BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K01

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          171   3e-47   Solanum tuberosum [potatoes]
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                168   3e-46   Nicotiana sylvestris
ref|XP_006350301.1|  PREDICTED: probable pectate lyase 20-like          168   5e-46   Solanum tuberosum [potatoes]
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                165   4e-45   Nicotiana tomentosiformis
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                165   4e-45   
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                165   5e-45   Nicotiana tomentosiformis
ref|XP_004247105.1|  PREDICTED: probable pectate lyase 8                165   5e-45   Solanum lycopersicum
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                164   8e-45   Nicotiana sylvestris
emb|CDO99404.1|  unnamed protein product                                161   2e-43   Coffea canephora [robusta coffee]
dbj|BAF43573.1|  pectate lyase                                          160   2e-43   Prunus persica
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                161   2e-43   
emb|CDP03845.1|  unnamed protein product                                161   2e-43   Coffea canephora [robusta coffee]
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             160   2e-43   Prunus persica
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                160   5e-43   Prunus mume [ume]
emb|CAN75298.1|  hypothetical protein VITISV_008675                     160   5e-43   Vitis vinifera
ref|XP_002265100.1|  PREDICTED: probable pectate lyase 8                160   5e-43   Vitis vinifera
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                160   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                159   7e-43   Sesamum indicum [beniseed]
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                159   9e-43   
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                158   9e-43   Sesamum indicum [beniseed]
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                158   1e-42   Erythranthe guttata [common monkey flower]
emb|CAN78491.1|  hypothetical protein VITISV_004934                     158   2e-42   Vitis vinifera
emb|CBI33346.3|  unnamed protein product                                158   2e-42   Vitis vinifera
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                158   2e-42   Solanum lycopersicum
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                158   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                158   4e-42   Vitis vinifera
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                157   4e-42   Nicotiana sylvestris
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          157   5e-42   Solanum tuberosum [potatoes]
gb|EYU17974.1|  hypothetical protein MIMGU_mgv1a006571mg                157   6e-42   Erythranthe guttata [common monkey flower]
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             157   7e-42   Phaseolus vulgaris [French bean]
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     157   8e-42   Eucalyptus grandis [rose gum]
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                156   9e-42   Nicotiana tomentosiformis
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           157   1e-41   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 8                156   1e-41   Fragaria vesca subsp. vesca
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           156   2e-41   Glycine max [soybeans]
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                155   2e-41   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                154   5e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003638494.1|  Pectate lyase                                      148   7e-41   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                154   8e-41   Cucumis melo [Oriental melon]
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          154   8e-41   Cucumis sativus [cucumbers]
ref|XP_009102476.1|  PREDICTED: probable pectate lyase 10               153   2e-40   Brassica rapa
emb|CDY46471.1|  BnaC07g03950D                                          152   2e-40   Brassica napus [oilseed rape]
emb|CDX77400.1|  BnaA07g05380D                                          153   3e-40   
ref|XP_008367255.1|  PREDICTED: probable pectate lyase 1                152   3e-40   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                152   3e-40   Eucalyptus grandis [rose gum]
ref|XP_010106682.1|  hypothetical protein L484_004616                   151   4e-40   Morus notabilis
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                152   4e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007049844.1|  Pectin lyase-like superfamily protein              152   5e-40   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          151   7e-40   
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                151   8e-40   Nelumbo nucifera [Indian lotus]
gb|ABR26682.1|  pectate lyase                                           150   9e-40   Fragaria chiloensis
gb|AAZ31564.1|  pectate lyase isoform 2                                 150   1e-39   Fragaria x ananassa
ref|XP_002297822.1|  pectate lyase family protein                       151   1e-39   Populus trichocarpa [western balsam poplar]
gb|AAK66160.1|  pectate lyase B                                         150   1e-39   Fragaria x ananassa
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     150   1e-39   Eucalyptus grandis [rose gum]
ref|XP_004515610.1|  PREDICTED: probable pectate lyase 8-like           150   1e-39   Cicer arietinum [garbanzo]
gb|AAZ31566.1|  pectate lyase isoform 4                                 150   1e-39   Fragaria x ananassa
gb|AAZ31563.1|  pectate lyase isoform 1                                 150   1e-39   Fragaria x ananassa
ref|XP_003622996.1|  Pectate lyase 1-27                                 150   2e-39   Medicago truncatula
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               150   2e-39   Tarenaya hassleriana [spider flower]
gb|KJB37784.1|  hypothetical protein B456_006G219800                    148   2e-39   Gossypium raimondii
ref|XP_004290232.1|  PREDICTED: probable pectate lyase 20               150   2e-39   Fragaria vesca subsp. vesca
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          150   2e-39   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                150   3e-39   
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         149   3e-39   Jatropha curcas
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          150   3e-39   Cucumis sativus [cucumbers]
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               149   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_009147117.1|  PREDICTED: probable pectate lyase 8                149   4e-39   Brassica rapa
gb|KJB10108.1|  hypothetical protein B456_001G184600                    149   4e-39   Gossypium raimondii
emb|CDY24654.1|  BnaA05g30530D                                          149   4e-39   Brassica napus [oilseed rape]
gb|ACJ83349.1|  unknown                                                 144   4e-39   Medicago truncatula
emb|CDY05305.1|  BnaC05g44980D                                          149   4e-39   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     149   4e-39   Cucumis melo [Oriental melon]
ref|XP_002518146.1|  Pectate lyase precursor, putative                  147   6e-39   
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             148   7e-39   Capsella rubella
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   149   7e-39   Citrus sinensis [apfelsine]
gb|KJB37785.1|  hypothetical protein B456_006G219800                    147   7e-39   Gossypium raimondii
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                149   7e-39   Prunus mume [ume]
ref|XP_010440665.1|  PREDICTED: putative pectate lyase 14               148   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                149   9e-39   Pyrus x bretschneideri [bai li]
gb|AAB71208.1|  pectate lyase                                           147   1e-38   Fragaria x ananassa
ref|XP_002862216.1|  hypothetical protein ARALYDRAFT_359757             142   1e-38   
gb|KDO55843.1|  hypothetical protein CISIN_1g010437mg                   147   1e-38   Citrus sinensis [apfelsine]
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           148   1e-38   Citrus sinensis [apfelsine]
ref|XP_008382653.1|  PREDICTED: probable pectate lyase 10               147   1e-38   
gb|KEH41255.1|  pectate lyase family protein                            148   1e-38   Medicago truncatula
gb|KFK38096.1|  hypothetical protein AALP_AA3G068900                    147   1e-38   Arabis alpina [alpine rockcress]
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                148   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_007140561.1|  hypothetical protein PHAVU_008G123000g             147   2e-38   Phaseolus vulgaris [French bean]
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     147   2e-38   
ref|XP_010435301.1|  PREDICTED: putative pectate lyase 14 isoform X1    147   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006443655.1|  hypothetical protein CICLE_v10019202mg             149   2e-38   
ref|XP_006420566.1|  hypothetical protein CICLE_v10004783mg             148   2e-38   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                147   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                147   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                147   2e-38   Malus domestica [apple tree]
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           147   2e-38   Citrus sinensis [apfelsine]
gb|KJB37786.1|  hypothetical protein B456_006G219800                    147   2e-38   Gossypium raimondii
ref|XP_002884619.1|  pectate lyase family protein                       147   3e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              147   3e-38   
emb|CDY01119.1|  BnaA04g07000D                                          147   3e-38   
ref|NP_187357.1|  putative pectate lyase 8                              146   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139642.1|  PREDICTED: putative pectate lyase 14               147   3e-38   Brassica rapa
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               147   4e-38   Populus euphratica
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                146   5e-38   Eucalyptus grandis [rose gum]
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             147   5e-38   
ref|XP_010466894.1|  PREDICTED: probable pectate lyase 10               146   5e-38   Camelina sativa [gold-of-pleasure]
emb|CDY47327.1|  BnaCnng14640D                                          146   5e-38   Brassica napus [oilseed rape]
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         146   6e-38   Jatropha curcas
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                145   6e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010488576.1|  PREDICTED: probable pectate lyase 10               146   7e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                146   7e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006297684.1|  hypothetical protein CARUB_v10013715mg             146   7e-38   Capsella rubella
ref|XP_010450305.1|  PREDICTED: putative pectate lyase 14               145   7e-38   Camelina sativa [gold-of-pleasure]
gb|KFK31278.1|  hypothetical protein AALP_AA6G091900                    145   8e-38   Arabis alpina [alpine rockcress]
ref|XP_011009338.1|  PREDICTED: probable pectate lyase 8                145   8e-38   Populus euphratica
ref|XP_010513666.1|  PREDICTED: probable pectate lyase 10               145   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002885665.1|  pectate lyase family protein                       145   8e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_008358000.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    149   9e-38   
ref|XP_010547043.1|  PREDICTED: probable pectate lyase 8                145   9e-38   Tarenaya hassleriana [spider flower]
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                145   9e-38   Populus euphratica
gb|KHG26906.1|  hypothetical protein F383_09796                         145   1e-37   Gossypium arboreum [tree cotton]
ref|XP_002521130.1|  Pectate lyase precursor, putative                  145   1e-37   Ricinus communis
dbj|BAB01216.1|  pectate lyase                                          145   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301766.2|  hypothetical protein POPTR_0002s23990g             145   1e-37   Populus trichocarpa [western balsam poplar]
ref|NP_189110.1|  probable pectate lyase 10                             145   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435302.1|  PREDICTED: putative pectate lyase 14 isoform X2    144   2e-37   Camelina sativa [gold-of-pleasure]
gb|KFK39788.1|  hypothetical protein AALP_AA3G287800                    145   2e-37   Arabis alpina [alpine rockcress]
ref|NP_001190715.1|  putative pectate lyase 14                          145   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003552152.2|  PREDICTED: probable pectate lyase 20-like          145   2e-37   Glycine max [soybeans]
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             144   2e-37   
ref|XP_004152014.1|  PREDICTED: probable pectate lyase 8-like           144   3e-37   Cucumis sativus [cucumbers]
ref|XP_003530885.1|  PREDICTED: probable pectate lyase 20-like          144   3e-37   Glycine max [soybeans]
gb|KHG06252.1|  hypothetical protein F383_10745                         144   3e-37   Gossypium arboreum [tree cotton]
gb|KHG30349.1|  hypothetical protein F383_15991                         145   3e-37   Gossypium arboreum [tree cotton]
ref|XP_008447332.1|  PREDICTED: probable pectate lyase 8                144   3e-37   Cucumis melo [Oriental melon]
emb|CAB41931.1|  pectate lyase like protein                             144   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193057.4|  putative pectate lyase 14                             143   4e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDY56668.1|  BnaCnng30870D                                          143   4e-37   Brassica napus [oilseed rape]
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               143   5e-37   Brassica rapa
emb|CDY19932.1|  BnaA09g03190D                                          143   5e-37   Brassica napus [oilseed rape]
gb|KJB72155.1|  hypothetical protein B456_011G161900                    144   5e-37   Gossypium raimondii
ref|XP_010558823.1|  PREDICTED: probable pectate lyase 8                143   5e-37   Tarenaya hassleriana [spider flower]
gb|AAM61584.1|  putative pectate lyase                                  143   6e-37   Arabidopsis thaliana [mouse-ear cress]
gb|ACB12931.1|  pectate lyase 1-27                                      143   7e-37   Populus tremula x Populus tremuloides
gb|AFZ78654.1|  pectate lyase                                           143   9e-37   Populus tomentosa [Chinese white poplar]
ref|XP_002304700.1|  pectate lyase family protein                       143   9e-37   Populus trichocarpa [western balsam poplar]
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     142   1e-36   Elaeis guineensis
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                142   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     142   1e-36   Elaeis guineensis
gb|AAX88800.1|  ripening-related pectate lyase                          142   1e-36   Mangifera indica
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                142   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_010439830.1|  PREDICTED: probable pectate lyase 20               142   2e-36   Camelina sativa [gold-of-pleasure]
dbj|BAB10313.1|  pectate lyase                                          141   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568705.1|  putative pectate lyase 20                             142   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63307.1|  pectate lyase                                           142   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863927.1|  pectate lyase family protein                       141   3e-36   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                141   3e-36   Populus euphratica
gb|ADP09680.1|  pectate lyase                                           141   3e-36   Rosa x borboniana [Bourbon rose]
ref|XP_010442341.1|  PREDICTED: probable pectate lyase 20               140   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          141   6e-36   Amborella trichopoda
ref|XP_010109687.1|  hypothetical protein L484_015172                   140   6e-36   Morus notabilis
ref|XP_010522431.1|  PREDICTED: probable pectate lyase 1                140   6e-36   Tarenaya hassleriana [spider flower]
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               140   7e-36   Tarenaya hassleriana [spider flower]
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                139   1e-35   Tarenaya hassleriana [spider flower]
gb|KFK39766.1|  hypothetical protein AALP_AA3G285000                    139   2e-35   Arabis alpina [alpine rockcress]
ref|NP_567409.1|  probable pectate lyase 15                             139   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863264.1|  pectate lyase family protein                       139   2e-35   
ref|XP_009129753.1|  PREDICTED: probable pectate lyase 20               139   2e-35   Brassica rapa
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                139   2e-35   Elaeis guineensis
ref|NP_001190720.1|  probable pectate lyase 15                          139   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     139   4e-35   Eucalyptus grandis [rose gum]
emb|CDY33938.1|  BnaA02g30490D                                          137   6e-35   Brassica napus [oilseed rape]
ref|XP_002870357.1|  pectate lyase family protein                       138   8e-35   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          137   9e-35   Oryza sativa Japonica Group [Japonica rice]
emb|CDY05655.1|  BnaC02g38820D                                          137   1e-34   
emb|CDY01151.1|  BnaA04g06680D                                          137   1e-34   
emb|CAE02420.2|  OSJNBa0095E20.8                                        137   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    137   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               137   1e-34   Brassica rapa
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               137   1e-34   Camelina sativa [gold-of-pleasure]
ref|NP_001052103.1|  Os04g0137100                                       137   1e-34   
gb|EEC76710.1|  hypothetical protein OsI_14719                          137   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               137   1e-34   Brassica rapa
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    137   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004163042.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    136   2e-34   
ref|XP_002892236.1|  pectate lyase family protein                       136   2e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    136   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    136   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    136   3e-34   
emb|CDY18738.1|  BnaC08g08780D                                          136   3e-34   Brassica napus [oilseed rape]
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                136   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL06861.1|  At1g04680/T1G11_6                                       134   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg             135   4e-34   Capsella rubella
emb|CDY53564.1|  BnaC04g55760D                                          135   4e-34   Brassica napus [oilseed rape]
ref|XP_002446075.1|  hypothetical protein SORBIDRAFT_06g001410          134   6e-34   
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    135   7e-34   Arabis alpina [alpine rockcress]
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             134   9e-34   Capsella rubella
ref|NP_563715.1|  putative pectate lyase 1                              134   1e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDX89799.1|  BnaA10g02830D                                          134   1e-33   
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                134   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                134   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009119265.1|  PREDICTED: probable pectate lyase 1                134   2e-33   Brassica rapa
emb|CDX86615.1|  BnaC08g00880D                                          134   2e-33   
emb|CDY61137.1|  BnaC05g48970D                                          133   2e-33   Brassica napus [oilseed rape]
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                133   2e-33   Brassica rapa
ref|XP_009118623.1|  PREDICTED: probable pectate lyase 1 isoform X2     133   3e-33   Brassica rapa
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              133   3e-33   
gb|KJB61086.1|  hypothetical protein B456_009G339700                    133   3e-33   Gossypium raimondii
gb|EPS68938.1|  hypothetical protein M569_05827                         132   3e-33   Genlisea aurea
ref|XP_009118622.1|  PREDICTED: probable pectate lyase 1 isoform X1     133   4e-33   Brassica rapa
ref|NP_001147553.1|  pectate lyase 8                                    133   4e-33   
gb|ABR17791.1|  unknown                                                 132   4e-33   Picea sitchensis
dbj|BAK06362.1|  predicted protein                                      133   4e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     133   4e-33   Phoenix dactylifera
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     133   4e-33   Phoenix dactylifera
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                132   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008789532.1|  PREDICTED: probable pectate lyase 8                131   5e-33   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     132   5e-33   Brachypodium distachyon [annual false brome]
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     132   6e-33   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               132   8e-33   Zea mays [maize]
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     132   8e-33   Phoenix dactylifera
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     132   1e-32   Phoenix dactylifera
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                131   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                131   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17766.1|  unknown                                                 130   2e-32   Picea sitchensis
gb|AAK66161.1|  pectate lyase                                           130   2e-32   Fragaria x ananassa
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     130   3e-32   Elaeis guineensis
ref|XP_010933171.1|  PREDICTED: probable pectate lyase 8 isoform X1     130   3e-32   Elaeis guineensis
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                130   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    130   4e-32   Setaria italica
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                130   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB15669.1|  hypothetical protein B456_002G189900                    129   5e-32   Gossypium raimondii
gb|KJB42428.1|  hypothetical protein B456_007G152500                    129   6e-32   Gossypium raimondii
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             129   7e-32   Capsella rubella
gb|KHF99208.1|  hypothetical protein F383_08934                         129   7e-32   Gossypium arboreum [tree cotton]
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          129   7e-32   Cucumis sativus [cucumbers]
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    129   8e-32   Setaria italica
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               129   1e-31   Cucumis melo [Oriental melon]
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    129   1e-31   
gb|AAN60248.1|  unknown                                                 124   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg             127   2e-31   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     128   2e-31   Elaeis guineensis
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     128   2e-31   Elaeis guineensis
emb|CDX88845.1|  BnaA03g08040D                                          130   3e-31   
ref|XP_002321242.2|  pectate lyase family protein                       126   4e-31   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    127   4e-31   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18               127   5e-31   Fragaria vesca subsp. vesca
gb|EPS63108.1|  hypothetical protein M569_11679                         126   6e-31   Genlisea aurea
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     126   6e-31   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    126   8e-31   Arabis alpina [alpine rockcress]
gb|KJB30978.1|  hypothetical protein B456_005G174600                    124   9e-31   Gossypium raimondii
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg             126   1e-30   Capsella rubella
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                126   1e-30   Phoenix dactylifera
gb|AAF19196.1|AF206320_1  pectate lyase 2                               126   1e-30   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     126   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY41506.1|  BnaA06g22590D                                          125   1e-30   Brassica napus [oilseed rape]
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               125   1e-30   Camelina sativa [gold-of-pleasure]
emb|CAC80136.1|  pectate lyase II enzyme                                125   1e-30   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22               125   2e-30   Brassica rapa
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     125   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17909.1|  unknown                                                 125   2e-30   Picea sitchensis
emb|CDY16732.1|  BnaA09g06500D                                          125   2e-30   Brassica napus [oilseed rape]
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               125   2e-30   Brassica rapa
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               125   2e-30   Camelina sativa [gold-of-pleasure]
emb|CDY65626.1|  BnaC03g74840D                                          125   2e-30   Brassica napus [oilseed rape]
ref|XP_010102919.1|  hypothetical protein L484_018936                   125   3e-30   Morus notabilis
gb|KJB30977.1|  hypothetical protein B456_005G174600                    124   3e-30   Gossypium raimondii
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               124   3e-30   Camelina sativa [gold-of-pleasure]
ref|NP_568967.1|  putative pectate lyase 22                             124   4e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10560.1|  pectate lyase                                          124   4e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30976.1|  hypothetical protein B456_005G174600                    124   4e-30   Gossypium raimondii
ref|XP_010488478.1|  PREDICTED: probable pectate lyase 9                124   5e-30   Camelina sativa [gold-of-pleasure]
gb|AFD54065.1|  nodulation pectate lyase mutant                         123   6e-30   Lotus japonicus
emb|CDY48132.1|  BnaCnng15740D                                          123   8e-30   Brassica napus [oilseed rape]
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               123   1e-29   Malus domestica [apple tree]
ref|XP_008444399.1|  PREDICTED: probable pectate lyase 5                123   1e-29   Cucumis melo [Oriental melon]
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  122   1e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDY03419.1|  BnaC01g16630D                                          123   1e-29   
gb|KDO69410.1|  hypothetical protein CISIN_1g015569mg                   121   1e-29   
gb|AEX93472.1|  nodulation pectate lyase                                123   1e-29   
gb|AFD54064.1|  nodulation pectate lyase mutant                         123   1e-29   
ref|XP_009138507.1|  PREDICTED: probable pectate lyase 18               123   1e-29   
ref|XP_007044917.1|  Pectate lyase family protein                       123   1e-29   
emb|CDY34310.1|  BnaA01g14130D                                          123   1e-29   
ref|XP_002866540.1|  pectate lyase                                      123   1e-29   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               123   1e-29   
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     122   1e-29   
gb|EPS60822.1|  hypothetical protein M569_13978                         122   2e-29   
gb|KHN34377.1|  Putative pectate lyase 22                               122   2e-29   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                122   2e-29   
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     122   2e-29   
ref|XP_010929962.1|  PREDICTED: probable pectate lyase 5                122   2e-29   
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                     122   2e-29   
gb|KDO69409.1|  hypothetical protein CISIN_1g015569mg                   121   2e-29   
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like           122   3e-29   
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640          122   3e-29   
ref|XP_004304764.1|  PREDICTED: probable pectate lyase 8                122   3e-29   
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             122   3e-29   
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18               121   3e-29   
dbj|BAF43572.1|  pectate lyase                                          121   3e-29   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               121   4e-29   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                121   5e-29   
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                121   5e-29   
gb|KEH35002.1|  pectate lyase family protein                            119   5e-29   
ref|XP_006476937.1|  PREDICTED: probable pectate lyase 18-like          121   5e-29   
ref|XP_004143054.1|  PREDICTED: probable pectate lyase 5-like           121   6e-29   
ref|NP_001280201.1|  probable pectate lyase 18 precursor                121   6e-29   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          120   6e-29   
gb|KDO69408.1|  hypothetical protein CISIN_1g015569mg                   120   6e-29   
gb|ABG66730.2|  pectate lyase                                           120   6e-29   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    121   6e-29   
ref|NP_001280839.1|  probable pectate lyase 18 precursor                120   7e-29   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               120   7e-29   
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                   120   7e-29   
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg             120   7e-29   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    120   8e-29   
gb|KFK33662.1|  hypothetical protein AALP_AA5G043100                    120   8e-29   
gb|ABK25017.1|  unknown                                                 120   8e-29   
gb|ABG66729.2|  pectate lyase                                           120   8e-29   
ref|XP_010425491.1|  PREDICTED: putative pectate lyase 11               120   8e-29   
ref|XP_004502359.1|  PREDICTED: probable pectate lyase 22-like          120   9e-29   
gb|EPS58564.1|  hypothetical protein M569_16249                         119   9e-29   
emb|CDY66697.1|  BnaAnng22760D                                          120   9e-29   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                120   1e-28   
ref|XP_009631254.1|  PREDICTED: probable pectate lyase 18               120   1e-28   
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9                120   1e-28   
emb|CDY20049.1|  BnaA09g02020D                                          120   1e-28   
ref|XP_009111570.1|  PREDICTED: putative pectate lyase 11               120   1e-28   
ref|NP_189376.1|  putative pectate lyase 11                             120   1e-28   
ref|XP_007037817.1|  Pectate lyase family protein isoform 3             118   1e-28   
ref|XP_002875382.1|  predicted protein                                  120   1e-28   
gb|KJB51150.1|  hypothetical protein B456_008G203900                    118   1e-28   
ref|XP_008796023.1|  PREDICTED: probable pectate lyase 5                120   1e-28   
emb|CDP15081.1|  unnamed protein product                                120   1e-28   
emb|CDY00156.1|  BnaC09g01450D                                          120   1e-28   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           120   2e-28   
ref|XP_002515037.1|  Pectate lyase precursor, putative                  119   2e-28   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             119   2e-28   
ref|XP_002885608.1|  pectate lyase family protein                       120   2e-28   
ref|XP_010502717.1|  PREDICTED: putative pectate lyase 11               119   2e-28   
ref|XP_004502358.1|  PREDICTED: probable pectate lyase 5-like           119   2e-28   
gb|KJB51151.1|  hypothetical protein B456_008G203900                    118   2e-28   
gb|AGC94753.1|  putative pectate lyase                                  119   2e-28   
gb|EMT28700.1|  hypothetical protein F775_17439                         119   2e-28   
ref|XP_003638513.1|  Pectate lyase                                      119   3e-28   
gb|ABO28477.1|  pectate lyase precursor                                 118   3e-28   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                119   3e-28   
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         119   3e-28   
ref|XP_009109237.1|  PREDICTED: probable pectate lyase 18               119   3e-28   
emb|CDY08948.1|  BnaC08g11780D                                          119   3e-28   
emb|CDY24847.1|  BnaA08g14630D                                          119   3e-28   
ref|XP_006285259.1|  hypothetical protein CARUB_v10006630mg             118   4e-28   
ref|XP_009788173.1|  PREDICTED: probable pectate lyase 18               119   4e-28   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               118   5e-28   
gb|ACK38190.1|  unknown                                                 117   5e-28   
gb|KHG22990.1|  hypothetical protein F383_28754                         118   5e-28   
ref|XP_009762540.1|  PREDICTED: probable pectate lyase 18               118   5e-28   
ref|XP_011010949.1|  PREDICTED: pectate lyase-like                      118   6e-28   
gb|KJB51149.1|  hypothetical protein B456_008G203900                    118   6e-28   
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               118   6e-28   
ref|XP_002311747.2|  pectate lyase 5 precursor family protein           118   6e-28   
gb|KFK29019.1|  hypothetical protein AALP_AA7G078200                    118   6e-28   
ref|XP_010100325.1|  hypothetical protein L484_027633                   118   6e-28   
ref|XP_003618787.1|  Pectate lyase                                      118   6e-28   
ref|XP_002300069.1|  pectate lyase family protein                       118   6e-28   
ref|XP_010695977.1|  PREDICTED: probable pectate lyase 18               118   6e-28   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    118   7e-28   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               118   7e-28   
emb|CDX77470.1|  BnaA07g06080D                                          118   7e-28   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               118   7e-28   
gb|KJB19534.1|  hypothetical protein B456_003G108300                    116   8e-28   
emb|CAA63496.1|  pectate lyase                                          117   1e-27   
emb|CDX92652.1|  BnaC07g39100D                                          117   1e-27   
ref|XP_006291220.1|  hypothetical protein CARUB_v10017351mg             117   1e-27   
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     117   1e-27   
gb|KHN14071.1|  Putative pectate lyase 18                               112   1e-27   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          117   1e-27   
ref|XP_010528200.1|  PREDICTED: putative pectate lyase 11               117   1e-27   
ref|XP_007163700.1|  hypothetical protein PHAVU_001G256800g             117   1e-27   
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5                117   1e-27   
emb|CDY11033.1|  BnaA03g46920D                                          117   2e-27   
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                117   2e-27   
ref|NP_189065.2|  putative pectate lyase 9                              117   2e-27   
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         117   2e-27   
ref|XP_006297643.1|  hypothetical protein CARUB_v10013661mg             117   2e-27   
ref|XP_010514446.1|  PREDICTED: putative pectate lyase 11 isoform X1    117   2e-27   
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                116   2e-27   
ref|XP_010433725.1|  PREDICTED: probable pectate lyase 18               116   2e-27   
ref|XP_010448519.1|  PREDICTED: probable pectate lyase 18               116   2e-27   
ref|XP_003608909.1|  Pectate lyase                                      116   2e-27   
gb|AFK44189.1|  unknown                                                 116   2e-27   
gb|AEN70968.1|  pectate lyase                                           116   2e-27   
gb|AES72123.2|  pectate lyase family protein                            116   2e-27   
ref|XP_010536660.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    116   3e-27   
emb|CAA22985.1|  putative pectate lyase                                 116   3e-27   
ref|NP_567707.1|  putative pectate lyase 18                             116   3e-27   
gb|AAK25850.1|AF360140_1  putative pectate lyase                        116   3e-27   
gb|AAM12784.1|  putative pectate-lyase                                  115   3e-27   
gb|AEN70981.1|  pectate lyase                                           116   3e-27   
gb|KHG19997.1|  hypothetical protein F383_02891                         116   3e-27   
gb|AEN70965.1|  pectate lyase                                           116   3e-27   
gb|ADB90479.1|  pectate lyase                                           116   3e-27   
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg             116   3e-27   
gb|AEN70964.1|  pectate lyase                                           116   3e-27   
gb|AEN70963.1|  pectate lyase                                           116   3e-27   
ref|XP_002867644.1|  pectate lyase family protein                       116   3e-27   
gb|ADB90477.1|  pectate lyase                                           116   3e-27   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               116   3e-27   
gb|ADB90476.1|  pectate lyase                                           116   3e-27   
gb|ADB90475.1|  pectate lyase                                           116   3e-27   
sp|O24554.1|PLY_ZINVI  RecName: Full=Pectate lyase; AltName: Full...    116   3e-27   
gb|AAM65103.1|  putative pectate lyase                                  116   3e-27   
gb|AEN70977.1|  pectate lyase                                           116   3e-27   
gb|AEN70985.1|  pectate lyase                                           116   4e-27   
gb|KJB08081.1|  hypothetical protein B456_001G062400                    115   4e-27   
gb|ADB90478.1|  pectate lyase                                           115   4e-27   
gb|KHG22755.1|  hypothetical protein F383_29653                         115   4e-27   
ref|XP_006447221.1|  hypothetical protein CICLE_v10015474mg             115   4e-27   
emb|CDY03964.1|  BnaC02g36790D                                          115   4e-27   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                115   4e-27   
emb|CDY34149.1|  BnaA02g28910D                                          115   4e-27   
gb|ABR18032.1|  unknown                                                 113   4e-27   
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             115   4e-27   
emb|CBI17713.3|  unnamed protein product                                115   5e-27   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               115   5e-27   
ref|XP_006351443.1|  PREDICTED: probable pectate lyase 18-like          115   5e-27   
ref|XP_009129418.1|  PREDICTED: putative pectate lyase 11               115   5e-27   
ref|XP_010111662.1|  hypothetical protein L484_017690                   115   6e-27   
dbj|BAI94495.1|  pectate lyase                                          115   6e-27   
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5                115   7e-27   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                115   7e-27   
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     115   7e-27   
gb|AEN70984.1|  pectate lyase                                           115   8e-27   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          115   8e-27   
gb|AAY85180.1|  pectate lyase                                           115   8e-27   
ref|NP_001268051.1|  pectate lyase precursor                            115   9e-27   
emb|CDX83690.1|  BnaC07g24300D                                          115   9e-27   
gb|AIA94884.1|  CAZy families PL1 protein                               108   1e-26   
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                114   1e-26   
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         114   1e-26   
ref|XP_007215475.1|  hypothetical protein PRUPE_ppa006569mg             114   1e-26   
dbj|BAB59066.1|  pectate lyase                                          114   1e-26   
ref|XP_010682362.1|  PREDICTED: probable pectate lyase 5                114   1e-26   
ref|XP_003601871.1|  Pectate lyase                                      114   2e-26   
ref|XP_002314576.1|  pectate lyase 5 precursor family protein           114   2e-26   
ref|XP_006591479.1|  PREDICTED: probable pectate lyase 5-like           114   2e-26   
ref|XP_003551943.1|  PREDICTED: probable pectate lyase 5-like           113   3e-26   
gb|KDO40644.1|  hypothetical protein CISIN_1g015623mg                   113   3e-26   
gb|ABR18471.1|  unknown                                                 114   3e-26   
emb|CDY32557.1|  BnaC02g17500D                                          113   4e-26   
emb|CDY12666.1|  BnaA02g13340D                                          113   4e-26   
ref|XP_009127577.1|  PREDICTED: probable pectate lyase 5                113   4e-26   
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like          113   4e-26   
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like          113   4e-26   
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                113   4e-26   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                113   4e-26   
emb|CDY56220.1|  BnaAnng14170D                                          113   4e-26   
ref|XP_006604001.1|  PREDICTED: pectate lyase-like                      112   4e-26   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    112   5e-26   
gb|KJB50292.1|  hypothetical protein B456_008G162500                    112   5e-26   
gb|KJB50293.1|  hypothetical protein B456_008G162500                    112   5e-26   
ref|XP_003524720.1|  PREDICTED: pectate lyase-like                      112   5e-26   
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                112   6e-26   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     112   7e-26   
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    112   7e-26   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               112   8e-26   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                112   8e-26   
ref|XP_011042354.1|  PREDICTED: probable pectate lyase 5                112   8e-26   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           112   8e-26   
emb|CDY01846.1|  BnaC06g28860D                                          112   9e-26   
ref|XP_009340844.1|  PREDICTED: pectate lyase-like                      112   9e-26   
ref|XP_009151964.1|  PREDICTED: putative pectate lyase 11 isoform X1    112   1e-25   
ref|XP_008230481.1|  PREDICTED: pectate lyase-like                      112   1e-25   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               112   1e-25   
dbj|BAA95715.1|  pectate lyase-like protein                             111   1e-25   
ref|XP_010322529.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    111   1e-25   
gb|KJB33886.1|  hypothetical protein B456_006G036300                    111   1e-25   
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                111   2e-25   
ref|XP_002526952.1|  Pectate lyase precursor, putative                  111   2e-25   
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      111   2e-25   
gb|KJB11588.1|  hypothetical protein B456_001G267300                    111   2e-25   
gb|KDO82122.1|  hypothetical protein CISIN_1g015702mg                   109   2e-25   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      110   3e-25   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                110   3e-25   
gb|KHN24117.1|  Putative pectate lyase 5                                110   3e-25   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          110   4e-25   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                110   4e-25   
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg             110   4e-25   
gb|KDO82121.1|  hypothetical protein CISIN_1g015702mg                   109   4e-25   
ref|XP_007163701.1|  hypothetical protein PHAVU_001G256900g             110   5e-25   
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5                109   6e-25   
gb|KHN05801.1|  Putative pectate lyase 22                               109   6e-25   
ref|XP_006830637.1|  hypothetical protein AMTR_s00120p00111300          111   6e-25   
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like           109   8e-25   
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                   109   8e-25   
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                      108   1e-24   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                108   1e-24   
emb|CDY28857.1|  BnaC06g26450D                                          108   1e-24   
ref|XP_007031685.1|  Pectin lyase-like superfamily protein              108   2e-24   



>ref|XP_006352706.1| PREDICTED: probable pectate lyase 10-like [Solanum tuberosum]
Length=434

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E  +  SL  S+MA+RL+ + E +HE AVDDPEAIASMVD S+RN+TERRKLGYFSC TG
Sbjct  33   EAEQFQSLSNSTMANRLSGNDELRHEHAVDDPEAIASMVDMSIRNSTERRKLGYFSCTTG  92

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            NPIDDCWRCD NW RNR+RLADC+IGFGRNAIGGRDG++YVVTD
Sbjct  93   NPIDDCWRCDRNWQRNRRRLADCSIGFGRNAIGGRDGRFYVVTD  136



>ref|XP_009804999.1| PREDICTED: probable pectate lyase 8 [Nicotiana sylvestris]
Length=439

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +1

Query  241  SQQRAEETELWSLEKSSMADRLNNSYESQHED-AVDDPEAIASMVDRSVRNATERRKLGY  417
            S    E  +  SL  S+MA+RLN      HE  AVDDP+ +ASMVD S+RN+TERRKLG+
Sbjct  25   STSPEEAKQFQSLNNSTMANRLNEENVPNHEKHAVDDPDMVASMVDMSIRNSTERRKLGF  84

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            FSC TGNPIDDCWRCD NW RNRKRLADCAIGFGRNAIGGRDGKYYVVTDP
Sbjct  85   FSCGTGNPIDDCWRCDRNWQRNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  135



>ref|XP_006350301.1| PREDICTED: probable pectate lyase 20-like [Solanum tuberosum]
Length=439

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  247  QRAEETELW-SLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFS  423
              AEE E + SL+  +MA+ L+      HE AVDDPE + SMVD S+RN+TERRKLG+FS
Sbjct  28   HSAEEAEQFQSLKNLTMANSLSEENVPNHEHAVDDPEKVVSMVDMSIRNSTERRKLGFFS  87

Query  424  CATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            C TGNPIDDCWRCD NW RNRKRLADCAIGFGRNAIGGRDGKYYVVTDP
Sbjct  88   CGTGNPIDDCWRCDRNWQRNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  136



>ref|XP_009624534.1| PREDICTED: probable pectate lyase 8 [Nicotiana tomentosiformis]
Length=438

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +1

Query  241  SQQRAEETELWSLEKSSMADRLNNSYESQHED-AVDDPEAIASMVDRSVRNATERRKLGY  417
            S    E  +  SL  S+MA+RL+      HE  AVDDPE +ASMVD S+RN+TERRKLG+
Sbjct  24   SNSPEEAKQFQSLNNSTMANRLSEENVPNHEKHAVDDPEMVASMVDMSIRNSTERRKLGF  83

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            FSC TGNPIDDCWRCD NW RNRKRLADCAIGFGRNAIGGRDGKYYVVTD
Sbjct  84   FSCGTGNPIDDCWRCDRNWQRNRKRLADCAIGFGRNAIGGRDGKYYVVTD  133



>ref|XP_004242391.1| PREDICTED: probable pectate lyase 8 [Solanum lycopersicum]
Length=434

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +1

Query  241  SQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYF  420
            S ++AE+ +  SL  S+M +RL+ + E +HE A DDPEAIASMVD S+RN+TERRKLGYF
Sbjct  30   SIEQAEQFQ--SLSNSTMTNRLSGNDELRHEHAEDDPEAIASMVDMSIRNSTERRKLGYF  87

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            SC TGNPIDDCWRCD NW RNR+RLADC+IGFGRNAIGGRDG++YVVTD
Sbjct  88   SCRTGNPIDDCWRCDRNWQRNRRRLADCSIGFGRNAIGGRDGRFYVVTD  136



>ref|XP_009609746.1| PREDICTED: probable pectate lyase 8 [Nicotiana tomentosiformis]
Length=437

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E  +  SL  S++A+RL+ + E +HE A DDPEAIASMV  S+RN+TERRKLGYFSC TG
Sbjct  29   EAKQFQSLSSSTLANRLSENDELRHEHAEDDPEAIASMVAMSIRNSTERRKLGYFSCTTG  88

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            NPIDDCWRCD +W RNRKRLADC+IGFGRNAIGGRDG+YYVVTD
Sbjct  89   NPIDDCWRCDRHWVRNRKRLADCSIGFGRNAIGGRDGRYYVVTD  132



>ref|XP_004247105.1| PREDICTED: probable pectate lyase 8 [Solanum lycopersicum]
Length=439

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = +1

Query  247  QRAEETELW-SLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFS  423
              AEE E + SL+  +M + L+      HE AVDDPE + SMVD S++N+TERRKLG+FS
Sbjct  28   HSAEEAEQFQSLKNLTMTNSLSEENVPNHEHAVDDPEKVVSMVDMSIKNSTERRKLGFFS  87

Query  424  CATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            C TGNPIDDCWRCD NW RNRKRLADCAIGFGRNAIGGRDGKYYVVTDP
Sbjct  88   CGTGNPIDDCWRCDRNWQRNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  136



>ref|XP_009799817.1| PREDICTED: probable pectate lyase 8 [Nicotiana sylvestris]
Length=437

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +1

Query  241  SQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYF  420
            S+   EE +  SL  S+M +RL+ + E +HE A  DPEAIASMV  S+RN+TERRKLGYF
Sbjct  24   SKSIEEEKQFQSLRNSTMVNRLSENDELRHEHAEVDPEAIASMVAMSIRNSTERRKLGYF  83

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            SC TGNPIDDCWRCD +W RNRKRLADC+IGFGRNAIGGRDG+YYVVTD
Sbjct  84   SCTTGNPIDDCWRCDRHWVRNRKRLADCSIGFGRNAIGGRDGRYYVVTD  132



>emb|CDO99404.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
            AE  +L SL  S+MA RL     +  E+AVDDPE IASMV  S++N+TERRKLG+FSC T
Sbjct  43   AELEKLQSLHNSTMAARLEEVEAALAENAVDDPEEIASMVAMSIKNSTERRKLGFFSCGT  102

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            GNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG+YYVVTD
Sbjct  103  GNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRYYVVTD  147



>dbj|BAF43573.1| pectate lyase [Prunus persica]
Length=425

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            EL S   SSMA R+    ES ++ AVDDPE + +MVD S+RN+TERRKLG+FSC TGNPI
Sbjct  20   ELQSSSNSSMAARVAEDDESFNKHAVDDPEEVVAMVDMSIRNSTERRKLGFFSCGTGNPI  79

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD+NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  80   DDCWRCDSNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  121



>ref|XP_008391438.1| PREDICTED: probable pectate lyase 8 [Malus domestica]
Length=446

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            EL S   SSMA R+    E  ++ AV+DPE IASMVD S+RN+TERRKLGYFSC TGNPI
Sbjct  41   ELQSSSNSSMAARVAEDDEGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPI  100

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  101  DDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  142



>emb|CDP03845.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +1

Query  268  LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPID  447
            L S   S++  R N   E +HE AVDDPE +ASMVD S+RN TERRKLG+FSC TGNPID
Sbjct  37   LQSTGNSTIPLRPNEEAEFKHEHAVDDPEMVASMVDMSIRNNTERRKLGFFSCGTGNPID  96

Query  448  DCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DCWRCD NW R RKRLADCAIGFGRNAIGGRDG++Y+VTDP
Sbjct  97   DCWRCDPNWQRQRKRLADCAIGFGRNAIGGRDGRFYIVTDP  137



>ref|XP_007222160.1| hypothetical protein PRUPE_ppa005761mg [Prunus persica]
 gb|ADD62392.1| pectase lyase [Prunus persica]
 gb|EMJ23359.1| hypothetical protein PRUPE_ppa005761mg [Prunus persica]
Length=445

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            EL S   SSMA R+    ES ++ AVDDPE + +MVD S+RN+TERRKLG+FSC TGNPI
Sbjct  40   ELQSSSNSSMAARVAEDDESFNKHAVDDPEEVVAMVDMSIRNSTERRKLGFFSCGTGNPI  99

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD+NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  100  DDCWRCDSNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  141



>ref|XP_008223974.1| PREDICTED: probable pectate lyase 8 [Prunus mume]
Length=445

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            EL S   SSMA R+    ES ++ AVDDPE + +MVD S+RN+TERRKLG+FSC TGNPI
Sbjct  40   ELQSSSNSSMAARVAEDDESFNKHAVDDPEEVVAMVDMSIRNSTERRKLGFFSCGTGNPI  99

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  100  DDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  141



>emb|CAN75298.1| hypothetical protein VITISV_008675 [Vitis vinifera]
Length=445

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = +1

Query  238  MSQQRAEET--ELWSLEKSSMADRLNNS--YESQHEDAVDDPEAIASMVDRSVRNATERR  405
            + + R EE   +L SLE S+MA+RL+ S  +  ++E AV++PE +ASMVD S+RN+TERR
Sbjct  27   LQKLRVEEKPDQLQSLENSTMAERLDKSEGWNERNEHAVENPEEVASMVDMSIRNSTERR  86

Query  406  KLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
             LGYFSC TGNPIDDCWRCD +W  +RKRLADC IGFGRNAIGGRDG+YYVVTDP
Sbjct  87   NLGYFSCGTGNPIDDCWRCDPHWQLHRKRLADCGIGFGRNAIGGRDGRYYVVTDP  141



>ref|XP_002265100.1| PREDICTED: probable pectate lyase 8 [Vitis vinifera]
 emb|CBI37263.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = +1

Query  238  MSQQRAEET--ELWSLEKSSMADRLNNS--YESQHEDAVDDPEAIASMVDRSVRNATERR  405
            + + R EE   +L SLE S+MA+RL+ S  +  ++E AV++PE +ASMVD S+RN+TERR
Sbjct  27   LQKLRVEEKPDQLQSLENSTMAERLDKSEGWNERNEHAVENPEEVASMVDMSIRNSTERR  86

Query  406  KLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
             LGYFSC TGNPIDDCWRCD +W  +RKRLADC IGFGRNAIGGRDG+YYVVTDP
Sbjct  87   NLGYFSCGTGNPIDDCWRCDPHWQLHRKRLADCGIGFGRNAIGGRDGRYYVVTDP  141



>ref|XP_009362042.1| PREDICTED: probable pectate lyase 8 [Pyrus x bretschneideri]
Length=446

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            EL S   SSM  R+    E  ++ AV+DPE IASMVD S+RN+TERRKLGYFSC TGNPI
Sbjct  41   ELQSSSNSSMEARVAEDEEGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPI  100

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  101  DDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  142



>ref|XP_011073763.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=444

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 85/106 (80%), Gaps = 4/106 (4%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
            A E EL S   S+MA++L    E  +E AVDDPE +A MV+ + RN+TERRKLG+FSC T
Sbjct  39   AAEKELQSSSTSTMAEKL----EGLNEHAVDDPEEVARMVEMATRNSTERRKLGFFSCGT  94

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            GNPIDDCWRCD NW RNRKRLADC IGFGRNAIGGRDG+YYVVTDP
Sbjct  95   GNPIDDCWRCDPNWQRNRKRLADCGIGFGRNAIGGRDGRYYVVTDP  140



>ref|XP_008360481.1| PREDICTED: probable pectate lyase 8 [Malus domestica]
Length=446

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            EL S    SMA R+    E  ++ AV+DPE IASMVD S+RN+TERRKLGYFSC TGNPI
Sbjct  41   ELQSSSNLSMAARVAEDDEGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPI  100

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  101  DDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  142



>ref|XP_011080166.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=405

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +1

Query  274  SLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDC  453
            SL  S+M DR +   + +HE AVDDPEA+A+MVD ++RN+TERRKLG+ SC TGNPIDDC
Sbjct  3    SLRNSTMPDR-SQDIKFKHEHAVDDPEAVAAMVDMTIRNSTERRKLGFLSCGTGNPIDDC  61

Query  454  WRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            WRCD NW R+R+RLADCAIGFGRNA+GGRDG+YYVVTDP
Sbjct  62   WRCDRNWIRHRRRLADCAIGFGRNAVGGRDGRYYVVTDP  100



>gb|EYU46355.1| hypothetical protein MIMGU_mgv1a007094mg [Erythranthe guttata]
Length=419

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  295  ADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNW  474
            ++RL+ S E +HE A DDPEAIA+MV+ ++RN+TERRKLG+ SC TGNPIDDCWRCD NW
Sbjct  23   SERLDESGELKHEHAEDDPEAIAAMVESNIRNSTERRKLGFLSCGTGNPIDDCWRCDRNW  82

Query  475  ARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
             RNRKRLADCAIGFGRNA+GGRDG+YYVVTDP
Sbjct  83   IRNRKRLADCAIGFGRNAVGGRDGRYYVVTDP  114



>emb|CAN78491.1| hypothetical protein VITISV_004934 [Vitis vinifera]
Length=418

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 87/112 (78%), Gaps = 9/112 (8%)
 Frame = +1

Query  238  MSQQRAEETE-LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLG  414
            M+  R   TE L S   SSMA R        +E AVDDP+A+ASMVD S+RN+TERRKLG
Sbjct  23   MANDRNGGTEQLQSSNNSSMAAR--------NEHAVDDPDAVASMVDMSIRNSTERRKLG  74

Query  415  YFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            YFSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  75   YFSCGTGNPIDDCWRCDHNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  126



>emb|CBI33346.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 87/112 (78%), Gaps = 9/112 (8%)
 Frame = +1

Query  238  MSQQRAEETE-LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLG  414
            M+  R   TE L S   SSMA R        +E AVDDP+A+ASMVD S+RN+TERRKLG
Sbjct  23   MANDRNGGTEQLQSSNNSSMAAR--------NEHAVDDPDAVASMVDMSIRNSTERRKLG  74

Query  415  YFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            YFSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  75   YFSCGTGNPIDDCWRCDHNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  126



>ref|XP_004247823.1| PREDICTED: probable pectate lyase 8 [Solanum lycopersicum]
Length=451

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
             E+ +L S E S+MA  L +  E   + AVDDPE + +MV +S+RN+TERRKLGYFSC T
Sbjct  42   VEKEQLLSSENSTMAVSLEDVEEKLSKHAVDDPEEVVAMVAQSIRNSTERRKLGYFSCGT  101

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            GNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG+YYVVTD
Sbjct  102  GNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRYYVVTD  146



>ref|XP_009370039.1| PREDICTED: probable pectate lyase 8 [Pyrus x bretschneideri]
Length=446

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  238  MSQQRAEETE-LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLG  414
            +S+ R   T+ L S   SSMA R+    +  ++ AV+DPE IASMVD S+RN+TERRKLG
Sbjct  31   ISRNRNGRTDKLQSSSDSSMAARVAEDDQGFNKHAVEDPEEIASMVDMSIRNSTERRKLG  90

Query  415  YFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            YFSC TGNP+DDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  91   YFSCGTGNPVDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  142



>ref|XP_002285639.2| PREDICTED: probable pectate lyase 8 [Vitis vinifera]
Length=464

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +1

Query  307  NNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNR  486
            N+S  +++E AVDDP+A+ASMVD S+RN+TERRKLGYFSC TGNPIDDCWRCD NW +NR
Sbjct  73   NSSMAARNEHAVDDPDAVASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDHNWQKNR  132

Query  487  KRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            KRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  133  KRLADCGIGFGRNAIGGRDGRFYVVTDP  160



>ref|XP_009775177.1| PREDICTED: probable pectate lyase 8 [Nicotiana sylvestris]
Length=452

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
             E+ +L S E S+MA  L    E   + AVDDPE + SMV  S+RN+TERRKLGYFSC T
Sbjct  43   VEKVQLKSSENSTMAVSLEEIEEKLSKHAVDDPEEVVSMVAESIRNSTERRKLGYFSCGT  102

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            GNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG+YYVVTD
Sbjct  103  GNPIDDCWRCDRNWQKNRKRLADCGIGFGRNAIGGRDGRYYVVTD  147



>ref|XP_006360328.1| PREDICTED: probable pectate lyase 15-like [Solanum tuberosum]
Length=454

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
             E+ +L S E S+MA  L    E   + AVDDPE + +MV  S+RN+TERRKLGYFSC T
Sbjct  45   VEKEQLLSSENSTMAVSLEEVEEKLSKHAVDDPEEVVAMVAESIRNSTERRKLGYFSCGT  104

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            GNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG+YYVVTD
Sbjct  105  GNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRYYVVTD  149



>gb|EYU17974.1| hypothetical protein MIMGU_mgv1a006571mg [Erythranthe guttata]
Length=438

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 7/112 (6%)
 Frame = +1

Query  247  QRAEET----ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLG  414
            +R EE      L +L  S+MA+RL    E  +  AVDDPEAIA+MV+ ++RN+TERRKLG
Sbjct  27   ERTEEIRQRKSLRNLRNSTMAERLE---EFDNPHAVDDPEAIATMVNMAIRNSTERRKLG  83

Query  415  YFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +FSC TGNPIDDCWRCD NW RNR+RLADC+IGFGRNA+GGRDG++YVVTDP
Sbjct  84   FFSCGTGNPIDDCWRCDRNWIRNRRRLADCSIGFGRNAVGGRDGRFYVVTDP  135



>ref|XP_007145412.1| hypothetical protein PHAVU_007G236800g [Phaseolus vulgaris]
 gb|ESW17406.1| hypothetical protein PHAVU_007G236800g [Phaseolus vulgaris]
Length=451

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
             E+  L SL+ SSM +R   + +   E AV +PE + SMV+ S+ N+T+RR LG+FSC T
Sbjct  42   VEKHRLPSLQNSSMVERAKEAEKLNEEAAVANPEEVVSMVEMSIHNSTQRRNLGFFSCGT  101

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            GNPIDDCWRCD NW RNRKRLADC IGFGRNAIGGRDGKYYVVTDP
Sbjct  102  GNPIDDCWRCDPNWQRNRKRLADCGIGFGRNAIGGRDGKYYVVTDP  147



>ref|XP_010023767.1| PREDICTED: probable pectate lyase 8 isoform X1 [Eucalyptus grandis]
 gb|KCW60135.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=444

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 88/116 (76%), Gaps = 7/116 (6%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRL-----NNSYESQHEDAVDDPEAIASMVDRSVRNATER  402
            MS     ETE  S + SSMA  L        + S+H  AV+DPE IASMV+ S+RN+TER
Sbjct  27   MSPLGNVETEKLSSKNSSMAASLLAEEEVGDHSSRH--AVEDPEEIASMVEMSIRNSTER  84

Query  403  RKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            RKLGYFSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  85   RKLGYFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  140



>ref|XP_009593549.1| PREDICTED: probable pectate lyase 8 [Nicotiana tomentosiformis]
Length=447

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
            AE+ +L S E  +MA  L    E   + AVDDPE + SMV  S+RN+TERR+LGYFSC T
Sbjct  38   AEKVQLKSSENLTMAASLEEIEEKLSKHAVDDPEQVVSMVAESIRNSTERRRLGYFSCGT  97

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            GNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG+YYVVTD
Sbjct  98   GNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRYYVVTD  142



>ref|XP_003555714.2| PREDICTED: probable pectate lyase 1-like [Glycine max]
Length=489

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
             E   L SL  SSMA+R   + +   + AV +PE + SMV+ S++N+TERRKLG+FSC T
Sbjct  80   VERHRLPSLTNSSMAERAKEAEKLNEQAAVANPEEVVSMVEMSIQNSTERRKLGFFSCGT  139

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            GNPIDDCWRCD NW RNRKRLADC IGFGRNAIGGRDGK+YVVTDP
Sbjct  140  GNPIDDCWRCDPNWQRNRKRLADCGIGFGRNAIGGRDGKFYVVTDP  185



>ref|XP_004289729.1| PREDICTED: probable pectate lyase 8 [Fragaria vesca subsp. vesca]
Length=451

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +1

Query  265  ELWSLEKSSMADRLN-NSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNP  441
            EL S   SSMA R+N N     ++ AV++P+ IA+MVD S+RN+TERRKLGYFSC TGNP
Sbjct  45   ELQSSSNSSMAPRVNENDDGGLNKHAVENPDEIAAMVDMSIRNSTERRKLGYFSCGTGNP  104

Query  442  IDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            IDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  105  IDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  147



>ref|XP_003535958.1| PREDICTED: probable pectate lyase 1-like [Glycine max]
 gb|KHN24365.1| Putative pectate lyase 15 [Glycine soja]
Length=450

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
             E   L SL  SSM +R   + +   + AV +PE + SMV+ S++N+TERRKLGYFSC T
Sbjct  41   VERHRLPSLTNSSMVERAKEADKLNEQAAVANPEEVVSMVEMSIQNSTERRKLGYFSCGT  100

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            GNPIDDCWRCD NW RNRKRLADC IGFGRNAIGGRDGK+YVVTDP
Sbjct  101  GNPIDDCWRCDPNWQRNRKRLADCGIGFGRNAIGGRDGKFYVVTDP  146



>ref|XP_008339288.1| PREDICTED: probable pectate lyase 8 [Malus domestica]
Length=446

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            +L S   SSMA R+    +  ++ AV+DPE IASMVD S+RN+TERRKLGYFSC TGNP 
Sbjct  41   KLQSSSDSSMAARVAEDDQGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPX  100

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  101  DDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  142



>ref|XP_010684949.1| PREDICTED: probable pectate lyase 8 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +1

Query  244  QQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFS  423
            Q    E +L SL+ SSMADR   +     + AV+ PE I SMV RS+ N+T RR LGYFS
Sbjct  34   QTLKVEEQLKSLKNSSMADRAREAEVKSEQAAVEQPEEIVSMVQRSIDNSTARRNLGYFS  93

Query  424  CATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            C TGNPIDDCWRCD++W  NRKRLADCAIGFGRNA+GGRDG++YVVTDP
Sbjct  94   CGTGNPIDDCWRCDSDWHNNRKRLADCAIGFGRNAVGGRDGRFYVVTDP  142



>ref|XP_003638494.1| Pectate lyase, partial [Medicago truncatula]
Length=194

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 3/114 (3%)
 Frame = +1

Query  238  MSQQRAEETE---LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRK  408
            +SQ    ETE   L S   SSMA R   + +     AV +P+ +ASMV+  ++N+TERR 
Sbjct  33   ISQFSNVETETHRLPSFNDSSMAAREKQAEKLNERAAVANPKEVASMVEMHIQNSTERRN  92

Query  409  LGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            LG+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDGKYYVVTDP
Sbjct  93   LGFFSCGTGNPIDDCWRCDRNWQQNRKRLADCGIGFGRNAIGGRDGKYYVVTDP  146



>ref|XP_008438392.1| PREDICTED: probable pectate lyase 8 [Cucumis melo]
Length=447

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            +L S   S+MA RL+ + +  +E AVD+PE IA+MVD S+RNAT RR+LG+FSC TGNPI
Sbjct  42   KLQSSSNSTMAVRLDETKDLGNEHAVDNPEEIAAMVDMSIRNATARRELGFFSCGTGNPI  101

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            DDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  102  DDCWRCDPNWQQNRKRLADCGIGFGRNAIGGRDGRFYVVTD  142



>ref|XP_004134015.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 ref|XP_004157662.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 gb|KGN56767.1| hypothetical protein Csa_3G133180 [Cucumis sativus]
Length=447

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 98/142 (69%), Gaps = 2/142 (1%)
 Frame = +1

Query  148  MAAASSSYW-RLVFHWsllaalaflflnasaMSQQRAEETE-LWSLEKSSMADRLNNSYE  321
            MA A S  W RL+     +  +  +      + +     TE L S   S+MA RL+ + +
Sbjct  1    MAMAESGKWIRLILLVVFMLFVGAIARAPKEIPEIENGGTEKLQSSSNSTMAVRLDEAKD  60

Query  322  SQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLAD  501
              +E AVD+PE IA+MVD S+RNAT RR+LG+FSC TGNPIDDCWRCD NW +NRKRLAD
Sbjct  61   LGNEHAVDNPEEIAAMVDMSIRNATARRELGFFSCGTGNPIDDCWRCDPNWQQNRKRLAD  120

Query  502  CAIGFGRNAIGGRDGKYYVVTD  567
            C IGFGRNAIGGRDG++YVVTD
Sbjct  121  CGIGFGRNAIGGRDGRFYVVTD  142



>ref|XP_009102476.1| PREDICTED: probable pectate lyase 10 [Brassica rapa]
Length=439

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 5/113 (4%)
 Frame = +1

Query  241  SQQRAEETELW---SLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKL  411
            +  RA ETE     SL  SS AD L++S  ++H  AV++PE +A++VD ++RN+TERRKL
Sbjct  25   ASTRAHETEELKSQSLTNSSTADNLSDSAWNEH--AVENPEEVAALVDMTIRNSTERRKL  82

Query  412  GYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            G+FSCATGNPIDDCWRCD NW   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  83   GFFSCATGNPIDDCWRCDRNWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  135



>emb|CDY46471.1| BnaC07g03950D [Brassica napus]
Length=439

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 5/113 (4%)
 Frame = +1

Query  241  SQQRAEETELW---SLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKL  411
            +  RA ETE     SL  SS AD+L++   ++H  AV++PE +A++VD ++RN+TERRKL
Sbjct  25   ASTRAHETEELKSQSLTNSSTADKLSDGAWNEH--AVENPEEVAALVDMTIRNSTERRKL  82

Query  412  GYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            G+FSCATGNPIDDCWRCD NW   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  83   GFFSCATGNPIDDCWRCDRNWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  135



>emb|CDX77400.1| BnaA07g05380D [Brassica napus]
Length=492

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 5/113 (4%)
 Frame = +1

Query  241  SQQRAEETELW---SLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKL  411
            +  RA ETE     SL  SS AD L++S  ++H  AV++PE +A++VD ++RN+TERRKL
Sbjct  25   ASTRAHETEELKSQSLTNSSTADNLSDSAWNEH--AVENPEEVAALVDMTIRNSTERRKL  82

Query  412  GYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            G+FSCATGNPIDDCWRCD NW   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  83   GFFSCATGNPIDDCWRCDRNWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  135



>ref|XP_008367255.1| PREDICTED: probable pectate lyase 1 [Malus domestica]
Length=405

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  319  ESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            E  ++ AV+DPE IASMVD S+RN+TERRKLGYFSC TGNPIDDCWRCD NW +NRKRLA
Sbjct  68   EGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHKNRKRLA  127

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  128  DCGIGFGRNAIGGRDGRFYVVTDP  151



>ref|XP_010038352.1| PREDICTED: probable pectate lyase 8 [Eucalyptus grandis]
 gb|KCW50165.1| hypothetical protein EUGRSUZ_K03600 [Eucalyptus grandis]
Length=444

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 87/113 (77%), Gaps = 5/113 (4%)
 Frame = +1

Query  238  MSQQRAEET--ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKL  411
            +S  + EE   EL  ++ SSMA R++     ++E AVDDPE +ASMVD S+RN+T RR L
Sbjct  31   LSGSKIEEQTGELQGVKNSSMAGRIS---VERNEHAVDDPEEVASMVDMSIRNSTARRNL  87

Query  412  GYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            G+FSC TGNPIDDCWRCD  W   RKRLADCAIGFGRNA+GGRDGKYYVV+DP
Sbjct  88   GFFSCGTGNPIDDCWRCDPKWYLRRKRLADCAIGFGRNAVGGRDGKYYVVSDP  140



>ref|XP_010106682.1| hypothetical protein L484_004616 [Morus notabilis]
 gb|EXC11270.1| hypothetical protein L484_004616 [Morus notabilis]
Length=397

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +1

Query  292  MADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTN  471
            MA R  N  E  +E AV+DPE +ASMV+  + N+TERRKLG+FSCATGNPIDDCWRCD N
Sbjct  1    MAARNGNIDEGLNEHAVEDPEEVASMVEMEITNSTERRKLGFFSCATGNPIDDCWRCDPN  60

Query  472  WARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            W +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  61   WHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  93



>ref|XP_010672089.1| PREDICTED: probable pectate lyase 1 [Beta vulgaris subsp. vulgaris]
Length=436

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 2/111 (2%)
 Frame = +1

Query  241  SQQRAEETE-LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            +  R+E+TE L SL+  +MA++LN   E  +E AV DPE + ++V  S+RN+T+RR LGY
Sbjct  23   TPPRSEKTEELQSLKNITMAEKLN-EVEIYNEHAVADPEEVVALVHMSIRNSTQRRNLGY  81

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            FSC TGNP+DDCWRCD NW +NRKRLADC IGFGRNAIGG++G++YVVTDP
Sbjct  82   FSCGTGNPVDDCWRCDRNWHKNRKRLADCGIGFGRNAIGGKNGRFYVVTDP  132



>ref|XP_007049844.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOX94001.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=444

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            ++ +  EE ++  ++ SSMAD L++     +E AVD+PE IASMVD S+RN+TERRKLGY
Sbjct  31   LNSRLGEEEKVQGMKNSSMADGLDDE-TWINEHAVDNPEEIASMVDMSIRNSTERRKLGY  89

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            FSC TGNPIDDCWRCD  W   RKRLA+C IGFGRNAIGGRDGKYYVV++P
Sbjct  90   FSCGTGNPIDDCWRCDRRWYLRRKRLANCGIGFGRNAIGGRDGKYYVVSNP  140



>ref|XP_004497757.1| PREDICTED: probable pectate lyase 15-like [Cicer arietinum]
Length=452

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            +S    E   L S   SSMA R     +     AV DPE +ASMV+  ++N T+RR LG+
Sbjct  38   LSNVEVETHRLQSFNDSSMAARAKEVEKLNERAAVADPEVVASMVEMHIQNNTQRRNLGF  97

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            FSC TGNPIDDCWRCD NW RNRKRLADC IGFGRNAIGGRDGK+YVVTDP
Sbjct  98   FSCGTGNPIDDCWRCDPNWQRNRKRLADCGIGFGRNAIGGRDGKFYVVTDP  148



>ref|XP_010243989.1| PREDICTED: probable pectate lyase 8 [Nelumbo nucifera]
Length=444

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = +1

Query  238  MSQQRAEETE-LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLG  414
            +S  R E TE L S + S+M  RL  + E  +E AVD+PE +ASMVD S+RN+TERR LG
Sbjct  30   VSDSRTEGTEQLQSSKNSTMEGRLEET-EPWNEHAVDNPEEVASMVDMSIRNSTERRNLG  88

Query  415  YFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            Y SC TGNPIDDCWRCD  W  +RKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  89   YLSCGTGNPIDDCWRCDPQWHLHRKRLADCGIGFGRNAIGGRDGRFYVVTDP  140



>gb|ABR26682.1| pectate lyase [Fragaria chiloensis]
Length=419

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = +1

Query  286  SSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCD  465
            SSMADR N+ +    E AVD+PE IAS+VD S+RN++ RR+LGYFSCATGNPIDDCWRCD
Sbjct  54   SSMADRSNDHWN---EHAVDNPEEIASLVDTSIRNSSTRRELGYFSCATGNPIDDCWRCD  110

Query  466  TNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
              W R+RKRLA+C IGFGRNA+GGRDGKYYVV+DP
Sbjct  111  PQWQRHRKRLANCGIGFGRNAVGGRDGKYYVVSDP  145



>gb|AAZ31564.1| pectate lyase isoform 2 [Fragaria x ananassa]
Length=405

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = +1

Query  286  SSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCD  465
            SSMADR N+ +    E AVD+PE IAS+VD S+RN++ RR+LGYFSCATGNPIDDCWRCD
Sbjct  54   SSMADRSNDDWN---EHAVDNPEEIASLVDTSIRNSSARRELGYFSCATGNPIDDCWRCD  110

Query  466  TNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
              W R+RKRLA+C IGFGRNA+GGRDGKYYVV+DP
Sbjct  111  PQWQRHRKRLANCGIGFGRNAVGGRDGKYYVVSDP  145



>ref|XP_002297822.1| pectate lyase family protein [Populus trichocarpa]
 gb|ABK96205.1| unknown [Populus trichocarpa]
 gb|EEE82627.1| pectate lyase family protein [Populus trichocarpa]
Length=450

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = +1

Query  250  RAEETE-LWSLEKSSMADRLNNSYESQHEDAV-DDPEAIASMVDRSVRNATERRKLGYFS  423
            R+ ETE + S   ++MA R     ++ +E AV D+PE + SMV+ S+RN+TERR+LGYFS
Sbjct  38   RSVETEKVQSSSNTTMAARSQEEADALNEKAVADNPEEVVSMVEMSIRNSTERRRLGYFS  97

Query  424  CATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            C TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  98   CGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  146



>gb|AAK66160.1| pectate lyase B [Fragaria x ananassa]
 gb|AAZ31565.1| pectate lyase isoform 3 [Fragaria x ananassa]
Length=405

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = +1

Query  286  SSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCD  465
            SSMADR N+ +    E AVD+PE IAS+VD S+RN++ RR+LGYFSCATGNPIDDCWRCD
Sbjct  54   SSMADRSNDDWN---EHAVDNPEEIASLVDTSIRNSSARRELGYFSCATGNPIDDCWRCD  110

Query  466  TNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
              W R+RKRLA+C IGFGRNA+GGRDGKYYVV+DP
Sbjct  111  PQWQRHRKRLANCGIGFGRNAVGGRDGKYYVVSDP  145



>ref|XP_010023768.1| PREDICTED: probable pectate lyase 1 isoform X2 [Eucalyptus grandis]
 gb|KCW60136.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=427

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +1

Query  316  YESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRL  495
            + S+H  AV+DPE IASMV+ S+RN+TERRKLGYFSC TGNPIDDCWRCD NW +NRKRL
Sbjct  41   HSSRH--AVEDPEEIASMVEMSIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHKNRKRL  98

Query  496  ADCAIGFGRNAIGGRDGKYYVVTDP  570
            ADC IGFGRNAIGGRDG++YVVTDP
Sbjct  99   ADCGIGFGRNAIGGRDGRFYVVTDP  123



>ref|XP_004515610.1| PREDICTED: probable pectate lyase 8-like [Cicer arietinum]
Length=443

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E+ ++ SL+ SSMA+RL++S+    E AVD+PE IASMVD ++RN TERR L +FSC TG
Sbjct  38   EKLKMQSLKNSSMAERLSDSFN---EHAVDNPEEIASMVDTTIRNYTERRNLNFFSCGTG  94

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD  W   RKRL+DCAIGFGRNAIGGRDG++YVV++P
Sbjct  95   NPIDDCWRCDKRWYLRRKRLSDCAIGFGRNAIGGRDGRFYVVSNP  139



>gb|AAZ31566.1| pectate lyase isoform 4 [Fragaria x ananassa]
Length=405

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = +1

Query  286  SSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCD  465
            SSMADR N+ +    E AVD+PE IAS+VD S+RN++ RR+LGYFSCATGNPIDDCWRCD
Sbjct  54   SSMADRSNDDWN---EHAVDNPEEIASLVDTSIRNSSARRELGYFSCATGNPIDDCWRCD  110

Query  466  TNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
              W R+RKRLA+C IGFGRNA+GGRDGKYYVV+DP
Sbjct  111  PQWQRHRKRLANCGIGFGRNAVGGRDGKYYVVSDP  145



>gb|AAZ31563.1| pectate lyase isoform 1 [Fragaria x ananassa]
Length=405

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = +1

Query  286  SSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCD  465
            SSMADR N+ +    E AVD+PE IAS+VD S+RN++ RR+LGYFSCATGNPIDDCWRCD
Sbjct  54   SSMADRSNDDWN---EHAVDNPEEIASLVDTSIRNSSARRELGYFSCATGNPIDDCWRCD  110

Query  466  TNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
              W R+RKRLA+C IGFGRNA+GGRDGKYYVV+DP
Sbjct  111  PQWQRHRKRLANCGIGFGRNAVGGRDGKYYVVSDP  145



>ref|XP_003622996.1| Pectate lyase 1-27 [Medicago truncatula]
 gb|AES79214.1| pectate lyase-like protein [Medicago truncatula]
Length=444

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 85/105 (81%), Gaps = 2/105 (2%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E+ ++ SL  SSMA+ L  S+++ +E AVD+PE IASMVD ++RN TERR L +FSC TG
Sbjct  38   EKLKMQSLNNSSMAESL--SHDAINEHAVDNPEEIASMVDTTIRNHTERRSLSFFSCGTG  95

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NP+DDCWRCD  W R RKRLADCAIGFGRNAIGGRDG+YYVV +P
Sbjct  96   NPMDDCWRCDKLWYRRRKRLADCAIGFGRNAIGGRDGRYYVVNNP  140



>ref|XP_010532870.1| PREDICTED: putative pectate lyase 14 [Tarenaya hassleriana]
Length=440

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 2/109 (2%)
 Frame = +1

Query  244  QQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFS  423
            ++ AE  +  S   SSMAD L  S ++ HE AV +PE IASMVD S+RN+TERRKLG+FS
Sbjct  30   RETAEFMKSQSSRNSSMADTL--SEDAWHEHAVKNPEEIASMVDMSIRNSTERRKLGFFS  87

Query  424  CATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            C TGN IDDCWRCD +W   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  88   CTTGNTIDDCWRCDRSWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  136



>gb|KJB37784.1| hypothetical protein B456_006G219800 [Gossypium raimondii]
Length=328

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 5/110 (5%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLGYF  420
             E  ++ S + S+MA R +   E  +E AV DPEA+A    S++D ++RN TERRKLG+F
Sbjct  35   VETEKVQSSKNSTMAAR-SEEVEPLNEHAVPDPEAVAAEVESIIDMNIRNVTERRKLGFF  93

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +C TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  94   TCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  143



>ref|XP_004290232.1| PREDICTED: probable pectate lyase 20 [Fragaria vesca subsp. vesca]
Length=447

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
             E  E  S   SSMADR N+ +    E AVD+PE IAS+VD S+RN++ RR+LGYFSCAT
Sbjct  42   VEVEEPKSSFNSSMADRSNDDWN---EHAVDNPEEIASLVDTSIRNSSARRELGYFSCAT  98

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            GNPIDDCWRCD  W R+RKRLA+C IGFGRNA+GGRDGKYYVV+DP
Sbjct  99   GNPIDDCWRCDPQWQRHRKRLANCGIGFGRNAVGGRDGKYYVVSDP  144



>ref|XP_004171543.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
Length=444

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 3/104 (3%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNN---SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E  S   SSMA R+ N     E  +E AVD+P+ IA+ V+ S+RN+TERRKLG+FSC TG
Sbjct  36   EFQSSSNSSMATRVENYDVEQELNNEHAVDNPDEIAASVEMSIRNSTERRKLGFFSCGTG  95

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            NPIDDCWRCD+NW RNRKRLA+C IGFGRNAIGGRDG++YVVTD
Sbjct  96   NPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFYVVTD  139



>ref|XP_011091390.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=452

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMADRLNN-SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFS  423
            +  E+ +L S   S+MA +L     E  +E AVDDPE +A MV+ + RN+TERR LG+FS
Sbjct  40   EEVEKEQLQSSPNSTMAAKLGGIDEEGLNEHAVDDPEEVARMVEMATRNSTERRNLGFFS  99

Query  424  CATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            C TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  100  CGTGNPIDDCWRCDANWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTD  147



>gb|KDP26417.1| hypothetical protein JCGZ_17575 [Jatropha curcas]
Length=442

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 85/110 (77%), Gaps = 4/110 (4%)
 Frame = +1

Query  244  QQRAEETE-LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYF  420
            + R EET    S   SSMAD    S ++ +E AV++P+ +ASMVD SVRN+T RR LG+F
Sbjct  32   KSRLEETRRFQSSNNSSMAD---GSGDAWNEHAVENPDEVASMVDESVRNSTARRNLGFF  88

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            SC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG+YYVV DP
Sbjct  89   SCVTGNPIDDCWRCDRNWQKNRKRLADCGIGFGRNAIGGRDGRYYVVNDP  138



>ref|XP_004138973.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 gb|KGN61525.1| hypothetical protein Csa_2G155600 [Cucumis sativus]
Length=449

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 3/104 (3%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNN---SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E  S   SSMA R+ N     E  +E AVD+P+ IA+ V+ S+RN+TERRKLG+FSC TG
Sbjct  41   EFQSSSNSSMATRVENYDVEQELNNEHAVDNPDEIAASVEMSIRNSTERRKLGFFSCGTG  100

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            NPIDDCWRCD+NW RNRKRLA+C IGFGRNAIGGRDG++YVVTD
Sbjct  101  NPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFYVVTD  144



>ref|XP_010527219.1| PREDICTED: probable pectate lyase 10 [Tarenaya hassleriana]
Length=395

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 79/93 (85%), Gaps = 2/93 (2%)
 Frame = +1

Query  292  MADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTN  471
            MAD   +S +S HE AV +PE IASMVD S+RN+TERRKLG+FSCATGNPIDDCWRCD  
Sbjct  1    MAD--TSSEDSWHEHAVKNPEEIASMVDMSIRNSTERRKLGFFSCATGNPIDDCWRCDQR  58

Query  472  WARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            W   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  59   WHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  91



>ref|XP_009147117.1| PREDICTED: probable pectate lyase 8 [Brassica rapa]
Length=416

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV+ PE +A+MVD S+RN+TERR+LGYFSCATGNPIDDCWRCD  W   RKR
Sbjct  27   SNETWHEHAVEKPEEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKR  86

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG+YYVVTDP
Sbjct  87   LADCSIGFGRNAIGGRDGRYYVVTDP  112



>gb|KJB10108.1| hypothetical protein B456_001G184600 [Gossypium raimondii]
Length=446

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            ++ + +EE +L  L+ SSM + L +  +  +E +VD+PE IASMVD S+RN+TERRKLGY
Sbjct  33   LNSRFSEENKLQGLKNSSMEEGLED-VQWINEHSVDNPEEIASMVDMSIRNSTERRKLGY  91

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            FSC TGNP+DDCWRCD +W   RK LA+C IGFGRNAIGGRDG+YYVVTDP
Sbjct  92   FSCGTGNPVDDCWRCDRHWYLRRKNLANCGIGFGRNAIGGRDGRYYVVTDP  142



>emb|CDY24654.1| BnaA05g30530D [Brassica napus]
Length=416

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV+ PE +A+MVD S+RN+TERR+LGYFSCATGNPIDDCWRCD  W   RKR
Sbjct  27   SNETWHEHAVEKPEEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKR  86

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG+YYVVTDP
Sbjct  87   LADCSIGFGRNAIGGRDGRYYVVTDP  112



>gb|ACJ83349.1| unknown [Medicago truncatula]
Length=206

 Score =   144 bits (362),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = +1

Query  238  MSQQRAEETE---LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRK  408
            +SQ    ETE   L S   SSMA R   + +     AV +P+ +ASMV+  ++N+TERR 
Sbjct  33   ISQFSNVETETHRLPSFNDSSMAAREKQAEKLNERAAVANPKEVASMVEMHIQNSTERRD  92

Query  409  LGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            LG+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDGKY VVTDP
Sbjct  93   LGFFSCGTGNPIDDCWRCDRNWQQNRKRLADCGIGFGRNAIGGRDGKYCVVTDP  146



>emb|CDY05305.1| BnaC05g44980D [Brassica napus]
Length=416

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV+ PE +A+MVD S+RN+TERR+LGYFSCATGNPIDDCWRCD  W   RKR
Sbjct  27   SNETWHEHAVEKPEEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKR  86

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG+YYVVTDP
Sbjct  87   LADCSIGFGRNAIGGRDGRYYVVTDP  112



>ref|XP_008460726.1| PREDICTED: probable pectate lyase 8 isoform X1 [Cucumis melo]
Length=449

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 3/104 (3%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNN---SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E  S   SSMA R+ N     E  +E AVD+P+ IA+ V+ S+RN+TERRKLG+FSC TG
Sbjct  41   EFQSSSDSSMATRVENYDVEQELNNEHAVDNPDEIAASVEMSIRNSTERRKLGFFSCGTG  100

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            NPIDDCWRCD+NW RNRKRLA+C IGFGRNAIGGRDG++YVVTD
Sbjct  101  NPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFYVVTD  144



>ref|XP_002518146.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF44279.1| Pectate lyase precursor, putative [Ricinus communis]
Length=376

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  319  ESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            E ++E AVDDPE + +MV+ S+RN+TERRKLGYFSC TGNPIDDCWRCD NW +NRKRLA
Sbjct  64   EWKNEHAVDDPEEVVAMVEMSIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWQKNRKRLA  123

Query  499  DCAIGFGRNAIGGRDGKYYVVTD  567
            DC IGFGRNAIGGRDG++YVVTD
Sbjct  124  DCGIGFGRNAIGGRDGRFYVVTD  146



>ref|XP_006297767.1| hypothetical protein CARUB_v10013802mg [Capsella rubella]
 gb|EOA30665.1| hypothetical protein CARUB_v10013802mg [Capsella rubella]
Length=418

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV+ PE +A+MVD S+RN+TERR+LGYFSCATGNPIDDCWRCD  W   RKR
Sbjct  29   SNETWHEHAVEKPEEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKR  88

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG+YYVVTDP
Sbjct  89   LADCSIGFGRNAIGGRDGRYYVVTDP  114



>gb|KDO65869.1| hypothetical protein CISIN_1g013239mg [Citrus sinensis]
Length=447

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +1

Query  265  ELWSLEKSSMADRLN-NSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNP  441
            +L S   SSM +R+  +  E  HE AVD+P+ IA+ VD ++RN+TERRKLGYFSC TGNP
Sbjct  41   QLQSSNNSSMPERIEFDDEEWTHEHAVDNPDEIAATVDMAIRNSTERRKLGYFSCGTGNP  100

Query  442  IDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            IDDCWRCD+ W   RKRLADCAIGFGRNAIGGRDG+YYVV+DP
Sbjct  101  IDDCWRCDSRWYLRRKRLADCAIGFGRNAIGGRDGRYYVVSDP  143



>gb|KJB37785.1| hypothetical protein B456_006G219800 [Gossypium raimondii]
Length=377

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 5/110 (5%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLGYF  420
             E  ++ S + S+MA R +   E  +E AV DPEA+A    S++D ++RN TERRKLG+F
Sbjct  35   VETEKVQSSKNSTMAAR-SEEVEPLNEHAVPDPEAVAAEVESIIDMNIRNVTERRKLGFF  93

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +C TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  94   TCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  143



>ref|XP_008235520.1| PREDICTED: probable pectate lyase 8 [Prunus mume]
Length=448

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 3/102 (3%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            EL S + SSMAD    S E+ +E AVD+P+ IASMVD S+RN+TERR LG+FSCATGNP+
Sbjct  47   ELQSSKSSSMADW---SDEALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCATGNPV  103

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD +W  +RKRLA+C IGFGRNA+GGRDGKYYVV +P
Sbjct  104  DDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDGKYYVVNNP  145



>ref|XP_010440665.1| PREDICTED: putative pectate lyase 14 [Camelina sativa]
Length=437

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSC  426
            Q   E++  S   +S AD L+N     HE AV DP+ IA+MVD S+RN+T RRKLG+FSC
Sbjct  28   QDTRESKHDSSRNTSTADNLSNG--EWHEHAVKDPDEIAAMVDMSIRNSTYRRKLGFFSC  85

Query  427  ATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +TGNPIDDCWRCD  W R RKRLA CAIGFGRNA+GGRDG+YY+VTDP
Sbjct  86   STGNPIDDCWRCDKKWHRQRKRLAGCAIGFGRNAVGGRDGRYYIVTDP  133



>ref|XP_009349844.1| PREDICTED: probable pectate lyase 8 [Pyrus x bretschneideri]
Length=451

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
             E  E  S + SSMA+R   S E+  E AVD+P+ IASMVD ++RN+TERR LG+FSCAT
Sbjct  47   VEPKESLSSKNSSMAER---SDEALDEHAVDNPDEIASMVDMTIRNSTERRNLGFFSCAT  103

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            GNPIDDCWRCD  W  +RKRLA+C IGFGRNA+GGRDG+YYVV DP
Sbjct  104  GNPIDDCWRCDPQWQLHRKRLANCGIGFGRNAVGGRDGRYYVVNDP  149



>gb|AAB71208.1| pectate lyase [Fragaria x ananassa]
 gb|AAZ31567.1| pectate lyase isoform 5 [Fragaria x ananassa]
Length=405

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = +1

Query  286  SSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCD  465
            SSMADR N+ +    E AVD+PE IAS+VD S+RN++ RR+LGYFSCATGNPIDDCWRCD
Sbjct  54   SSMADRSNDHWN---EHAVDNPEEIASLVDTSIRNSSTRRELGYFSCATGNPIDDCWRCD  110

Query  466  TNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
              W R+RKR A+C IGFGRNA+GGRDGKYYVV+DP
Sbjct  111  PQWQRHRKRPANCGIGFGRNAVGGRDGKYYVVSDP  145



>ref|XP_002862216.1| hypothetical protein ARALYDRAFT_359757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38474.1| hypothetical protein ARALYDRAFT_359757 [Arabidopsis lyrata subsp. 
lyrata]
Length=200

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++PE +A+MVD S+RN+TERR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  28   SNETWHEHAVENPEEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRRWQSRRKA  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA+CAIGFGRNAIGGRDG+YYVV DP
Sbjct  88   LANCAIGFGRNAIGGRDGRYYVVNDP  113



>gb|KDO55843.1| hypothetical protein CISIN_1g010437mg [Citrus sinensis]
Length=363

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  331  EDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAI  510
            + AVD+P+ IASMV+ S RN+TERRKLGYFSC TGNPIDDCWRCD NW +NRKRLADC I
Sbjct  126  KHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADCGI  185

Query  511  GFGRNAIGGRDGKYYVVTDP  570
            GFGRNAIGGRDG++YVVTDP
Sbjct  186  GFGRNAIGGRDGRFYVVTDP  205



>ref|XP_006480190.1| PREDICTED: probable pectate lyase 8-like [Citrus sinensis]
Length=447

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +1

Query  265  ELWSLEKSSMADRLN-NSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNP  441
            +L S   SSM +R+  +  E  HE AVD+P+ IA+ VD ++RN+TERRKLGYFSC TGNP
Sbjct  41   QLQSSNNSSMPERIEFDDEEWTHEHAVDNPDEIAATVDMAIRNSTERRKLGYFSCGTGNP  100

Query  442  IDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            IDDCWRCD+ W   RKRLADCAIGFGRNA+GGRDG+YYVV+DP
Sbjct  101  IDDCWRCDSRWYLRRKRLADCAIGFGRNAVGGRDGRYYVVSDP  143



>ref|XP_008382653.1| PREDICTED: probable pectate lyase 10 [Malus domestica]
Length=381

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 82/102 (80%), Gaps = 3/102 (3%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            E  S + SSMA+R   S E+  E AVD+P+ IASMVD ++RN+TERR LG+FSCATGNPI
Sbjct  51   ESLSSKNSSMAER---SDEALDEHAVDNPDEIASMVDMTIRNSTERRNLGFFSCATGNPI  107

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD  W  +RKRLA+C IGFGRNA+GGRDG+YYVV DP
Sbjct  108  DDCWRCDPQWQLHRKRLANCGIGFGRNAVGGRDGRYYVVNDP  149



>gb|KEH41255.1| pectate lyase family protein [Medicago truncatula]
Length=450

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 3/114 (3%)
 Frame = +1

Query  238  MSQQRAEETE---LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRK  408
            +SQ    ETE   L S   SSMA R   + +     AV +P+ +ASMV+  ++N+TERR 
Sbjct  33   ISQFSNVETETHRLPSFNDSSMAAREKQAEKLNERAAVANPKEVASMVEMHIQNSTERRN  92

Query  409  LGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            LG+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDGKYYVVTDP
Sbjct  93   LGFFSCGTGNPIDDCWRCDRNWQQNRKRLADCGIGFGRNAIGGRDGKYYVVTDP  146



>gb|KFK38096.1| hypothetical protein AALP_AA3G068900 [Arabis alpina]
Length=416

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV +PE IA+MVD S+RN+T+RRKLGYFSCATGNPIDDCWRCD  W   RKR
Sbjct  27   SNETWHEHAVKNPEEIAAMVDMSIRNSTDRRKLGYFSCATGNPIDDCWRCDRKWQLRRKR  86

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG++Y+VTDP
Sbjct  87   LADCSIGFGRNAIGGRDGRFYIVTDP  112



>ref|XP_009371193.1| PREDICTED: probable pectate lyase 8 [Pyrus x bretschneideri]
Length=451

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 84/102 (82%), Gaps = 3/102 (3%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            E  S + SS+A+R   S E+ +E AVD+P+ IASMVD S+RN+TERR LG+FSCATGNPI
Sbjct  51   ESISFKNSSIAER---SEEALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCATGNPI  107

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD +W  +RKRLA+C IGFGRNA+GGRDG+YYVV +P
Sbjct  108  DDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDGRYYVVNNP  149



>ref|XP_007140561.1| hypothetical protein PHAVU_008G123000g [Phaseolus vulgaris]
 gb|ESW12555.1| hypothetical protein PHAVU_008G123000g [Phaseolus vulgaris]
Length=451

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 3/105 (3%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            +E  + SL+ SSMA+RL ++    +E AVD+PE IASMVD S+RN+T RR L +FSC TG
Sbjct  46   KELRVQSLKNSSMAERLEDAL---NEHAVDNPEEIASMVDESIRNSTARRNLNFFSCGTG  102

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD  W   RKRLA+C IGFGRNAIGGRDG+YYVV+DP
Sbjct  103  NPIDDCWRCDKRWYLRRKRLANCGIGFGRNAIGGRDGRYYVVSDP  147



>ref|XP_008460727.1| PREDICTED: probable pectate lyase 1 isoform X2 [Cucumis melo]
Length=431

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 82/106 (77%), Gaps = 6/106 (6%)
 Frame = +1

Query  250  RAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCA  429
            R EET    +E   +   LNN      E AVD+P+ IA+ V+ S+RN+TERRKLG+FSC 
Sbjct  27   RKEETSKIRVENYDVEQELNN------EHAVDNPDEIAASVEMSIRNSTERRKLGFFSCG  80

Query  430  TGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            TGNPIDDCWRCD+NW RNRKRLA+C IGFGRNAIGGRDG++YVVTD
Sbjct  81   TGNPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFYVVTD  126



>ref|XP_010435301.1| PREDICTED: putative pectate lyase 14 isoform X1 [Camelina sativa]
Length=437

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +1

Query  241  SQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYF  420
            ++Q   +++  S   +S AD L+N     HE AV DP+ IA+MVD S+RN+T RRKLG+F
Sbjct  26   ARQDTRKSKHDSSRNTSTADNLSNG--EWHEHAVKDPDEIAAMVDMSIRNSTYRRKLGFF  83

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            SC+TGNPIDDCWRCD  W R RKRLA CAIGFGRNA+GGRDG+YY+VTDP
Sbjct  84   SCSTGNPIDDCWRCDKKWHRQRKRLAGCAIGFGRNAVGGRDGRYYIVTDP  133



>ref|XP_006443655.1| hypothetical protein CICLE_v10019202mg [Citrus clementina]
 gb|ESR56895.1| hypothetical protein CICLE_v10019202mg [Citrus clementina]
Length=661

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +1

Query  265  ELWSLEKSSMADRLN-NSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNP  441
            +L S   SSM +R+  +  E  HE AVD+P+ IA+ VD ++RN+TERRKLGYFSC TGNP
Sbjct  255  QLQSSNNSSMPERIEFDDEEWTHEHAVDNPDEIAATVDMAIRNSTERRKLGYFSCGTGNP  314

Query  442  IDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            IDDCWRCD+ W   RKRLADCAIGFGRNA+GGRDG+YYVV+DP
Sbjct  315  IDDCWRCDSRWYLRRKRLADCAIGFGRNAVGGRDGRYYVVSDP  357



>ref|XP_006420566.1| hypothetical protein CICLE_v10004783mg [Citrus clementina]
 gb|ESR33806.1| hypothetical protein CICLE_v10004783mg [Citrus clementina]
Length=488

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  331  EDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAI  510
            + AVD+P+ IASMV+ S RN+TERRKLGYFSC TGNPIDDCWRCD NW +NRKRLADC I
Sbjct  126  KHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADCGI  185

Query  511  GFGRNAIGGRDGKYYVVTDP  570
            GFGRNAIGGRDG++YVVTDP
Sbjct  186  GFGRNAIGGRDGRFYVVTDP  205



>ref|XP_010486231.1| PREDICTED: probable pectate lyase 8 [Camelina sativa]
Length=419

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++PE +A+MVD S+RN+TERR+LGYFSC+TGNPIDDCWRCD  W   RKR
Sbjct  30   SNETWHEHAVENPEEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWQLRRKR  89

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG+YYVVT+P
Sbjct  90   LADCSIGFGRNAIGGRDGRYYVVTNP  115



>ref|XP_010447044.1| PREDICTED: probable pectate lyase 8 [Camelina sativa]
Length=417

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++PE +A+MVD S+RN+TERR+LGYFSC+TGNPIDDCWRCD  W   RKR
Sbjct  28   SNETWHEHAVENPEEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWQLRRKR  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG+YYVVT+P
Sbjct  88   LADCSIGFGRNAIGGRDGRYYVVTNP  113



>ref|XP_008372438.1| PREDICTED: probable pectate lyase 8 [Malus domestica]
Length=451

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            E  S + SS+A+R     E+ +E AVD+P+ IASMVD S+RN+TERR LG+FSCATGNPI
Sbjct  51   ESISSKNSSIAERFE---EALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCATGNPI  107

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD +W  +RKRLA+C IGFGRNA+GGRDGKYYVV +P
Sbjct  108  DDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDGKYYVVNNP  149



>ref|XP_006487597.1| PREDICTED: probable pectate lyase 1-like [Citrus sinensis]
Length=445

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  331  EDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAI  510
            + AVD+P+ IASMV+ S RN+TERRKLGYFSC TGNPIDDCWRCD NW +NRKRLADC I
Sbjct  61   KHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADCGI  120

Query  511  GFGRNAIGGRDGKYYVVTDP  570
            GFGRNAIGGRDG++YVVTDP
Sbjct  121  GFGRNAIGGRDGRFYVVTDP  140



>gb|KJB37786.1| hypothetical protein B456_006G219800 [Gossypium raimondii]
Length=447

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 5/110 (5%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLGYF  420
             E  ++ S + S+MA R +   E  +E AV DPEA+A    S++D ++RN TERRKLG+F
Sbjct  35   VETEKVQSSKNSTMAAR-SEEVEPLNEHAVPDPEAVAAEVESIIDMNIRNVTERRKLGFF  93

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +C TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  94   TCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  143



>ref|XP_002884619.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60878.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=416

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD S+RN+TERR+LGYFSCATGNPIDDCWRCD  W   RKR
Sbjct  27   SNETWHEHAVENPDEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKR  86

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG++YVVTDP
Sbjct  87   LADCSIGFGRNAIGGRDGRFYVVTDP  112



>ref|XP_007034463.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY05389.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=447

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +1

Query  241  SQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRK  408
            +    E  +L S   S+MA R +   E  +E AV DP A+A    +M+D ++RN TERRK
Sbjct  31   TSSNVETEKLQSSNNSTMAAR-SEEAEPLNEHAVPDPGAVAAEVETMIDMNIRNVTERRK  89

Query  409  LGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            LG+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  90   LGFFSCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  143



>emb|CDY01119.1| BnaA04g07000D [Brassica napus]
Length=435

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  328  HEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCA  507
            HE AV DPE IA+MVD  +RN+TERR+LGYFSC+TGNPIDDCWRCD  W R RKRLA CA
Sbjct  50   HEHAVKDPEEIAAMVDMKIRNSTERRRLGYFSCSTGNPIDDCWRCDKKWHRQRKRLASCA  109

Query  508  IGFGRNAIGGRDGKYYVVTDP  570
            IGFGRNA+GGRDG++YVVTDP
Sbjct  110  IGFGRNAVGGRDGRFYVVTDP  130



>ref|NP_187357.1| putative pectate lyase 8 [Arabidopsis thaliana]
 sp|Q9M8Z8.1|PLY8_ARATH RecName: Full=Probable pectate lyase 8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF27005.1|AC016827_16 putative pectate lyase [Arabidopsis thaliana]
 dbj|BAH20216.1| AT3G07010 [Arabidopsis thaliana]
 gb|AEE74488.1| putative pectate lyase 8 [Arabidopsis thaliana]
Length=416

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD S+RN+TERR+LGYFSCATGNPIDDCWRCD  W   RKR
Sbjct  27   SNETWHEHAVENPDEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKR  86

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG++YVVTDP
Sbjct  87   LADCSIGFGRNAIGGRDGRFYVVTDP  112



>ref|XP_009139642.1| PREDICTED: putative pectate lyase 14 [Brassica rapa]
Length=434

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  328  HEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCA  507
            HE AV DPE IA+MVD  +RN+TERR+LGYFSC+TGNPIDDCWRCD  W R RKRLA CA
Sbjct  50   HEHAVKDPEEIAAMVDMKIRNSTERRRLGYFSCSTGNPIDDCWRCDKKWHRQRKRLASCA  109

Query  508  IGFGRNAIGGRDGKYYVVTDP  570
            IGFGRNA+GGRDG++YVVTDP
Sbjct  110  IGFGRNAVGGRDGRFYVVTDP  130



>ref|XP_011024740.1| PREDICTED: probable pectate lyase 20 [Populus euphratica]
Length=442

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E  EL S + SSMAD  ++++    E  ++DPE +A+MVD S+RN+TERRKLG+FSC TG
Sbjct  37   ETQELLSSKNSSMADWYDDTWN---EHTMEDPEEVAAMVDESIRNSTERRKLGFFSCGTG  93

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD +W R+RK LA+C IGFGRNA+GGRDG+YYVV++P
Sbjct  94   NPIDDCWRCDPHWQRHRKSLANCGIGFGRNAVGGRDGRYYVVSNP  138



>ref|XP_010069078.1| PREDICTED: probable pectate lyase 8 [Eucalyptus grandis]
 gb|KCW57295.1| hypothetical protein EUGRSUZ_H00093 [Eucalyptus grandis]
Length=450

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 74/92 (80%), Gaps = 7/92 (8%)
 Frame = +1

Query  295  ADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNW  474
            ADRLN       + AVDDPE +ASMVD  +RN+TERR LG+FSC TGNPIDDCWRCD NW
Sbjct  62   ADRLN-------DQAVDDPEKVASMVDMIIRNSTERRNLGFFSCGTGNPIDDCWRCDPNW  114

Query  475  ARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
              NRKRLADC IGFGRNAIGGRDG+ YVVTDP
Sbjct  115  HLNRKRLADCGIGFGRNAIGGRDGRIYVVTDP  146



>ref|XP_006420567.1| hypothetical protein CICLE_v10004783mg [Citrus clementina]
 gb|ESR33807.1| hypothetical protein CICLE_v10004783mg [Citrus clementina]
 gb|KDO55842.1| hypothetical protein CISIN_1g010437mg [Citrus sinensis]
Length=510

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  331  EDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAI  510
            + AVD+P+ IASMV+ S RN+TERRKLGYFSC TGNPIDDCWRCD NW +NRKRLADC I
Sbjct  126  KHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADCGI  185

Query  511  GFGRNAIGGRDGKYYVVTDP  570
            GFGRNAIGGRDG++YVVTDP
Sbjct  186  GFGRNAIGGRDGRFYVVTDP  205



>ref|XP_010466894.1| PREDICTED: probable pectate lyase 10 [Camelina sativa]
Length=441

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            EE +  S   SS A+RL+N   + +E AV +PE +A+MVD +++N+TERR+LG+FSCATG
Sbjct  33   EEPKSHSSSNSSTANRLSNDDGAWNEHAVKNPEDVAAMVDMTIKNSTERRRLGFFSCATG  92

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD NW   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  93   NPIDDCWRCDRNWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  137



>emb|CDY47327.1| BnaCnng14640D [Brassica napus]
Length=433

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  328  HEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCA  507
            HE AV DPE IA+MVD  +RN+TERR+LGYFSC+TGNPIDDCWRCD  W R RKRLA CA
Sbjct  49   HEHAVKDPEEIAAMVDMKIRNSTERRRLGYFSCSTGNPIDDCWRCDKKWHRQRKRLASCA  108

Query  508  IGFGRNAIGGRDGKYYVVTDP  570
            IGFGRNA+GGRDG++Y+VTDP
Sbjct  109  IGFGRNAVGGRDGRFYIVTDP  129



>gb|KDP33375.1| hypothetical protein JCGZ_12924 [Jatropha curcas]
Length=449

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 81/110 (74%), Gaps = 17/110 (15%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            M+    E+TE+W                 ++E AVDDPE + +MV+ S+RN+TERR+LGY
Sbjct  52   MAASSGEDTEIW-----------------KNEHAVDDPEEVVAMVEMSIRNSTERRQLGY  94

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            FSC TGNPIDDCWRCD NW +NRKRLA+C IGFGRNAIGGRDG++YVVTD
Sbjct  95   FSCGTGNPIDDCWRCDPNWQKNRKRLAECGIGFGRNAIGGRDGRFYVVTD  144



>ref|XP_010464311.1| PREDICTED: probable pectate lyase 8 [Camelina sativa]
Length=417

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++PE +A+MVD S+RN+TERR+LGYFSC+TGNPIDDCWRCD  W   RKR
Sbjct  28   SNETWHEHAVENPEEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWQLRRKR  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG++YVVT+P
Sbjct  88   LADCSIGFGRNAIGGRDGRFYVVTNP  113



>ref|XP_010488576.1| PREDICTED: probable pectate lyase 10 [Camelina sativa]
Length=442

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            EE +  S   SS  D+L+N   + +E AV +PE +A+MVD +++N+TERR+LG+FSCATG
Sbjct  34   EELKSHSSSNSSTVDKLSNDDGAWNEHAVKNPEEVAAMVDMTIKNSTERRRLGFFSCATG  93

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD NW   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  94   NPIDDCWRCDRNWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  138



>ref|XP_010264036.1| PREDICTED: probable pectate lyase 8 [Nelumbo nucifera]
Length=440

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 92/140 (66%), Gaps = 6/140 (4%)
 Frame = +1

Query  154  AASSSYWRLVFHWsllaalaflflnasaMSQQRAEETE-LWSLEKSSMADRLNNSYESQH  330
            A S  ++ L F   LL       +    +S  R E T+ L S + SS ADRL      Q 
Sbjct  2    AVSPRWFSLCFVLLLLLVGVMAGVAKEQVSDSRIEGTQQLQSSKNSSKADRL-----EQA  56

Query  331  EDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAI  510
            E AVD+PE +A+MVD S+RN+T RR LG+ SC TGNPIDDCWRCD  W   RKRLADC I
Sbjct  57   EHAVDNPEEVAAMVDMSIRNSTARRNLGFLSCGTGNPIDDCWRCDPMWHLRRKRLADCGI  116

Query  511  GFGRNAIGGRDGKYYVVTDP  570
            GFGRNAIGGRDG++YVVTDP
Sbjct  117  GFGRNAIGGRDGRFYVVTDP  136



>ref|XP_006297684.1| hypothetical protein CARUB_v10013715mg [Capsella rubella]
 gb|EOA30582.1| hypothetical protein CARUB_v10013715mg [Capsella rubella]
Length=442

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  256  EETELWSLEK-SSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
            EE    SL   SS  D+L N   + +E AV +P+ +A+MVD +++N+TERR+LG+FSCAT
Sbjct  33   EELNSHSLSNTSSTVDKLPNDDGAWNEHAVKNPDEVAAMVDMTIKNSTERRRLGFFSCAT  92

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            GNPIDDCWRCD NW   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  93   GNPIDDCWRCDRNWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  138



>ref|XP_010450305.1| PREDICTED: putative pectate lyase 14 [Camelina sativa]
Length=437

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSC  426
            Q   E++  S   +S AD L++     H+ AV DP+ IA+MVD S+RN+T RRKLG+FSC
Sbjct  28   QETRESKHDSSRNTSTADNLSDG--EWHDHAVKDPDEIAAMVDMSIRNSTYRRKLGFFSC  85

Query  427  ATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +TGNPIDDCWRCD  W R RKRLA CAIGFGRNA+GGRDG+YY+VTDP
Sbjct  86   STGNPIDDCWRCDKKWHRQRKRLAGCAIGFGRNAVGGRDGRYYIVTDP  133



>gb|KFK31278.1| hypothetical protein AALP_AA6G091900 [Arabis alpina]
Length=417

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E++HE AV++PE +A+MVD S+RN+TERRKLGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  28   SNETRHEHAVENPEEVAAMVDMSIRNSTERRKLGYFSCSTGNPIDDCWRCDRKWQLRRKH  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA+C IGFGRNAIGGRDG+YYVV+DP
Sbjct  88   LANCGIGFGRNAIGGRDGRYYVVSDP  113



>ref|XP_011009338.1| PREDICTED: probable pectate lyase 8 [Populus euphratica]
Length=442

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 84/105 (80%), Gaps = 3/105 (3%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E  EL S + SSMA+R ++++    E  V+D E +A+MVD S+RN+TERRKLG+FSC TG
Sbjct  37   ETQELLSSKNSSMAERSDDAWN---EHTVEDSEEVAAMVDESIRNSTERRKLGFFSCVTG  93

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD +W  +RKRLA C IGFGRNA+GGRDGKYYVV++P
Sbjct  94   NPIDDCWRCDPHWQLHRKRLAKCGIGFGRNAVGGRDGKYYVVSNP  138



>ref|XP_010513666.1| PREDICTED: probable pectate lyase 10 [Camelina sativa]
Length=442

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            EE +  S   SS  D+L+N   + +E AV +PE +A+MVD +++N+TERR+LG+FSCATG
Sbjct  34   EELKSHSSSNSSTVDKLSNDDGAWNEHAVKNPEEVAAMVDMTIKNSTERRRLGFFSCATG  93

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD NW   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  94   NPIDDCWRCDRNWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  138



>ref|XP_002885665.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61924.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=440

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  253  AEETEL--WSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSC  426
            A+ETEL   S   SS A+ L N   + +E AV +PE +A+MVD +++N+TERR+LG+FSC
Sbjct  29   AQETELKSHSSSNSSTANTLPNDDGAWNEHAVKNPEEVAAMVDMTIKNSTERRRLGFFSC  88

Query  427  ATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            ATGNPIDDCWRCD NW   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  89   ATGNPIDDCWRCDQNWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  136



>ref|XP_008358000.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan glycosyltransferase 
9 [Malus domestica]
Length=818

 Score =   149 bits (375),  Expect = 9e-38, Method: Composition-based stats.
 Identities = 68/102 (67%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +1

Query  265  ELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPI  444
            EL S   SSMA  +    E  ++ AV+D E IASMVD S+RN+TE+RKLGYFSC  GNPI
Sbjct  41   ELQSSSNSSMAAIVAEDDEGFNKHAVEDLEEIASMVDMSIRNSTEKRKLGYFSCGPGNPI  100

Query  445  DDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DDCWRCD NW +N KRLADC I FGRNAI GRDG +YVVTDP
Sbjct  101  DDCWRCDPNWHKNXKRLADCGIRFGRNAISGRDGYFYVVTDP  142



>ref|XP_010547043.1| PREDICTED: probable pectate lyase 8 [Tarenaya hassleriana]
Length=416

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 2/101 (2%)
 Frame = +1

Query  274  SLEKSSMADRLNNSY--ESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPID  447
            +L  + +  R+N+S   E+ HE AV+ PE +A+MVD S+RN+TERR+LGYFSC TGNPID
Sbjct  12   ALLLTMLFIRVNSSRSNETWHEHAVEHPEEVAAMVDMSIRNSTERRRLGYFSCTTGNPID  71

Query  448  DCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DCWRCD  W   RKRLADCAIGFGRNA+GGRDG+YYVV+DP
Sbjct  72   DCWRCDRKWQLRRKRLADCAIGFGRNALGGRDGRYYVVSDP  112



>ref|XP_011002172.1| PREDICTED: probable pectate lyase 8 [Populus euphratica]
Length=450

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = +1

Query  250  RAEETE-LWSLEKSSMADRLNNSYESQHEDAV-DDPEAIASMVDRSVRNATERRKLGYFS  423
            R+ ETE + S   ++MA R     ++ +E AV ++PE + SMV+ S+RN+TERR+LGYFS
Sbjct  38   RSVETEKVKSSSNTTMAARSQEEADALNEKAVAENPEEVVSMVEMSIRNSTERRRLGYFS  97

Query  424  CATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            C TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  98   CGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTD  145



>gb|KHG26906.1| hypothetical protein F383_09796 [Gossypium arboreum]
Length=446

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            ++ +  EE +L  L+ SSM + L +  +  +E +VD+PE IASMV  S+RN+T+RRKLGY
Sbjct  33   LNSRLTEENKLQGLKNSSMEEGLEDE-QWINEHSVDNPEEIASMVHMSIRNSTKRRKLGY  91

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            FSC TGNP+DDCWRCD +W   RK LA+C IGFGRNAIGGRDG+YYVVTDP
Sbjct  92   FSCGTGNPVDDCWRCDRHWYLRRKNLANCGIGFGRNAIGGRDGRYYVVTDP  142



>ref|XP_002521130.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF41281.1| Pectate lyase precursor, putative [Ricinus communis]
Length=441

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            ++ +  E+T   S + S+MAD    S  + +E AV+DPE IASMVD S+RN+T RR LG+
Sbjct  30   LNSRLGEKTHFQSSDNSTMAD---GSGGAWNEHAVEDPEDIASMVDESIRNSTARRNLGF  86

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            FSC TGNPIDDCWRCD +W  +RKRLA+C IGFGRNA+GGRDG+YYVVTD
Sbjct  87   FSCVTGNPIDDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDGRYYVVTD  136



>dbj|BAB01216.1| pectate lyase [Arabidopsis thaliana]
Length=449

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSC  426
            Q  E+    S   SS A++L N   + +E AV +PE +A+MVD  ++N+TERR+LG+FSC
Sbjct  29   QETEDLNSHSSSNSSTANKLPNDDGAWNEHAVKNPEEVAAMVDMKIKNSTERRRLGFFSC  88

Query  427  ATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            ATGNPIDDCWRCD NW   RKRLA+CAIGFGRNAIGGRDG+YYVVTDP
Sbjct  89   ATGNPIDDCWRCDRNWHLRRKRLANCAIGFGRNAIGGRDGRYYVVTDP  136



>ref|XP_002301766.2| hypothetical protein POPTR_0002s23990g [Populus trichocarpa]
 gb|EEE81039.2| hypothetical protein POPTR_0002s23990g [Populus trichocarpa]
Length=442

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E  EL S + SSMAD  ++++    E  ++DPE +A+MVD S+RN+TERRKLG+FSC TG
Sbjct  37   ETQELLSSKNSSMADWYDDAWN---EHTMEDPEEVAAMVDESIRNSTERRKLGFFSCVTG  93

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD +W  +RKRLA+C IGFGRNA+GGRDG++YVV++P
Sbjct  94   NPIDDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDGRFYVVSNP  138



>ref|NP_189110.1| probable pectate lyase 10 [Arabidopsis thaliana]
 sp|Q9LJ42.2|PLY10_ARATH RecName: Full=Probable pectate lyase 10; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76935.1| probable pectate lyase 10 [Arabidopsis thaliana]
Length=440

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSC  426
            Q  E+    S   SS A++L N   + +E AV +PE +A+MVD  ++N+TERR+LG+FSC
Sbjct  29   QETEDLNSHSSSNSSTANKLPNDDGAWNEHAVKNPEEVAAMVDMKIKNSTERRRLGFFSC  88

Query  427  ATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            ATGNPIDDCWRCD NW   RKRLA+CAIGFGRNAIGGRDG+YYVVTDP
Sbjct  89   ATGNPIDDCWRCDRNWHLRRKRLANCAIGFGRNAIGGRDGRYYVVTDP  136



>ref|XP_010435302.1| PREDICTED: putative pectate lyase 14 isoform X2 [Camelina sativa]
Length=416

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  328  HEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCA  507
            HE AV DP+ IA+MVD S+RN+T RRKLG+FSC+TGNPIDDCWRCD  W R RKRLA CA
Sbjct  32   HEHAVKDPDEIAAMVDMSIRNSTYRRKLGFFSCSTGNPIDDCWRCDKKWHRQRKRLAGCA  91

Query  508  IGFGRNAIGGRDGKYYVVTDP  570
            IGFGRNA+GGRDG+YY+VTDP
Sbjct  92   IGFGRNAVGGRDGRYYIVTDP  112



>gb|KFK39788.1| hypothetical protein AALP_AA3G287800 [Arabis alpina]
Length=437

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 3/109 (3%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMAD-RLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFS  423
             + EE +  S   SS AD +L++   ++H  AV +PE +A++VD S+RN+TERR+LG+FS
Sbjct  27   HQTEELKSHSSRNSSTADNKLSDGAWNEH--AVKNPEEVAALVDMSIRNSTERRQLGFFS  84

Query  424  CATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            CATGNPIDDCWRCD NW   RKRLA+CAIGFGRNA+GGRDG+YYVVTDP
Sbjct  85   CATGNPIDDCWRCDRNWHLRRKRLANCAIGFGRNAVGGRDGRYYVVTDP  133



>ref|NP_001190715.1| putative pectate lyase 14 [Arabidopsis thaliana]
 sp|Q9SVQ6.2|PLY14_ARATH RecName: Full=Putative pectate lyase 14; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE83246.1| putative pectate lyase 14 [Arabidopsis thaliana]
Length=438

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 3/109 (3%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFS-  423
            Q   E +  S   +S  D L++     HE AV DPE IA+MVD S+RN+T RRKLG+FS 
Sbjct  28   QETREPKHESSRNTSTVDNLSDG--EWHEHAVKDPEEIAAMVDMSIRNSTYRRKLGFFSS  85

Query  424  CATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            C+TGNPIDDCWRCD  W R RKRLADCAIGFGRNA+GGRDG+YY+VTDP
Sbjct  86   CSTGNPIDDCWRCDKKWHRRRKRLADCAIGFGRNAVGGRDGRYYIVTDP  134



>ref|XP_003552152.2| PREDICTED: probable pectate lyase 20-like [Glycine max]
Length=451

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 3/105 (3%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E+ ++ SL+ SSMA+R   S  + +E AVD+PE IASMVD S+RN T RR L +FSC +G
Sbjct  46   EKLQVQSLKNSSMAER---SGSALNEHAVDNPEEIASMVDESIRNYTARRNLNFFSCGSG  102

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD  W   RKRLA+C IGFGRNAIGGRDG+YYVV+DP
Sbjct  103  NPIDDCWRCDKRWYARRKRLANCGIGFGRNAIGGRDGRYYVVSDP  147



>ref|XP_007201029.1| hypothetical protein PRUPE_ppa006229mg [Prunus persica]
 gb|EMJ02228.1| hypothetical protein PRUPE_ppa006229mg [Prunus persica]
Length=421

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +1

Query  268  LWSLEKSSMADRLNNSY--ESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNP  441
            L +L  S+  ++L NS   E+ +E AVD+P+ IASMVD S+RN+TERR LG+FSCATGNP
Sbjct  17   LQALFVSAENEKLVNSRSDEALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCATGNP  76

Query  442  IDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +DDCWRCD +W  +RKRLA+C IGFGRNA+GGRDGKYYVV +P
Sbjct  77   VDDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDGKYYVVNNP  119



>ref|XP_004152014.1| PREDICTED: probable pectate lyase 8-like [Cucumis sativus]
 gb|KGN58334.1| hypothetical protein Csa_3G624020 [Cucumis sativus]
Length=433

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 5/106 (5%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
            AE+  L S   SSM  R       ++E AVD+PE IASMVD S+RN+TERR LG+FSC T
Sbjct  29   AEDERLHSFNSSSMPYRY-----IENEHAVDNPEEIASMVDLSIRNSTERRNLGFFSCGT  83

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            GNPIDDCWRCD  W   RK LA+C IGFGRNA+GGRDG+YYVV+DP
Sbjct  84   GNPIDDCWRCDPRWQLRRKHLANCGIGFGRNAVGGRDGRYYVVSDP  129



>ref|XP_003530885.1| PREDICTED: probable pectate lyase 20-like [Glycine max]
Length=451

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATG  435
            E+  + SL+ SSMA+R   S  + +E AVD+PE IASMVD S+RN T RR L +FSC TG
Sbjct  46   EKLRVQSLKNSSMAER---SGGALNEHAVDNPEEIASMVDESIRNYTARRNLNFFSCGTG  102

Query  436  NPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            NPIDDCWRCD  W   RKRLA+C IGFGRNAIGGRDG+YYVV+DP
Sbjct  103  NPIDDCWRCDKRWYARRKRLANCGIGFGRNAIGGRDGRYYVVSDP  147



>gb|KHG06252.1| hypothetical protein F383_10745 [Gossypium arboreum]
Length=429

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLGYF  420
             E  +L + + S+MA R +   ++ +E AV DPEA+A    +++D ++RNATERRKLG+F
Sbjct  17   VEIEKLQNSKNSTMATR-SEEVKALNEHAVADPEAVAAEVETIIDMNIRNATERRKLGFF  75

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            SC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  76   SCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTD  124



>gb|KHG30349.1| hypothetical protein F383_15991 [Gossypium arboreum]
Length=487

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLGYF  420
             E  +L + + S+MA R +   ++ +E AV DPEA+A    +++D ++RNATERRKLG+F
Sbjct  75   VEIEKLQNSKNSTMATR-SEEVKALNEHAVADPEAVAAEVETIIDMNIRNATERRKLGFF  133

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            SC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  134  SCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTD  182



>ref|XP_008447332.1| PREDICTED: probable pectate lyase 8 [Cucumis melo]
Length=432

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 5/106 (5%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
            AE+  L S   SSM  R       ++E AVD+PE IASMVD S+RN+TERR LG+FSC T
Sbjct  28   AEDERLQSFNSSSMPYRY-----IKNEHAVDNPEEIASMVDSSIRNSTERRNLGFFSCGT  82

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            GNPIDDCWRCD  W   RK LA+C IGFGRNA+GGRDG+YYVV+DP
Sbjct  83   GNPIDDCWRCDPRWQLRRKHLANCGIGFGRNAVGGRDGRYYVVSDP  128



>emb|CAB41931.1| pectate lyase like protein [Arabidopsis thaliana]
 emb|CAB78363.1| pectate lyase like protein [Arabidopsis thaliana]
Length=418

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +1

Query  328  HEDAVDDPEAIASMVDRSVRNATERRKLGYFS-CATGNPIDDCWRCDTNWARNRKRLADC  504
            HE AV DPE IA+MVD S+RN+T RRKLG+FS C+TGNPIDDCWRCD  W R RKRLADC
Sbjct  33   HEHAVKDPEEIAAMVDMSIRNSTYRRKLGFFSSCSTGNPIDDCWRCDKKWHRRRKRLADC  92

Query  505  AIGFGRNAIGGRDGKYYVVTDP  570
            AIGFGRNA+GGRDG+YY+VTDP
Sbjct  93   AIGFGRNAVGGRDGRYYIVTDP  114



>ref|NP_193057.4| putative pectate lyase 14 [Arabidopsis thaliana]
 gb|AEE83245.1| putative pectate lyase 14 [Arabidopsis thaliana]
Length=401

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +1

Query  328  HEDAVDDPEAIASMVDRSVRNATERRKLGYFS-CATGNPIDDCWRCDTNWARNRKRLADC  504
            HE AV DPE IA+MVD S+RN+T RRKLG+FS C+TGNPIDDCWRCD  W R RKRLADC
Sbjct  16   HEHAVKDPEEIAAMVDMSIRNSTYRRKLGFFSSCSTGNPIDDCWRCDKKWHRRRKRLADC  75

Query  505  AIGFGRNAIGGRDGKYYVVTDP  570
            AIGFGRNA+GGRDG+YY+VTDP
Sbjct  76   AIGFGRNAVGGRDGRYYIVTDP  97



>emb|CDY56668.1| BnaCnng30870D [Brassica napus]
Length=418

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AVD+P+ +A+MVD S RN+TERR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  29   SNETWHEHAVDNPDEVAAMVDMSTRNSTERRRLGYFSCSTGNPIDDCWRCDRKWKLRRKH  88

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG+YYVV+DP
Sbjct  89   LADCSIGFGRNAIGGRDGRYYVVSDP  114



>ref|XP_009111860.1| PREDICTED: probable pectate lyase 20 [Brassica rapa]
Length=418

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD S+RN+TERR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  29   SNETWHEHAVENPDEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWKLRRKH  88

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG+YYVV+DP
Sbjct  89   LADCSIGFGRNAIGGRDGRYYVVSDP  114



>emb|CDY19932.1| BnaA09g03190D [Brassica napus]
Length=418

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD S+RN+TERR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  29   SNETWHEHAVENPDEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWKLRRKH  88

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGFGRNAIGGRDG+YYVV+DP
Sbjct  89   LADCSIGFGRNAIGGRDGRYYVVSDP  114



>gb|KJB72155.1| hypothetical protein B456_011G161900 [Gossypium raimondii]
Length=447

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 5/110 (5%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLGYF  420
             E  +L + +  +MA R +   +  +E AV DPEA+A    +++D ++RN TERRKLG+F
Sbjct  35   VEIEKLQNSKNPTMATR-SEEVKVLNEHAVADPEAVAAEVETIIDMNIRNVTERRKLGFF  93

Query  421  SCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            SC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  94   SCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  143



>ref|XP_010558823.1| PREDICTED: probable pectate lyase 8 [Tarenaya hassleriana]
Length=418

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HEDAV+ P  +A+ VD S+RN+TERRKLGYFSC+TGNPIDDCWRCD  W   RKR
Sbjct  29   SNETWHEDAVEHPHEVAATVDMSIRNSTERRKLGYFSCSTGNPIDDCWRCDRKWHLRRKR  88

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA+C+IGFGRNAIGGRDG+YYVV+DP
Sbjct  89   LAECSIGFGRNAIGGRDGRYYVVSDP  114



>gb|AAM61584.1| putative pectate lyase [Arabidopsis thaliana]
Length=416

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD S+RN+TERR+LGYFSCATGNPIDDCWRCD  W   RKR
Sbjct  27   SNETWHEHAVENPDEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKR  86

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LADC+IGF RNAIGGRDG++YVVTDP
Sbjct  87   LADCSIGFCRNAIGGRDGRFYVVTDP  112



>gb|ACB12931.1| pectate lyase 1-27 [Populus tremula x Populus tremuloides]
Length=452

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +1

Query  274  SLEKSSMADRLNNSYESQHEDAVD-DPEAIASMVDRSVRNATERRKLGYFSCATGNPIDD  450
            S   S+MA R     ++ +E AV  DPE + SMV+ ++RN+TERR+LGYFSC TGNPIDD
Sbjct  49   SSSNSTMAARSQEEADALNEKAVAADPEEVVSMVEMNIRNSTERRRLGYFSCGTGNPIDD  108

Query  451  CWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            CWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  109  CWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTD  147



>gb|AFZ78654.1| pectate lyase [Populus tomentosa]
Length=452

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +1

Query  274  SLEKSSMADRLNNSYESQHEDAVD-DPEAIASMVDRSVRNATERRKLGYFSCATGNPIDD  450
            S   S+MA R     ++ +E AV  DPE + SMV+ ++RN+TERR+LGYFSC TGNPIDD
Sbjct  49   SSSNSTMAARSQEEADAFNEKAVAADPEEVVSMVEMNIRNSTERRRLGYFSCGTGNPIDD  108

Query  451  CWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            CWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  109  CWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTD  147



>ref|XP_002304700.1| pectate lyase family protein [Populus trichocarpa]
 gb|ABK95980.1| unknown [Populus trichocarpa]
 gb|EEE79679.1| pectate lyase family protein [Populus trichocarpa]
Length=452

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +1

Query  274  SLEKSSMADRLNNSYESQHEDAVD-DPEAIASMVDRSVRNATERRKLGYFSCATGNPIDD  450
            S   S+MA R     ++ +E AV  DPE + SMV+ ++RN+TERR+LGYFSC TGNPIDD
Sbjct  49   SSSNSTMAARSQEEADAFNEKAVAADPEEVVSMVEMNIRNSTERRRLGYFSCGTGNPIDD  108

Query  451  CWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            CWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  109  CWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTD  147



>ref|XP_010935686.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=425

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  331  EDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAI  510
            E AVDDPE +ASMV  S+RN+T RR LGY SC TGNPIDDCWRCD +W  NRKRLADC I
Sbjct  42   EGAVDDPEMVASMVQMSIRNSTARRALGYLSCGTGNPIDDCWRCDPDWHHNRKRLADCGI  101

Query  511  GFGRNAIGGRDGKYYVVTDP  570
            GFGRNAIGGRDG++YVVTDP
Sbjct  102  GFGRNAIGGRDGRFYVVTDP  121



>gb|EYU43815.1| hypothetical protein MIMGU_mgv1a006554mg [Erythranthe guttata]
Length=439

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  334  DAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIG  513
            + +DDPE +  MV+ + RN+TERRKLG+FSC TGNPIDDCWRCD NW +NRKRLADC IG
Sbjct  55   EGIDDPEEVVRMVEMATRNSTERRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  114

Query  514  FGRNAIGGRDGKYYVVTDP  570
            FGRNAIGGRDG++Y+VTDP
Sbjct  115  FGRNAIGGRDGRFYIVTDP  133



>ref|XP_010935685.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=453

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 74/96 (77%), Gaps = 3/96 (3%)
 Frame = +1

Query  283  KSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRC  462
             SSM +R   +     E AVDDPE +ASMV  S+RN+T RR LGY SC TGNPIDDCWRC
Sbjct  57   SSSMPER---AAPKAVEGAVDDPEMVASMVQMSIRNSTARRALGYLSCGTGNPIDDCWRC  113

Query  463  DTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            D +W  NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  114  DPDWHHNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  149



>gb|AAX88800.1| ripening-related pectate lyase [Mangifera indica]
Length=437

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = +1

Query  268  LWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPID  447
            L + + +S+AD  ++S+ SQH  AVD+PE +A+MVD S+RN+TERR+LGYFSC TGNPID
Sbjct  36   LLNSKNTSIADSSDDSW-SQH--AVDNPEEVAAMVDISIRNSTERRRLGYFSCETGNPID  92

Query  448  DCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            DCWRCD  W  +RK LADCAIGFGRNAIGGRDGK+YVV+D
Sbjct  93   DCWRCDPKWHLHRKHLADCAIGFGRNAIGGRDGKFYVVSD  132



>gb|EYU32621.1| hypothetical protein MIMGU_mgv1a006198mg [Erythranthe guttata]
Length=453

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 2/106 (2%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYES-QHEDAVDDPEAIASMVDRSVRNATERRK-LGYFSCA  429
            E+ EL +   S+MA++L    E   +E AVDDPE +  MV+ + RN+T+RR+ LGYFSC 
Sbjct  43   EKEELQNSPNSTMAEKLEGIEEDVLNEHAVDDPEEVVRMVEMATRNSTDRRRRLGYFSCG  102

Query  430  TGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  103  TGNPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTD  148



>ref|XP_010439830.1| PREDICTED: probable pectate lyase 20 [Camelina sativa]
Length=417

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD S+RN+T RR+LGYFSC+TGNPIDDCWRCD  W   RKR
Sbjct  28   SNETWHEHAVENPDEVAAMVDMSIRNSTARRRLGYFSCSTGNPIDDCWRCDRKWQFRRKR  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA+CAIGFGRNAIGGRDG+YYVV+DP
Sbjct  88   LANCAIGFGRNAIGGRDGRYYVVSDP  113



>dbj|BAB10313.1| pectate lyase [Arabidopsis thaliana]
Length=393

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++PE +A+MVD S+RN+T RR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  5    SNETWHEHAVENPEEVAAMVDMSIRNSTARRRLGYFSCSTGNPIDDCWRCDRRWQSRRKH  64

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA+CAIGFGRNAIGGRDG+YYVV+DP
Sbjct  65   LANCAIGFGRNAIGGRDGRYYVVSDP  90



>ref|NP_568705.1| putative pectate lyase 20 [Arabidopsis thaliana]
 sp|Q93WF1.1|PLY20_ARATH RecName: Full=Probable pectate lyase 20; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK91420.1| AT5g48900/K19E20_1 [Arabidopsis thaliana]
 gb|AAK92730.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AED95740.1| putative pectate lyase 20 [Arabidopsis thaliana]
Length=417

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++PE +A+MVD S+RN+T RR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  28   SNETWHEHAVENPEEVAAMVDMSIRNSTARRRLGYFSCSTGNPIDDCWRCDRRWQSRRKH  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA+CAIGFGRNAIGGRDG+YYVV+DP
Sbjct  88   LANCAIGFGRNAIGGRDGRYYVVSDP  113



>gb|AAM63307.1| pectate lyase [Arabidopsis thaliana]
Length=417

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++PE +A+MVD S+RN+T RR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  28   SNETWHEHAVENPEEVAAMVDMSIRNSTARRRLGYFSCSTGNPIDDCWRCDRRWQSRRKH  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA+CAIGFGRNAIGGRDG+YYVV+DP
Sbjct  88   LANCAIGFGRNAIGGRDGRYYVVSDP  113



>ref|XP_002863927.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40186.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=411

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  319  ESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            +S  E AV++PE +A+MVD S+RN+TERRKLGYFSC+TGNPIDDCWRCD  W   RK LA
Sbjct  24   DSTSEQAVENPEEVAAMVDMSIRNSTERRKLGYFSCSTGNPIDDCWRCDRRWQSRRKALA  83

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            +CAIGFGRNAIGGRDG+YYVV+DP
Sbjct  84   NCAIGFGRNAIGGRDGRYYVVSDP  107



>ref|XP_011020694.1| PREDICTED: probable pectate lyase 8 [Populus euphratica]
Length=452

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +1

Query  274  SLEKSSMADRLNNSYESQHEDAVD-DPEAIASMVDRSVRNATERRKLGYFSCATGNPIDD  450
            S   S+MA R     ++ +E AV  DP+ + SMV+ ++RN+TERR+LGYFSC TGNPIDD
Sbjct  49   SSSNSTMAARSQEEADAFNEKAVAADPDEVVSMVEMNIRNSTERRRLGYFSCGTGNPIDD  108

Query  451  CWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            CWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTD
Sbjct  109  CWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTD  147



>gb|ADP09680.1| pectate lyase [Rosa x borboniana]
Length=448

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 3/99 (3%)
 Frame = +1

Query  274  SLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDC  453
            S+  S   +R N+ +    E AVD+PE IAS+VD ++RN+T RR LG+FSCATGNPIDDC
Sbjct  50   SINSSMSTERSNDDWN---EHAVDNPEEIASLVDTTIRNSTARRNLGFFSCATGNPIDDC  106

Query  454  WRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            WRCD  W R+RKRLA+C IGFGRNA+GGRDG+YYVV DP
Sbjct  107  WRCDPQWQRHRKRLANCGIGFGRNAVGGRDGRYYVVNDP  145



>ref|XP_010442341.1| PREDICTED: probable pectate lyase 20 [Camelina sativa]
 ref|XP_010482158.1| PREDICTED: probable pectate lyase 20 isoform X1 [Camelina sativa]
 ref|XP_010482159.1| PREDICTED: probable pectate lyase 20 isoform X2 [Camelina sativa]
Length=417

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD S++N+T RR+LGYFSC+TGNPIDDCWRCD  W   RKR
Sbjct  28   SNETWHEHAVENPDEVAAMVDMSIKNSTARRRLGYFSCSTGNPIDDCWRCDRKWQFRRKR  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA+CAIGFGRNAIGGRDG+YYVV+DP
Sbjct  88   LANCAIGFGRNAIGGRDGRYYVVSDP  113



>ref|XP_006854398.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
 gb|ERN15865.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
Length=457

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +1

Query  256  EETELWSLEKSSMADRLNNSYE-SQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCAT  432
            E T + S+ ++  AD+L +  E S     V+DPE +ASMV+ S+ NAT+RR+LG+FSC T
Sbjct  48   EGTGVRSVAQNRSADQLVDERERSVGPLQVEDPEMVASMVEMSIHNATQRRRLGFFSCGT  107

Query  433  GNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            GNPIDDCWRCD  WAR RKRLADC IGFGRNA+GGRDG+YYVVTD
Sbjct  108  GNPIDDCWRCDPLWARRRKRLADCGIGFGRNAVGGRDGRYYVVTD  152



>ref|XP_010109687.1| hypothetical protein L484_015172 [Morus notabilis]
 gb|EXC24157.1| hypothetical protein L484_015172 [Morus notabilis]
Length=444

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            +  +  E  EL S + SSMA+R   S + Q+E AV +P+ IA+MVD ++RN TERR LGY
Sbjct  33   VQSRSVEPKELQSSKNSSMANR---SDDIQNEHAVGNPDEIAAMVDMNIRNHTERRNLGY  89

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            F+C TGNPIDDCWRCD  W   RK LA+C IGFGRNA+GGRDG+YYVV++P
Sbjct  90   FTCGTGNPIDDCWRCDRRWHLRRKHLANCGIGFGRNAVGGRDGRYYVVSNP  140



>ref|XP_010522431.1| PREDICTED: probable pectate lyase 1 [Tarenaya hassleriana]
Length=420

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            E AV DP+ +A    S+VD S+RN TERRKLGYFSC TGNPIDDCWRCD NW +NRKRLA
Sbjct  41   EHAVADPDKVADEVASLVDMSMRNHTERRKLGYFSCGTGNPIDDCWRCDANWHKNRKRLA  100

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  101  DCGIGFGRNAIGGRDGRFYVVTDP  124



>ref|XP_010532807.1| PREDICTED: probable pectate lyase 15 [Tarenaya hassleriana]
Length=452

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 84/112 (75%), Gaps = 6/112 (5%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLG  414
            ++ +  EL +   S+MADRL     ++H  AV DP+ +A    ++V+ S +N T RRKLG
Sbjct  39   RKLKTEELQNSNSSTMADRLEGIELNEH--AVADPDKVADEVAALVEISEQNNTARRKLG  96

Query  415  YFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            YFSC TGNPIDDCWRCDT W +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  97   YFSCGTGNPIDDCWRCDTKWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  148



>ref|XP_010556943.1| PREDICTED: probable pectate lyase 1 [Tarenaya hassleriana]
Length=428

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            E AV DP+ +A    S+V+ S+RN TERRKLGYFSC TGNPIDDCWRCD+NW +NRKRLA
Sbjct  39   EHAVADPDKVADHVASLVEMSMRNHTERRKLGYFSCGTGNPIDDCWRCDSNWHKNRKRLA  98

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  99   DCGIGFGRNAIGGRDGRFYVVTDP  122



>gb|KFK39766.1| hypothetical protein AALP_AA3G285000 [Arabis alpina]
Length=413

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +1

Query  253  AEETELWSLEKSSMADRLNNSYESQ-HEDAVDDPEAIASMVDRSVRNATERR-KLGYFSC  426
             +ET +   E S      NN  + + HE AV DPE IASMVD S++N+TERR KLG+FS 
Sbjct  27   VQETVILRNESSRNTSIANNLSDDEWHEHAVKDPEEIASMVDMSIQNSTERRRKLGFFSY  86

Query  427  ATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            ATGNPIDDCWRCD  W R RK LA+CAIGFGRNAIGGRDG +Y+VTDP
Sbjct  87   ATGNPIDDCWRCDKKWHRRRKHLANCAIGFGRNAIGGRDGHFYIVTDP  134



>ref|NP_567409.1| probable pectate lyase 15 [Arabidopsis thaliana]
 sp|Q944R1.1|PLY15_ARATH RecName: Full=Probable pectate lyase 15; AltName: Full=Pectate 
lyase A11; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL11586.1|AF424592_1 AT4g13710/F18A5_100 [Arabidopsis thaliana]
 gb|AAM98277.1| At4g13710/F18A5_100 [Arabidopsis thaliana]
 gb|AEE83315.1| probable pectate lyase 15 [Arabidopsis thaliana]
Length=470

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMA-DRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKL  411
            ++ +  E  SL  S+MA  RL+   + Q     DDP+ +A     +V  S +N T RRKL
Sbjct  54   RKLKTEEFQSLNSSTMAATRLDGEPQQQQHAVADDPDMVADEVAKLVQMSEQNRTARRKL  113

Query  412  GYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            G+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++Y+VTDP
Sbjct  114  GFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGIGFGRNAIGGRDGRFYIVTDP  166



>ref|XP_002863264.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39523.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = +1

Query  328  HEDAVDDPEAIASMVDRSVRNATERRKLGYFS-CATGNPIDDCWRCDTNWARNRKRLADC  504
            HE AV DPE IA++VD S+RN+T RRKLG+FS C TGNPIDDCWRCD  W R RKRLA C
Sbjct  33   HEHAVKDPEEIAALVDMSIRNSTYRRKLGFFSSCETGNPIDDCWRCDKKWHRRRKRLAGC  92

Query  505  AIGFGRNAIGGRDGKYYVVTDP  570
            AIGFGRNA+GGRDG+YY+VTDP
Sbjct  93   AIGFGRNAVGGRDGRYYIVTDP  114



>ref|XP_009129753.1| PREDICTED: probable pectate lyase 20 [Brassica rapa]
Length=417

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD S+RN+T RR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  28   SNETWHEHAVENPDEVAAMVDMSIRNSTMRRRLGYFSCSTGNPIDDCWRCDRKWQLRRKH  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA CAIGFGRNAIGGRDG+YYVV+DP
Sbjct  88   LAVCAIGFGRNAIGGRDGRYYVVSDP  113



>ref|XP_010940647.1| PREDICTED: probable pectate lyase 8 [Elaeis guineensis]
Length=448

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE +ASMV  S+RN+T RR LGY SC TGNPIDDCWRCD +W  NRKRLADC IGF
Sbjct  67   AVDDPEVVASMVQMSIRNSTARRALGYLSCGTGNPIDDCWRCDPDWHLNRKRLADCGIGF  126

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNA+GGRDG++YVVTDP
Sbjct  127  GRNAVGGRDGRFYVVTDP  144



>ref|NP_001190720.1| probable pectate lyase 15 [Arabidopsis thaliana]
 gb|AEE83316.1| probable pectate lyase 15 [Arabidopsis thaliana]
Length=451

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMA-DRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKL  411
            ++ +  E  SL  S+MA  RL+   + Q     DDP+ +A     +V  S +N T RRKL
Sbjct  35   RKLKTEEFQSLNSSTMAATRLDGEPQQQQHAVADDPDMVADEVAKLVQMSEQNRTARRKL  94

Query  412  GYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            G+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++Y+VTDP
Sbjct  95   GFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGIGFGRNAIGGRDGRFYIVTDP  147



>gb|KCW57296.1| hypothetical protein EUGRSUZ_H00093 [Eucalyptus grandis]
Length=447

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 72/92 (78%), Gaps = 10/92 (11%)
 Frame = +1

Query  295  ADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNW  474
            ADRLN       + AVDDPE +ASMVD    N+TERR LG+FSC TGNPIDDCWRCD NW
Sbjct  62   ADRLN-------DQAVDDPEKVASMVDM---NSTERRNLGFFSCGTGNPIDDCWRCDPNW  111

Query  475  ARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
              NRKRLADC IGFGRNAIGGRDG+ YVVTDP
Sbjct  112  HLNRKRLADCGIGFGRNAIGGRDGRIYVVTDP  143



>emb|CDY33938.1| BnaA02g30490D [Brassica napus]
Length=417

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD S+RN+T RR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  28   SNETWHEHAVENPDEVAAMVDMSIRNSTMRRRLGYFSCSTGNPIDDCWRCDRKWQLRRKH  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA C+IGFGRNAIGGRDG+YYVV+DP
Sbjct  88   LAVCSIGFGRNAIGGRDGRYYVVSDP  113



>ref|XP_002870357.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46616.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMA-DRLNNSYESQHEDAVDD---PEAIASMVDRSVRNATERRKLG  414
            ++ +  E  SL  S+MA  RL+   + QH  A D     + +A +V  S +N T RRKLG
Sbjct  69   RKLKTEEFQSLNSSTMAATRLDGEPQQQHAVAADPDMVADEVAKLVQMSEQNRTARRKLG  128

Query  415  YFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  129  FFSCGTGNPIDDCWRCDRNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  180



>gb|EEE60442.1| hypothetical protein OsJ_13660 [Oryza sativa Japonica Group]
Length=443

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE + S V  S+RN+T RRKLGY SC TGNPIDDCWRCD +W +NR+RLADC IGF
Sbjct  62   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGF  121

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  122  GRNAIGGRDGKIYVVTDP  139



>emb|CDY05655.1| BnaC02g38820D [Brassica napus]
Length=417

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD ++RN+T RR+LGYFSC+TGNPIDDCWRCD  W   RK 
Sbjct  28   SNETWHEHAVENPDEVAAMVDMTIRNSTVRRRLGYFSCSTGNPIDDCWRCDRKWQLRRKH  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA C+IGFGRNAIGGRDG+YYVV+DP
Sbjct  88   LATCSIGFGRNAIGGRDGRYYVVSDP  113



>emb|CDY01151.1| BnaA04g06680D [Brassica napus]
Length=452

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 83/116 (72%), Gaps = 7/116 (6%)
 Frame = +1

Query  241  SQQRAEETELWSLEKSSM--ADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATER  402
            S ++ +  EL S + +S   A+RL    E   + AVDDP+ +A    ++V  S  N T R
Sbjct  34   SSRKVKTEELQSSKNTSTMAANRLE-GVELNEQHAVDDPDKVADEVSTLVQMSEHNITAR  92

Query  403  RKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            RKLG+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNA+GGRDG++YVVTDP
Sbjct  93   RKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGIGFGRNAVGGRDGRFYVVTDP  148



>emb|CAE02420.2| OSJNBa0095E20.8 [Oryza sativa Japonica Group]
 emb|CAH65848.1| OSIGBa0147B06.7 [Oryza sativa Indica Group]
Length=472

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE + S V  S+RN+T RRKLGY SC TGNPIDDCWRCD +W +NR+RLADC IGF
Sbjct  91   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGF  150

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  151  GRNAIGGRDGKIYVVTDP  168



>ref|XP_010440536.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=462

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLG  414
            ++ +  E  S   S+MA  +    E Q      DPE +A     +V  S +N T RRKLG
Sbjct  47   RKLKTEEFQSSNSSTMAATMLGGEEEQQHAVAADPEKVADEVAKLVQMSEQNRTARRKLG  106

Query  415  YFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  107  FFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  158



>ref|XP_009139602.1| PREDICTED: probable pectate lyase 15 [Brassica rapa]
Length=451

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 83/116 (72%), Gaps = 7/116 (6%)
 Frame = +1

Query  241  SQQRAEETELWSLEKSSM--ADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATER  402
            S ++ +  EL S + +S   A+RL    E   + AVDDP+ +A    ++V  S  N T R
Sbjct  33   SSRKVKTEELQSSKNTSTMAANRLE-GVELNEQHAVDDPDKVADEVSTLVQMSEHNITAR  91

Query  403  RKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            RKLG+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNA+GGRDG++YVVTDP
Sbjct  92   RKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGIGFGRNAVGGRDGRFYVVTDP  147



>ref|XP_010435229.1| PREDICTED: probable pectate lyase 15 [Camelina sativa]
Length=461

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 6/113 (5%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMA-DRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKL  411
            ++ +  EL S   SS+A  RL    + QH  AVD PE +A     +V  S +N T RRKL
Sbjct  46   RKLKTEELQSSNSSSVAATRLRGEEDQQHAVAVD-PEKVADEVAKLVQMSEQNRTARRKL  104

Query  412  GYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            G+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  105  GFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  157



>ref|NP_001052103.1| Os04g0137100 [Oryza sativa Japonica Group]
 dbj|BAF14017.1| Os04g0137100 [Oryza sativa Japonica Group]
Length=492

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE + S V  S+RN+T RRKLGY SC TGNPIDDCWRCD +W +NR+RLADC IGF
Sbjct  92   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGF  151

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  152  GRNAIGGRDGKIYVVTDP  169



>gb|EEC76710.1| hypothetical protein OsI_14719 [Oryza sativa Indica Group]
Length=473

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE + S V  S+RN+T RRKLGY SC TGNPIDDCWRCD +W +NR+RLADC IGF
Sbjct  92   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGF  151

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  152  GRNAIGGRDGKIYVVTDP  169



>ref|XP_009107745.1| PREDICTED: probable pectate lyase 15 [Brassica rapa]
Length=451

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 81/115 (70%), Gaps = 5/115 (4%)
 Frame = +1

Query  241  SQQRAEETELWSLEK-SSMADRLNNSYESQHEDAVDDPE----AIASMVDRSVRNATERR  405
            S ++ +  EL S +  S+MA +     E   + AV DP+     +AS+V  S  N T RR
Sbjct  33   SSRKLKTEELRSAKNNSTMAAKRVKGVELNEQHAVSDPDRVADEVASLVQMSEHNKTARR  92

Query  406  KLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            KLG+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++Y+VTDP
Sbjct  93   KLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYIVTDP  147



>ref|XP_010440534.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=466

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLG  414
            ++ +  E  S   S+MA  +    E Q      DPE +A     +V  S +N T RRKLG
Sbjct  51   RKLKTEEFQSSNSSTMAATMLGGEEEQQHAVAADPEKVADEVAKLVQMSEQNRTARRKLG  110

Query  415  YFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            +FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  111  FFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  162



>ref|XP_004163042.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 8-like 
[Cucumis sativus]
Length=392

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  325  QHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADC  504
            ++E AVD+PE IASMVD S+RN+TERR LG+FSC TGNPIDDCWRCD  W   RK LA+C
Sbjct  7    ENEHAVDNPEEIASMVDLSIRNSTERRNLGFFSCGTGNPIDDCWRCDPRWQLRRKHLANC  66

Query  505  AIGFGRNAIGGRDGKYYVVTDP  570
             IGFGRNA+GG DG+YYVV+DP
Sbjct  67   GIGFGRNAVGGXDGRYYVVSDP  88



>ref|XP_002892236.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68495.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=432

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 83/107 (78%), Gaps = 8/107 (7%)
 Frame = +1

Query  274  SLEKSSMADRLNNSYESQ----HEDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCA  429
            ++EK++  D++++   S     ++ AV +P+ +A    ++ + SVRN TERRKLGYF+C 
Sbjct  20   AMEKNTTHDKISSLPRSDENEWNQHAVTNPDEVAGEVLALTEMSVRNHTERRKLGYFTCG  79

Query  430  TGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  80   TGNPIDDCWRCDRNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  126



>ref|XP_010450167.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=465

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 81/113 (72%), Gaps = 6/113 (5%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMA-DRLNNSYESQHEDAVDDPEA----IASMVDRSVRNATERRKL  411
            ++ +  E+ S   S+MA  R+    + QH  AVD PE     +A +V  S +N T RRKL
Sbjct  50   RKLKTEEVQSSNSSTMAATRVGGEEQQQHAVAVD-PEKGADEVAKLVQMSEQNRTARRKL  108

Query  412  GYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            G+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  109  GFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  161



>ref|XP_010450168.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=461

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 81/113 (72%), Gaps = 6/113 (5%)
 Frame = +1

Query  247  QRAEETELWSLEKSSMA-DRLNNSYESQHEDAVDDPEA----IASMVDRSVRNATERRKL  411
            ++ +  E+ S   S+MA  R+    + QH  AVD PE     +A +V  S +N T RRKL
Sbjct  46   RKLKTEEVQSSNSSTMAATRVGGEEQQQHAVAVD-PEKGADEVAKLVQMSEQNRTARRKL  104

Query  412  GYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            G+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  105  GFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  157



>ref|XP_006653139.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 8-like 
[Oryza brachyantha]
Length=483

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE + S V  S+RN+T RRKLGY SC TGNPIDDCWRCD +W  NR+RLADC IGF
Sbjct  83   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHNNRQRLADCGIGF  142

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  143  GRNAIGGRDGKIYVVTDP  160



>emb|CDY18738.1| BnaC08g08780D [Brassica napus]
Length=476

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 74/103 (72%), Gaps = 4/103 (4%)
 Frame = +1

Query  274  SLEKSSMADRLNNSYESQHEDAVDDPE----AIASMVDRSVRNATERRKLGYFSCATGNP  441
            S   S+MA +     E   + AV DP+     +AS+V  S  N T RRKLG+FSC TGNP
Sbjct  70   SKNNSTMAAKRVKGVELNEQHAVSDPDRVADEVASLVQMSEHNKTARRKLGFFSCGTGNP  129

Query  442  IDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            IDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++Y+VTDP
Sbjct  130  IDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYIVTDP  172



>ref|XP_009411363.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=454

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = +1

Query  283  KSSMADRLNNSYESQHE--------DAVDDPEAIASMVDRSVRNATERRKLGYFSCATGN  438
            KSS A   N S+ +            AVDDPE +AS VD  + N+T RR LGY SC TGN
Sbjct  47   KSSRAKAANESFPAARSTAGREARVGAVDDPELVASEVDMMISNSTSRRALGYLSCGTGN  106

Query  439  PIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            PIDDCWRCD  W R+RKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  107  PIDDCWRCDPEWHRHRKRLADCGIGFGRNAIGGRDGRFYVVTDP  150



>gb|AAL06861.1| At1g04680/T1G11_6 [Arabidopsis thaliana]
 gb|AAL47400.1| At1g04680/T1G11_6 [Arabidopsis thaliana]
Length=354

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            + AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLA
Sbjct  42   QHAVTNPDEVADEVLALTEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDPNWHKNRKRLA  101

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  102  DCGIGFGRNAIGGRDGRFYVVTDP  125



>ref|XP_006280540.1| hypothetical protein CARUB_v10026482mg [Capsella rubella]
 gb|EOA13438.1| hypothetical protein CARUB_v10026482mg [Capsella rubella]
Length=417

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  313  SYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKR  492
            S E+ HE AV++P+ +A+MVD ++RN+T RR+LGYFSC+TGN IDDCWRCD  W   RK 
Sbjct  28   SNETWHEHAVENPDEVAAMVDMNIRNSTARRRLGYFSCSTGNVIDDCWRCDRRWQLRRKH  87

Query  493  LADCAIGFGRNAIGGRDGKYYVVTDP  570
            LA+CAIGFGRNAIGGRDG+YYVV+DP
Sbjct  88   LANCAIGFGRNAIGGRDGRYYVVSDP  113



>emb|CDY53564.1| BnaC04g55760D [Brassica napus]
Length=455

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = +1

Query  241  SQQRAEETELWSLEKSS-MADRLNNSYESQHEDAVDDPEAIAS--------MVDRSVRNA  393
            S ++ +  EL S + SS MA       E   + AVDDP+ +A         ++ RS  N 
Sbjct  33   SSRKLKTEELQSSKNSSTMAANRLEGVELNKQHAVDDPDKVADEVSTLVKVLIFRSEHNI  92

Query  394  TERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            T RRKLG+FSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNA+GGRDG++YVVTDP
Sbjct  93   TARRKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGIGFGRNAVGGRDGRFYVVTDP  151



>ref|XP_002446075.1| hypothetical protein SORBIDRAFT_06g001410 [Sorghum bicolor]
 gb|EES10403.1| hypothetical protein SORBIDRAFT_06g001410 [Sorghum bicolor]
Length=381

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AV+DPEA+A+ V  S+RN+T RR LGY SC TGNPIDDCWRCD++W  NR+RLADC IGF
Sbjct  71   AVEDPEAVANDVHVSIRNSTARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGF  130

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  131  GRNAIGGRDGKIYVVTDP  148



>gb|KFK42808.1| hypothetical protein AALP_AA1G041400 [Arabis alpina]
Length=432

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            + AV +P+ +A    ++V+ SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLA
Sbjct  43   KHAVTNPDEVADEVVALVEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLA  102

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  103  DCGIGFGRNAIGGRDGRFYVVTDP  126



>ref|XP_006307575.1| hypothetical protein CARUB_v10009197mg [Capsella rubella]
 gb|EOA40473.1| hypothetical protein CARUB_v10009197mg [Capsella rubella]
Length=431

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 6/101 (6%)
 Frame = +1

Query  280  EKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPID  447
            +K S   R ++S  +QH  AV +P+ +A    +M + S RN TERRKLGYF+C TGNPID
Sbjct  27   DKISSLPRSDDSEWNQH--AVTNPDEVADEVLAMTEMSARNHTERRKLGYFTCGTGNPID  84

Query  448  DCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  85   DCWRCDRNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  125



>ref|NP_563715.1| putative pectate lyase 1 [Arabidopsis thaliana]
 sp|Q940Q1.2|PLY1_ARATH RecName: Full=Probable pectate lyase 1; AltName: Full=Pectate 
lyase A1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB80622.1| Strong similarity to Musa pectate lyase (gb|X92943). ESTs gb|AA042458, 
gb|ATTS4502, gb|N38552 come from this gene [Arabidopsis 
thaliana]
 gb|AAL57671.1| At1g04680/T1G11_6 [Arabidopsis thaliana]
 gb|AAM65261.1| putative pectate lyase A11 [Arabidopsis thaliana]
 gb|AEE27732.1| putative pectate lyase 1 [Arabidopsis thaliana]
Length=431

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            + AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLA
Sbjct  42   QHAVTNPDEVADEVLALTEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDPNWHKNRKRLA  101

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  102  DCGIGFGRNAIGGRDGRFYVVTDP  125



>emb|CDX89799.1| BnaA10g02830D [Brassica napus]
Length=431

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 4/82 (5%)
 Frame = +1

Query  337  AVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADC  504
            AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLADC
Sbjct  44   AVTNPDEVADEVIALAEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDANWQKNRKRLADC  103

Query  505  AIGFGRNAIGGRDGKYYVVTDP  570
             IGFGRNAIGGRDG++YVVTDP
Sbjct  104  GIGFGRNAIGGRDGRFYVVTDP  125



>ref|XP_010457526.1| PREDICTED: probable pectate lyase 1 [Camelina sativa]
Length=432

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            + AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLA
Sbjct  43   QHAVKNPDEVADEVLALTEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLA  102

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  103  DCGIGFGRNAIGGRDGRFYVVTDP  126



>ref|XP_010484103.1| PREDICTED: probable pectate lyase 1 [Camelina sativa]
Length=432

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            + AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLA
Sbjct  43   QHAVKNPDEVADEVLALTEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLA  102

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  103  DCGIGFGRNAIGGRDGRFYVVTDP  126



>ref|XP_009119265.1| PREDICTED: probable pectate lyase 1 [Brassica rapa]
Length=431

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 4/82 (5%)
 Frame = +1

Query  337  AVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADC  504
            AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLADC
Sbjct  44   AVTNPDEVADEVIALAEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDANWHKNRKRLADC  103

Query  505  AIGFGRNAIGGRDGKYYVVTDP  570
             IGFGRNAIGGRDG++YVVTDP
Sbjct  104  GIGFGRNAIGGRDGRFYVVTDP  125



>emb|CDX86615.1| BnaC08g00880D [Brassica napus]
Length=431

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            + AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLA
Sbjct  42   KHAVTNPDEVADEVLALAEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLA  101

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  102  DCGIGFGRNAIGGRDGRFYVVTDP  125



>emb|CDY61137.1| BnaC05g48970D [Brassica napus]
Length=431

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 6/101 (6%)
 Frame = +1

Query  280  EKSSMADRLNNSYESQHEDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPID  447
            +K S   R N +  + H  AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPID
Sbjct  27   DKISSLSRSNENEWNAH--AVTNPDEVADEVIALAEMSVRNHTERRKLGYFACGTGNPID  84

Query  448  DCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            DCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  85   DCWRCDANWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  125



>ref|XP_009111089.1| PREDICTED: probable pectate lyase 1 [Brassica rapa]
 emb|CDY15517.1| BnaA08g28010D [Brassica napus]
Length=431

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 4/82 (5%)
 Frame = +1

Query  337  AVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADC  504
            AV +P+ +A    ++V+ S RN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLADC
Sbjct  44   AVTNPDEVADEVLALVEMSARNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLADC  103

Query  505  AIGFGRNAIGGRDGKYYVVTDP  570
             IGFGRNAIGGRDG++YVVTDP
Sbjct  104  GIGFGRNAIGGRDGRFYVVTDP  125



>ref|XP_009118623.1| PREDICTED: probable pectate lyase 1 isoform X2 [Brassica rapa]
Length=431

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            + AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLA
Sbjct  42   KHAVTNPDEVADEVIALAEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLA  101

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  102  DCGIGFGRNAIGGRDGRFYVVTDP  125



>ref|XP_008667903.1| PREDICTED: pectate lyase 8 isoform X1 [Zea mays]
 tpg|DAA38670.1| TPA: pectate lyase 8 [Zea mays]
Length=479

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AV+DPEA+A+ V  S+RN+T RR LGY SC TGNPIDDCWRCD++W  NR+RLADC IGF
Sbjct  98   AVEDPEAVANDVHVSIRNSTARRNLGYLSCGTGNPIDDCWRCDSDWHSNRQRLADCGIGF  157

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  158  GRNAIGGRDGKVYVVTDP  175



>gb|KJB61086.1| hypothetical protein B456_009G339700 [Gossypium raimondii]
Length=511

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 4/83 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            E AV DPEA+A    +++D ++RN TERRKLG+FSC TGNPIDDCWRCD NW + RKRLA
Sbjct  124  EHAVADPEAVAMEVETIIDLNIRNLTERRKLGFFSCGTGNPIDDCWRCDPNWHKRRKRLA  183

Query  499  DCAIGFGRNAIGGRDGKYYVVTD  567
            +C IGFGRNA+GGRDG++Y+VTD
Sbjct  184  ECGIGFGRNAVGGRDGRFYIVTD  206



>gb|EPS68938.1| hypothetical protein M569_05827, partial [Genlisea aurea]
Length=394

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +1

Query  319  ESQHEDAVDDPEAIASMVDRSVRNATERR-KLGYFSCATGNPIDDCWRCDTNWARNRKRL  495
            E      ++DPE +A MV+ + RN+TERR KLG+FSC TGNPIDDCWRCD NW +NR+RL
Sbjct  6    EGAFNYTMEDPEEVARMVEMATRNSTERRRKLGFFSCGTGNPIDDCWRCDPNWHKNRRRL  65

Query  496  ADCAIGFGRNAIGGRDGKYYVVTDP  570
            ADC IGFGRNAIGGRDG++YVV+DP
Sbjct  66   ADCGIGFGRNAIGGRDGRFYVVSDP  90



>ref|XP_009118622.1| PREDICTED: probable pectate lyase 1 isoform X1 [Brassica rapa]
Length=434

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            + AV +P+ +A    ++ + SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLA
Sbjct  42   KHAVTNPDEVADEVIALAEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLA  101

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  102  DCGIGFGRNAIGGRDGRFYVVTDP  125



>ref|NP_001147553.1| pectate lyase 8 [Zea mays]
 gb|ACG27904.1| pectate lyase 8 precursor [Zea mays]
Length=467

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AV+DPEA+A+ V  S+RN+T RR LGY SC TGNPIDDCWRCD++W  NR+RLADC IGF
Sbjct  99   AVEDPEAVANDVHVSIRNSTARRNLGYLSCGTGNPIDDCWRCDSDWHSNRQRLADCGIGF  158

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  159  GRNAIGGRDGKVYVVTDP  176



>gb|ABR17791.1| unknown [Picea sitchensis]
Length=420

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = +1

Query  319  ESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            +S +  AV+DPE +  MV+RS+ ++  RR+LGYFSC TGNPIDDCWRCD +W RNRKRLA
Sbjct  26   QSSNSSAVEDPEMVVEMVERSINSS--RRQLGYFSCGTGNPIDDCWRCDPDWERNRKRLA  83

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGR+G++YVVTDP
Sbjct  84   DCGIGFGRNAIGGRNGRFYVVTDP  107



>dbj|BAK06362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE + S V  S+RN+T RR LGY SC TGNPIDDCWRCD++W  NR+RLADC IGF
Sbjct  85   AVDDPETVVSQVHMSIRNSTARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGF  144

Query  517  GRNAIGGRDGKYYVVTD  567
            GRNAIGGRDGK YVVTD
Sbjct  145  GRNAIGGRDGKIYVVTD  161



>ref|XP_008800563.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=456

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = +1

Query  283  KSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRC  462
             SSMA+R         E AVDDPE +AS V  ++RN+T RR LGY SC TGNPIDDCWRC
Sbjct  60   SSSMAER---PALKAAEGAVDDPEMVASTVQMTIRNSTARRALGYLSCGTGNPIDDCWRC  116

Query  463  DTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            D++W  +R RLADC IGFGRNA+GGRDG  YVVTDP
Sbjct  117  DSDWHLHRTRLADCGIGFGRNAVGGRDGSLYVVTDP  152



>ref|XP_008800564.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=455

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = +1

Query  283  KSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRC  462
             SSMA+R         E AVDDPE +AS V  ++RN+T RR LGY SC TGNPIDDCWRC
Sbjct  59   SSSMAER---PALKAAEGAVDDPEMVASTVQMTIRNSTARRALGYLSCGTGNPIDDCWRC  115

Query  463  DTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            D++W  +R RLADC IGFGRNA+GGRDG  YVVTDP
Sbjct  116  DSDWHLHRTRLADCGIGFGRNAVGGRDGSLYVVTDP  151



>ref|XP_010475133.1| PREDICTED: probable pectate lyase 1 [Camelina sativa]
Length=432

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 4/84 (5%)
 Frame = +1

Query  331  EDAVDDPEAIA----SMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLA  498
            + AV +P+ +A    ++ + S+RN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLA
Sbjct  43   QHAVTNPDEVADEVLALTEMSLRNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLA  102

Query  499  DCAIGFGRNAIGGRDGKYYVVTDP  570
            DC IGFGRNAIGGRDG++YVVTDP
Sbjct  103  DCGIGFGRNAIGGRDGRFYVVTDP  126



>ref|XP_008789532.1| PREDICTED: probable pectate lyase 8 [Phoenix dactylifera]
Length=322

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDP+ +ASMV  S+RN++ RR LGY SC TGNPIDDCWRCD  W  +RKRLADC IGF
Sbjct  3    AVDDPDMVASMVQMSIRNSSARRALGYLSCGTGNPIDDCWRCDPAWHHHRKRLADCGIGF  62

Query  517  GRNAIGGRDGKYYVVTDP  570
            G NA+GGRDG+ YVVTDP
Sbjct  63   GHNAVGGRDGRLYVVTDP  80



>ref|XP_010239619.1| PREDICTED: probable pectate lyase 8 isoform X1 [Brachypodium 
distachyon]
Length=450

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +1

Query  271  WSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDD  450
            W  + +S+    +     + + +VDDPE +AS V  S++N+T RR LGY SC TGNPIDD
Sbjct  47   WLRDSTSLLPAASRRSGGEDDASVDDPETVASQVHMSIKNSTARRNLGYLSCGTGNPIDD  106

Query  451  CWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTD  567
            CWRCD++W  NR+RLADC IGFGRNAIGGRDGK YVVTD
Sbjct  107  CWRCDSDWHNNRQRLADCGIGFGRNAIGGRDGKLYVVTD  145



>ref|XP_010239620.1| PREDICTED: probable pectate lyase 8 isoform X2 [Brachypodium 
distachyon]
Length=424

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            +VDDPE +AS V  S++N+T RR LGY SC TGNPIDDCWRCD++W  NR+RLADC IGF
Sbjct  43   SVDDPETVASQVHMSIKNSTARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGF  102

Query  517  GRNAIGGRDGKYYVVTD  567
            GRNAIGGRDGK YVVTD
Sbjct  103  GRNAIGGRDGKLYVVTD  119



>ref|NP_001141589.1| uncharacterized protein LOC100273705 [Zea mays]
 gb|ACF86672.1| unknown [Zea mays]
 gb|AFW57904.1| hypothetical protein ZEAMMB73_963462 [Zea mays]
Length=466

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AV+DPEA+A+ V  S+ N T RR LGY SC TGNPIDDCWRCD++W  NRKRLADC IGF
Sbjct  85   AVEDPEAVANDVHASINNITARRNLGYLSCGTGNPIDDCWRCDSDWHNNRKRLADCGIGF  144

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  145  GRNAIGGRDGKIYVVTDP  162



>ref|XP_008804450.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=426

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE +AS V  ++ N T RR LGY SC TGN IDDCWRCD  W RNRKRLADC IGF
Sbjct  45   AVDDPELVASEVHMTINNHTARRALGYLSCGTGNSIDDCWRCDPEWHRNRKRLADCGIGF  104

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDG+YYVVTDP
Sbjct  105  GRNAIGGRDGRYYVVTDP  122



>ref|XP_008804449.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=451

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE +AS V  ++ N T RR LGY SC TGN IDDCWRCD  W RNRKRLADC IGF
Sbjct  70   AVDDPELVASEVHMTINNHTARRALGYLSCGTGNSIDDCWRCDPEWHRNRKRLADCGIGF  129

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDG+YYVVTDP
Sbjct  130  GRNAIGGRDGRYYVVTDP  147



>ref|XP_009382167.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=427

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE +AS V   ++N+T RR LGY SC+TGNPIDDCWRCD  W RNRKRLADC IGF
Sbjct  46   AVDDPELVASEVHMMIKNSTARRALGYLSCSTGNPIDDCWRCDAEWHRNRKRLADCGIGF  105

Query  517  GRNAIGGRDGKYYVVTD  567
            GRNAIGGR+G++YVVTD
Sbjct  106  GRNAIGGREGRFYVVTD  122



>ref|XP_009408120.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  331  EDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAI  510
            E AVDDPE +AS V   + N+T RR LGY SC TGNPIDDCWRCD +W  NRKRLADC I
Sbjct  64   EAAVDDPEEVASAVQMIISNSTARRSLGYLSCGTGNPIDDCWRCDPDWHLNRKRLADCGI  123

Query  511  GFGRNAIGGRDGKYYVVTD  567
            GFGRNA+GGRDG+YYVVTD
Sbjct  124  GFGRNALGGRDGQYYVVTD  142



>gb|ABR17766.1| unknown [Picea sitchensis]
Length=426

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  343  DDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGR  522
            +DPE++  MV RS+ N+T RR+LGY SC TGNPIDDCWRCD NW RNRKRLADCAIGFGR
Sbjct  48   EDPESVVQMVQRSIDNSTRRRELGYLSCGTGNPIDDCWRCDPNWERNRKRLADCAIGFGR  107

Query  523  NAIGGRDGKYYVVTDP  570
            +A+GG+ G +Y+VTDP
Sbjct  108  DALGGKHGSFYLVTDP  123



>gb|AAK66161.1| pectate lyase [Fragaria x ananassa]
Length=368

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  379  SVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYV  558
            S+RN+TERRKLGYFSC TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YV
Sbjct  1    SIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYV  60

Query  559  VTDP  570
            VTDP
Sbjct  61   VTDP  64



>ref|XP_010933172.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  340  VDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFG  519
            VDDPE +AS V  S++N T RR LGY SC TGN IDDCWRCD  W RNRKRLADC IGFG
Sbjct  46   VDDPELVASEVLMSIKNHTMRRSLGYLSCGTGNSIDDCWRCDPKWHRNRKRLADCGIGFG  105

Query  520  RNAIGGRDGKYYVVTDP  570
            RNAIGGRDG+YYVV+DP
Sbjct  106  RNAIGGRDGRYYVVSDP  122



>ref|XP_010933171.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=452

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  340  VDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFG  519
            VDDPE +AS V  S++N T RR LGY SC TGN IDDCWRCD  W RNRKRLADC IGFG
Sbjct  72   VDDPELVASEVLMSIKNHTMRRSLGYLSCGTGNSIDDCWRCDPKWHRNRKRLADCGIGFG  131

Query  520  RNAIGGRDGKYYVVTDP  570
            RNAIGGRDG+YYVV+DP
Sbjct  132  RNAIGGRDGRYYVVSDP  148



>ref|XP_009391056.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=453

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  331  EDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAI  510
            E AVDDPE +AS V  S+ N+T RR LGY SC TGNPIDDCWRCD +W  NRK LADC I
Sbjct  70   EAAVDDPEEVASAVHMSISNSTARRSLGYLSCGTGNPIDDCWRCDPDWHLNRKTLADCGI  129

Query  511  GFGRNAIGGRDGKYYVVTD  567
            GFGRNAIGGRDG++YVVTD
Sbjct  130  GFGRNAIGGRDGEFYVVTD  148



>ref|XP_004975048.1| PREDICTED: probable pectate lyase 15-like isoform X3 [Setaria 
italica]
Length=440

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AV+DPEA+   V  S+RN+T RR L Y SC TGNPIDDCWRCD +W +NR+RLADC IGF
Sbjct  59   AVEDPEAVVDDVHVSIRNSTARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIGF  118

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  119  GRNAIGGRDGKIYVVTDP  136



>ref|XP_009384552.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=457

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AVDDPE +A+ V  ++ N+T RR LGY SC TGNPIDDCWRCD+ W  +RKRLADC IGF
Sbjct  76   AVDDPELVANEVHMAISNSTARRALGYLSCGTGNPIDDCWRCDSEWHLHRKRLADCGIGF  135

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDG+YYVV+DP
Sbjct  136  GRNAIGGRDGRYYVVSDP  153



>gb|KJB15669.1| hypothetical protein B456_002G189900 [Gossypium raimondii]
Length=406

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = +1

Query  340  VDDPEAIASMVDRSVRNATE-RRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            V DPE +   V+ S+RNAT  RRKLG+ SC TGNPIDDCWRCD NWA+NRKRLADC IGF
Sbjct  25   VQDPEQVVRQVNESIRNATAARRKLGFLSCGTGNPIDDCWRCDPNWAKNRKRLADCGIGF  84

Query  517  GRNAIGGRDGKYYVVTDP  570
            G+ AIGGR+GK+YVVTDP
Sbjct  85   GKRAIGGRNGKFYVVTDP  102



>gb|KJB42428.1| hypothetical protein B456_007G152500 [Gossypium raimondii]
Length=445

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            ++ + AE  +L  L+ SS AD L++  + ++E AVD+PE IASMVD +++N+T RR LGY
Sbjct  32   LNSRLAEGNKLQGLKNSSTADGLDDD-KWKNEHAVDNPEEIASMVDMTIKNSTARRNLGY  90

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            FSC TGNPIDDCWRCD  W R R+RLA C IGFGRNAIGGRDG+YYVVTDP
Sbjct  91   FSCGTGNPIDDCWRCDRRWYRRRRRLASCGIGFGRNAIGGRDGRYYVVTDP  141



>ref|XP_006282594.1| hypothetical protein CARUB_v10004736mg [Capsella rubella]
 gb|EOA15492.1| hypothetical protein CARUB_v10004736mg [Capsella rubella]
Length=469

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 79/116 (68%), Gaps = 5/116 (4%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVD-DPEAIAS----MVDRSVRNATER  402
            M+  R  +TE +    SS     +   +  H+ AV  DP+ +A+    ++  S +N T R
Sbjct  50   MAATRKLKTEEFQSSNSSTMAATSVGGDEPHQHAVAADPDEVAAEVAKLIQMSEQNRTAR  109

Query  403  RKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            R LG+FSC TGNP+DDCWRCD NW +NRKRLADC IGFGRNAIGGRDG++YVVTDP
Sbjct  110  RNLGFFSCGTGNPVDDCWRCDRNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDP  165



>gb|KHF99208.1| hypothetical protein F383_08934 [Gossypium arboreum]
Length=445

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +1

Query  238  MSQQRAEETELWSLEKSSMADRLNNSYESQHEDAVDDPEAIASMVDRSVRNATERRKLGY  417
            ++ + AE  +L  L+ SS AD L++  + ++E AVD+PE IASMVD +++N+T RR LGY
Sbjct  32   LNSRLAEGNKLQGLKNSSTADGLDDD-KWKNEHAVDNPEEIASMVDMTIKNSTARRNLGY  90

Query  418  FSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYVVTDP  570
            FSC TGNPIDDCWRCD  W R R+RLA C IGFGRNAIGGRDG+YYVVTDP
Sbjct  91   FSCGTGNPIDDCWRCDRRWYRRRRRLASCGIGFGRNAIGGRDGRYYVVTDP  141



>ref|XP_004152502.1| PREDICTED: probable pectate lyase 22-like [Cucumis sativus]
 gb|KGN64357.1| hypothetical protein Csa_1G049960 [Cucumis sativus]
Length=413

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +1

Query  322  SQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLAD  501
            S +  AV +PE +   V RS+ NAT+RR LGY SC TGNPIDDCWRCD+NW +NR+RLAD
Sbjct  27   SPNPAAVSNPELVVQEVHRSIINATKRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLAD  86

Query  502  CAIGFGRNAIGGRDGKYYVVTD  567
            C IGFG+NAIGGRDGK YVVTD
Sbjct  87   CGIGFGKNAIGGRDGKIYVVTD  108



>ref|XP_004975047.1| PREDICTED: probable pectate lyase 15-like isoform X2 [Setaria 
italica]
Length=473

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AV+DPEA+   V  S+RN+T RR L Y SC TGNPIDDCWRCD +W +NR+RLADC IGF
Sbjct  92   AVEDPEAVVDDVHVSIRNSTARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIGF  151

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  152  GRNAIGGRDGKIYVVTDP  169



>ref|XP_008439105.1| PREDICTED: probable pectate lyase 22 [Cucumis melo]
Length=411

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  VDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFG  519
            V DPE +   V RS+ NAT+RR LGY SC TGNPIDDCWRCD+NW +NR+RLADC IGFG
Sbjct  31   VSDPELVVQEVHRSIINATKRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLADCGIGFG  90

Query  520  RNAIGGRDGKYYVVTD  567
            +NAIGGRDGK YVVTD
Sbjct  91   KNAIGGRDGKIYVVTD  106



>ref|XP_004975046.1| PREDICTED: probable pectate lyase 15-like isoform X1 [Setaria 
italica]
Length=509

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AV+DPEA+   V  S+RN+T RR L Y SC TGNPIDDCWRCD +W +NR+RLADC IGF
Sbjct  128  AVEDPEAVVDDVHVSIRNSTARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIGF  187

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNAIGGRDGK YVVTDP
Sbjct  188  GRNAIGGRDGKIYVVTDP  205



>gb|AAN60248.1| unknown [Arabidopsis thaliana]
Length=193

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  340  VDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFG  519
            V DPE +   V R +  +  RRKLG+FSC +GNPIDDCWRCD +W +NRKRLADC IGFG
Sbjct  28   VSDPELVVEEVHRKINESISRRKLGFFSCGSGNPIDDCWRCDKDWEKNRKRLADCGIGFG  87

Query  520  RNAIGGRDGKYYVVTDP  570
            +NAIGGRDG+ YVVTDP
Sbjct  88   KNAIGGRDGEIYVVTDP  104



>ref|XP_006297766.1| hypothetical protein CARUB_v10013802mg [Capsella rubella]
 gb|EOA30664.1| hypothetical protein CARUB_v10013802mg [Capsella rubella]
Length=381

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  358  IASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGG  537
            + + +D S+RN+TERR+LGYFSCATGNPIDDCWRCD  W   RKRLADC+IGFGRNAIGG
Sbjct  7    MPTCIDTSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCSIGFGRNAIGG  66

Query  538  RDGKYYVVTDP  570
            RDG+YYVVTDP
Sbjct  67   RDGRYYVVTDP  77



>ref|XP_010918897.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AV+DPE +AS V  ++ N T RR LGY SC TGN IDDCWRCD  W RNRKRLADC IGF
Sbjct  45   AVNDPELVASEVHMAINNHTARRSLGYLSCGTGNSIDDCWRCDPQWHRNRKRLADCGIGF  104

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNA+GGRDG+YY VTDP
Sbjct  105  GRNAVGGRDGRYYAVTDP  122



>ref|XP_010918895.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=451

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  337  AVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            AV+DPE +AS V  ++ N T RR LGY SC TGN IDDCWRCD  W RNRKRLADC IGF
Sbjct  70   AVNDPELVASEVHMAINNHTARRSLGYLSCGTGNSIDDCWRCDPQWHRNRKRLADCGIGF  129

Query  517  GRNAIGGRDGKYYVVTDP  570
            GRNA+GGRDG+YY VTDP
Sbjct  130  GRNAVGGRDGRYYAVTDP  147



>emb|CDX88845.1| BnaA03g08040D [Brassica napus]
Length=752

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  370  VDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGK  549
            V  SVRN TERRKLGYF+C TGNPIDDCWRCD NW +NRKRLADC IGFGRNAIGGRDG+
Sbjct  6    VLMSVRNHTERRKLGYFACGTGNPIDDCWRCDANWHKNRKRLADCGIGFGRNAIGGRDGR  65

Query  550  YYVVTDP  570
            +YVVTDP
Sbjct  66   FYVVTDP  72



>ref|XP_002321242.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE99557.2| pectate lyase family protein [Populus trichocarpa]
Length=372

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  367  MVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDG  546
            MVD S+RN+TERRKLG+FSC TGNPIDDCWRCD +W  +RKRLA+C IGFGRNA+GGRDG
Sbjct  1    MVDESIRNSTERRKLGFFSCVTGNPIDDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDG  60

Query  547  KYYVVTDP  570
            KYYVV++P
Sbjct  61   KYYVVSNP  68



>ref|XP_004157771.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 22-like 
[Cucumis sativus]
Length=413

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +1

Query  322  SQHEDAVDDPEAIASMVDRSVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLAD  501
            S +  AV +PE +   V RS+ NAT+RR LGY SC TGNPIDDCWRCD+NW +NR+RLAD
Sbjct  27   SPNPAAVSNPELVVQEVHRSIINATKRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLAD  86

Query  502  CAIGFGRNAIGGRDGKYYVVTD  567
            C IGFG+NAIGGRDG  YVVTD
Sbjct  87   CGIGFGKNAIGGRDGXIYVVTD  108



>ref|XP_004299169.1| PREDICTED: probable pectate lyase 18 [Fragaria vesca subsp. vesca]
Length=412

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = +1

Query  340  VDDPEAIASMVDRSVRNA-TERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            V DPE +   V RS+ NA T RRKLGY SC TGNPIDDCWRCD NW +NR+RLADCAIGF
Sbjct  31   VQDPELVVQQVQRSIYNASTTRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGF  90

Query  517  GRNAIGGRDGKYYVVTD  567
            G+NAIGGRDG+ YVVTD
Sbjct  91   GKNAIGGRDGRIYVVTD  107



>gb|EPS63108.1| hypothetical protein M569_11679, partial [Genlisea aurea]
Length=382

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = +1

Query  340  VDDPEAIASMVDRSVRNAT-ERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGF  516
            V+DPE ++ MV  +VRNAT  RR+LGYFSC TGNPIDDCWRC+ +W  NRK+LADC+IGF
Sbjct  1    VEDPEEVSRMVTMAVRNATWRRRRLGYFSCGTGNPIDDCWRCNPDWQNNRKQLADCSIGF  60

Query  517  GRNAIGGRDGKYYVVTDP  570
            GR+AIGGRDG++Y+VTDP
Sbjct  61   GRDAIGGRDGRFYLVTDP  78



>ref|XP_008460728.1| PREDICTED: probable pectate lyase 1 isoform X3 [Cucumis melo]
Length=369

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +1

Query  379  SVRNATERRKLGYFSCATGNPIDDCWRCDTNWARNRKRLADCAIGFGRNAIGGRDGKYYV  558
            S+RN+TERRKLG+FSC TGNPIDDCWRCD+NW RNRKRLA+C IGFGRNAIGGRDG++YV
Sbjct  2    SIRNSTERRKLGFFSCGTGNPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFYV  61

Query  559  VTD  567
            VTD
Sbjct  62   VTD  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515