              GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R
Sbjct  54   NHGTTTLAFKFQHGVVVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMFWER  113

Query  411  NLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             L  +CR++EL NK RISVA ASK+LAN++Y+Y+GMGLS+GTMI GW
Sbjct  114  VLAKQCRIYELRNKERISVAAASKILANMVYNYKGMGLSMGTMICGW  160



>ref|XP_004474611.1| PREDICTED: proteasome subunit beta type-5 [Dasypus novemcinctus]
Length=262

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 108/148 (73%), Gaps = 10/148 (7%)
 Frame = +3

Query  120  GESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            G  ++L D  P  PS       PN+   D  ++  I+M+    GTTTLAF F+ GV+VA 
Sbjct  22   GGRADLLDLGPGSPSDGMSLAAPNL---DVSEEPGIEMLH---GTTTLAFKFRHGVIVAV  75

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  76   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISV  135

Query  468  AGASKLLANILYSYRGMGLSVGTMIAGW  551
            A ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  136  AAASKLLANMVYQYKGMGLSMGTMICGW  163



>gb|ELU16739.1| hypothetical protein CAPTEDRAFT_41193, partial [Capitella teleta]
Length=131

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF FK GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +
Sbjct  2    GTTTLAFKFKHGVIVAVDSRATAGDWIASQTVKKVIEINPYLLGTMAGGAADCQYWERVV  61

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
              +CR++EL NK RISVA ASKLLANI+Y+Y+GMGLS+GTMI GW
Sbjct  62   ARQCRIYELRNKERISVAAASKLLANIVYNYKGMGLSMGTMICGW  106



>gb|EST08741.1| 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 
[Pseudozyma brasiliensis GHG001]
Length=344

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 108/152 (71%), Gaps = 12/152 (8%)
 Frame = +3

Query  126  SSELFDEIPRVP-SFQIPNI---------TDFDGFQKDAIQMVKPAKGTTTLAFIFKEGV  275
            SS   D++   P  F +PN+         TD D    +    +K A GTTTLAF FK G+
Sbjct  44   SSSAHDQMMGAPGQFDLPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRFKGGI  101

Query  276  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR  455
            +V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK 
Sbjct  102  IVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKE  161

Query  456  RISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            RISVA ASK L+N++YSY+GMGLS+GTMI GW
Sbjct  162  RISVAAASKYLSNLVYSYKGMGLSMGTMICGW  193



>ref|XP_004333043.1| proteasome endopeptidase subunit, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11030.1| proteasome endopeptidase subunit, putative [Acanthamoeba castellanii 
str. Neff]
Length=275

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 116/169 (69%), Gaps = 9/169 (5%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITD-----FDGFQKDAIQMV  224
            +    + +DF  L    P   E ++L +E+  V  F +P +++      D FQ+   + +
Sbjct  1    MATAALNLDFLDL----PSEREDNQLQNEVLDVDRFTLPAVSNPASFLTDTFQETQAEPI  56

Query  225  KPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFW  404
            K   GTTTL+F+F+ G++VA DSRA+ G YI+SQSV+K+I INP++LGTMAGGAADC +W
Sbjct  57   KMLHGTTTLSFVFQGGIVVAVDSRATQGTYIASQSVQKVIRINPFLLGTMAGGAADCSYW  116

Query  405  HRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
             R LG + RL++L NK R++VA ASK+L+NILY YR  GLSVG+MI GW
Sbjct  117  ERELGRRTRLYQLRNKERMTVAAASKVLSNILYYYRNQGLSVGSMICGW  165



>ref|XP_007321997.1| hypothetical protein SERLADRAFT_475676 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN95513.1| hypothetical protein SERLA73DRAFT_186558 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO21040.1| hypothetical protein SERLADRAFT_475676 [Serpula lacrymans var. 
lacrymans S7.9]
Length=317

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P+++D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  47   VPSFTVPSVSDPAAFLRLHTDDHADPNCKIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  107  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  166

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++Y Y+GMGLS+GTMI GW
Sbjct  167  LVYGYKGMGLSMGTMICGW  185



>ref|XP_005875924.1| PREDICTED: proteasome subunit beta type-5-like [Myotis brandtii]
 gb|EPQ13719.1| Proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 110/159 (69%), Gaps = 9/159 (6%)
 Frame = +3

Query  96   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTTLA
Sbjct  7    LESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTTLA  64

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR+
Sbjct  65   FKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRI  124

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +EL NK RISVA ASKLL N+LY Y+GMGLSVGTMI GW
Sbjct  125  YELRNKERISVAAASKLLVNMLYQYKGMGLSVGTMICGW  163



>gb|KIO13433.1| hypothetical protein M404DRAFT_122218 [Pisolithus tinctorius 
Marx 270]
Length=304

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P++ D   F         D    +K   GTTTLAF ++ GV+VA DSRA+ G Y
Sbjct  49   VPTFTVPSVPDPAAFLRLHTDDHADPSCRIKIQHGTTTLAFRYQGGVIVAVDSRATAGNY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQFW   LG+ CRLHEL N  RISV+ ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHELRNHERISVSAASKYLSN  168

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++YSY+GMGLS+GTMI GW
Sbjct  169  LVYSYKGMGLSMGTMICGW  187



>ref|XP_008564788.1| PREDICTED: proteasome subunit beta type-5 [Galeopterus variegatus]
Length=263

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 110/158 (70%), Gaps = 18/158 (11%)
 Frame = +3

Query  78   RIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAF  257
            R D   L   +PI G S          PS+ +P        ++  I+M+    GTTTLAF
Sbjct  24   RTDLLDLGPGSPIDGLSLA-------APSWGVP--------EEPGIEMLH---GTTTLAF  65

Query  258  IFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLH  437
             F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++
Sbjct  66   KFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIY  125

Query  438  ELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  126  ELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  163



>emb|CDI55907.1| probable PRE2-20S core proteasome subunit (beta5) (C-terminal 
fragment) [Melanopsichium pennsylvanicum 4]
Length=324

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 109/154 (71%), Gaps = 12/154 (8%)
 Frame = +3

Query  120  GESSELFDEIPRVP-SFQIPNI---------TDFDGFQKDAIQMVKPAKGTTTLAFIFKE  269
            G SS   D++   P  F +PN+         TD D    +    +K A GTTTLAF F+ 
Sbjct  22   GGSSAAQDQLMGAPGQFALPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRFRG  79

Query  270  GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELAN  449
            G++V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N
Sbjct  80   GIIVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRN  139

Query  450  KRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            K RISVA ASK L+N++YSY+GMGLS+GTMI GW
Sbjct  140  KERISVAAASKYLSNLVYSYKGMGLSMGTMICGW  173



>ref|XP_009541838.1| subunit beta type peptidase T1A, 20S proteasome [Heterobasidion 
irregulare TC 32-1]
 gb|ETW85983.1| subunit beta type peptidase T1A, 20S proteasome [Heterobasidion 
irregulare TC 32-1]
Length=313

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 102/137 (74%), Gaps = 7/137 (5%)
 Frame = +3

Query  162  SFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            SF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y++
Sbjct  50   SFDVPSVADPAAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSYVA  109

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N++
Sbjct  110  SGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLV  169

Query  501  YSYRGMGLSVGTMIAGW  551
            YSY+GMGLS+GTMI GW
Sbjct  170  YSYKGMGLSMGTMICGW  186



>ref|XP_005267928.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Homo sapiens]
Length=169

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  163



>gb|EWM22648.1| proteasome subunit beta type 5 [Nannochloropsis gaditana]
Length=278

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  195  GFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q +K AKGTTTLAF F  G++VA DSR++ G Y++S +VKK+IEINPY+LGTM
Sbjct  55   GYGTDQHQELKFAKGTTTLAFKFDGGIVVAVDSRSTQGAYVASGTVKKVIEINPYLLGTM  114

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            AGGAADC FW RNLG++CRL+EL +K RISVA ASKLLAN +  YRG GLS+GTMI GW
Sbjct  115  AGGAADCSFWERNLGIQCRLYELRHKERISVAAASKLLANTVMQYRGYGLSMGTMITGW  173



>ref|XP_004694702.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Condylura 
cristata]
Length=208

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  108



>ref|XP_004755395.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Mustela 
putorius furo]
 ref|XP_004801214.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Mustela 
putorius furo]
Length=204

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 108/148 (73%), Gaps = 10/148 (7%)
 Frame = +3

Query  120  GESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            G  ++L D  P  PS       PN   +   ++  I+M+    GTTTLAF F+ GV+VAA
Sbjct  22   GGRADLLDLGPGSPSDGLTLAAPN---WGVAEEPRIEMLH---GTTTLAFKFQHGVIVAA  75

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  76   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISV  135

Query  468  AGASKLLANILYSYRGMGLSVGTMIAGW  551
            A ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  136  AAASKLLANMVYQYKGMGLSMGTMICGW  163



>dbj|BAA06097.1| proteasome subunit X [Homo sapiens]
 gb|AAP35423.1| proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|AIC59195.1| hypothetical protein, partial [synthetic construct]
Length=208

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  108



>ref|XP_009061521.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
 gb|ESO87922.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
Length=263

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 103/145 (71%), Gaps = 2/145 (1%)
 Frame = +3

Query  117  RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            +GE ++LF+         +     F   + D    +    GTTTLAF FK G +VA DSR
Sbjct  18   QGERNQLFNNCGGNYGRPLETRNSFTNEKSDV--KIHFDHGTTTLAFKFKHGCIVAVDSR  75

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R+L  +CRL+EL NK RISVA A
Sbjct  76   ATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERHLAKECRLYELRNKERISVAAA  135

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN +Y+Y+GMGLS+GTMI GW
Sbjct  136  SKLLANTVYNYKGMGLSMGTMIVGW  160



>ref|XP_004313402.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Tursiops 
truncatus]
Length=208

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  108



>ref|XP_009021669.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
 gb|ESO00235.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
Length=245

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 107/139 (77%), Gaps = 5/139 (4%)
 Frame = +3

Query  138  FDEIPRVPSFQIPNITDFDGFQKDAIQM-VKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            F+ +P+  SFQ P++  F+    D  ++ +    GTTTL+F +K GV+VA DSRA+ G +
Sbjct  11   FNLVPK--SFQ-PSL-HFNKESNDESKIKIHFDHGTTTLSFKYKNGVIVAVDSRATAGPW  66

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  KCRL+EL NK RISVA ASKLLAN
Sbjct  67   IASQNVKKVIEINPYLLGTMAGGAADCSFWQRFLAEKCRLYELRNKERISVAAASKLLAN  126

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ILY Y+GMGLSVGTMI GW
Sbjct  127  ILYGYKGMGLSVGTMIVGW  145



>ref|XP_007100517.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Physeter 
catodon]
Length=263

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  I    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLIAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>ref|XP_007989006.1| PREDICTED: proteasome subunit beta type-5 isoform X3 [Chlorocebus 
sabaeus]
Length=197

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 107/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLAAPGWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>ref|XP_005338834.1| PREDICTED: proteasome subunit beta type-5 [Ictidomys tridecemlineatus]
Length=208

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  413
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  3    HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  62

Query  414  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  63   LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  108



>gb|AAP36588.1| Homo sapiens proteasome (prosome, macropain) subunit, beta type, 
5 [synthetic construct]
Length=209

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  108



>ref|XP_003363600.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Equus caballus]
Length=203

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 102/131 (78%), Gaps = 11/131 (8%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGW  551
            GLS+GTMI GW
Sbjct  153  GLSMGTMICGW  163



>ref|XP_004347536.2| hypothetical protein CAOG_04785 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94093.1| hypothetical protein CAOG_004785 [Capsaspora owczarzaki ATCC 
30864]
Length=305

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 122/193 (63%), Gaps = 20/193 (10%)
 Frame = +3

Query  9    SPIVP*VESTPSFYS-RYLVVT-----MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQ  170
            +PI     STP+  S RY  ++     M   + SGL        E ++    + ++P F 
Sbjct  20   APITA-ARSTPASVSGRYAALSAEDDAMAESELSGLT-------ELNQQLGAMSQLPVFD  71

Query  171  IPNITD----FDGFQKDAIQMVKP--AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            +P + D       + +D    VK     GTTTLAF FK G++VA DSRA+ G YI+S +V
Sbjct  72   VPAVQDPAAFLHAYTEDPHSKVKIHIQHGTTTLAFKFKHGIIVAVDSRATGGSYIASGTV  131

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  132  KKVIEINPYLLGTMAGGAADCSFWERELARRCRIYELRNKERISVAAASKLLANMVYGYK  191

Query  513  GMGLSVGTMIAGW  551
             MGLS+GTMI GW
Sbjct  192  NMGLSMGTMITGW  204



>ref|XP_006682354.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF76856.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=267

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K  KGTTTLAF F +GV+VA DSRA+MG YI SQ+VKK+IEINPY+LGTMAGGAADC F
Sbjct  1    IKLEKGTTTLAFKFAKGVVVAVDSRATMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSF  60

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            W R LG + RL+EL NK RISVA ASKLL+N++Y Y+GMGLS+GTMI GW
Sbjct  61   WERELGRRARLYELRNKERISVAAASKLLSNMVYGYKGMGLSMGTMITGW  110



>ref|XP_008065987.1| PREDICTED: proteasome subunit beta type-5 [Tarsius syrichta]
Length=263

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +   T   G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGNPSDGLSLATPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>gb|EPS96804.1| hypothetical protein FOMPIDRAFT_1025230 [Fomitopsis pinicola 
FP-58527 SS1]
Length=304

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 102/139 (73%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
             P+F +P++ D   F         D    +K   GTTTLAF +K GV+VA DSRA+ G Y
Sbjct  48   APNFMVPDVPDPAAFLRLHTDDHADPSCRIKIKHGTTTLAFRYKGGVVVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLSVGTMIAGW  551
            ++Y Y+GMGLS+GTMI GW
Sbjct  168  LVYGYKGMGLSMGTMICGW  186



>ref|XP_006776843.1| PREDICTED: proteasome subunit beta type-5 [Myotis davidii]
Length=263

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 111/159 (70%), Gaps = 9/159 (6%)
 Frame = +3

Query  96   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            LE++ P+        G  ++L D  P  PS  +       G  ++    ++   GTTTLA
Sbjct  7    LETSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTTLA  64

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F FK GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR+
Sbjct  65   FKFKHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRI  124

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  125  YELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  163



>ref|XP_006144566.1| PREDICTED: proteasome subunit beta type-5 [Tupaia chinensis]
 gb|ELW69249.1| Proteasome subunit beta type-5 [Tupaia chinensis]
Length=263

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 102/131 (78%), Gaps = 11/131 (8%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWDVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGW  551
            GLS+GTMI GW
Sbjct  153  GLSMGTMICGW  163



>gb|KIY43500.1| N-terminal nucleophile aminohydrolase [Fistulina hepatica ATCC 
64428]
Length=308

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 7/138 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            PSF +P + D   F         D    +K   GTTTLAF +K GV+VA DSRA+ G Y+
Sbjct  47   PSFAVPALADPAAFLRLHTDDHADPNCRIKIQHGTTTLAFRYKGGVIVAVDSRATAGSYV  106

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N+
Sbjct  107  ASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSNL  166

Query  498  LYSYRGMGLSVGTMIAGW  551
            +YSY+GMGLS+GTMI GW
Sbjct  167  VYSYKGMGLSMGTMICGW  184



>ref|XP_009209435.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Papio anubis]
Length=197

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 107/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDIGPGSPSDGLSLAAPGWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>gb|KIP12266.1| hypothetical protein PHLGIDRAFT_17679 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=306

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 107/154 (69%), Gaps = 7/154 (5%)
 Frame = +3

Query  111  PIRGESSELFDEIPRVPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKE  269
            P+ G  +   +    V  F IP + D   F +       D    +K   GTTTLAF F+ 
Sbjct  33   PMWGSQAGFGNLASGVVKFNIPTVPDPSAFLRMHTDDFADPSCRIKIKHGTTTLAFRFQG  92

Query  270  GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELAN  449
            GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N
Sbjct  93   GVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRN  152

Query  450  KRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            + RISVA ASK L+N++YSY+GMGLS+GTMI GW
Sbjct  153  RERISVAAASKYLSNLVYSYKGMGLSMGTMICGW  186



>ref|XP_004283228.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Orcinus 
orca]
Length=263

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>gb|EIF47547.1| proteasome component pre2 precursor [Brettanomyces bruxellensis 
AWRI1499]
Length=284

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 106/138 (77%), Gaps = 7/138 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQK----DAIQ---MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            PS  +P I+    F +    D++     +K A GTTTLAF FKEG++VA DSRA+ G ++
Sbjct  39   PSISLPPISKPTAFLRANTDDSVNPDCKIKIAHGTTTLAFRFKEGIIVAVDSRATAGSWV  98

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +SQ+VKK+IEINP +LGTMAGGAADCQ+W   LG +CRLHEL NK RISVA ASK+L+N+
Sbjct  99   ASQTVKKVIEINPMLLGTMAGGAADCQYWETWLGTQCRLHELRNKERISVAAASKILSNL  158

Query  498  LYSYRGMGLSVGTMIAGW  551
            +YSY+GMGLS+GTMI G+
Sbjct  159  VYSYKGMGLSMGTMICGY  176



>ref|XP_004313401.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Tursiops 
truncatus]
Length=263

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



>ref|XP_008156742.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Eptesicus 
fuscus]
Length=263

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 111/159 (70%), Gaps = 9/159 (6%)
 Frame = +3

Query  96   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTTLA
Sbjct  7    LESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PKIEILHGTTTLA  64

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR+
Sbjct  65   FKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRI  124

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  551
            +EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  125  YELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW  163



>ref|XP_005560889.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Macaca 
fascicularis]
Length=203

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 107/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDIGPGSPSDGLSLAAPGWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGW  551
            SKLLAN++Y Y+GMGLS+GTMI GW
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGW  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760