BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J24

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603008.1|  PREDICTED: external alternative NAD(P)H-ubiq...    231   1e-68   Nicotiana tomentosiformis
ref|XP_009777442.1|  PREDICTED: external alternative NAD(P)H-ubiq...    230   2e-68   Nicotiana sylvestris
ref|XP_004232796.1|  PREDICTED: external alternative NAD(P)H-ubiq...    223   1e-65   Solanum lycopersicum
ref|XP_006347139.1|  PREDICTED: external alternative NAD(P)H-ubiq...    222   2e-65   Solanum tuberosum [potatoes]
ref|XP_011096201.1|  PREDICTED: external alternative NAD(P)H-ubiq...    209   2e-60   Sesamum indicum [beniseed]
emb|CDO99637.1|  unnamed protein product                                206   3e-59   Coffea canephora [robusta coffee]
ref|XP_010057754.1|  PREDICTED: external alternative NAD(P)H-ubiq...    195   2e-55   Eucalyptus grandis [rose gum]
ref|XP_010538314.1|  PREDICTED: external alternative NAD(P)H-ubiq...    195   3e-55   Tarenaya hassleriana [spider flower]
gb|KCW75033.1|  hypothetical protein EUGRSUZ_E03807                     195   4e-55   Eucalyptus grandis [rose gum]
gb|KCW75032.1|  hypothetical protein EUGRSUZ_E03807                     196   4e-55   Eucalyptus grandis [rose gum]
ref|XP_011086117.1|  PREDICTED: external alternative NAD(P)H-ubiq...    194   8e-55   Sesamum indicum [beniseed]
ref|XP_008441960.1|  PREDICTED: external alternative NAD(P)H-ubiq...    192   5e-54   Cucumis melo [Oriental melon]
ref|XP_010087909.1|  putative NADH-ubiquinone oxidoreductase            193   5e-54   
ref|XP_011086124.1|  PREDICTED: external alternative NAD(P)H-ubiq...    191   8e-54   Sesamum indicum [beniseed]
gb|KDO75712.1|  hypothetical protein CISIN_1g007975mg                   189   8e-54   Citrus sinensis [apfelsine]
ref|XP_010057753.1|  PREDICTED: external alternative NAD(P)H-ubiq...    191   1e-53   
ref|XP_010431858.1|  PREDICTED: external alternative NAD(P)H-ubiq...    191   1e-53   Camelina sativa [gold-of-pleasure]
gb|KDO75711.1|  hypothetical protein CISIN_1g007975mg                   189   2e-53   Citrus sinensis [apfelsine]
ref|XP_002872730.1|  hypothetical protein ARALYDRAFT_911770             190   2e-53   Arabidopsis lyrata subsp. lyrata
gb|KFK32231.1|  nad h dehydrogenase b2                                  190   2e-53   Arabis alpina [alpine rockcress]
gb|AAD48975.1|AF162444_7  contains similarity to Pfam family PF00...    189   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb|EYU43419.1|  hypothetical protein MIMGU_mgv1a003457mg                189   3e-53   Erythranthe guttata [common monkey flower]
ref|XP_010538689.1|  PREDICTED: external alternative NAD(P)H-ubiq...    189   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_006467902.1|  PREDICTED: external alternative NAD(P)H-ubiq...    189   6e-53   Citrus sinensis [apfelsine]
ref|XP_006449209.1|  hypothetical protein CICLE_v10014723mg             189   7e-53   Citrus clementina [clementine]
ref|XP_010422373.1|  PREDICTED: external alternative NAD(P)H-ubiq...    188   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008383824.1|  PREDICTED: external alternative NAD(P)H-ubiq...    184   2e-51   Malus domestica [apple tree]
ref|XP_010431865.1|  PREDICTED: external alternative NAD(P)H-ubiq...    184   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009114515.1|  PREDICTED: external alternative NAD(P)H-ubiq...    183   7e-51   Brassica rapa
ref|NP_567283.1|  NAD(P)H dehydrogenase B2                              183   7e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268847.1|  PREDICTED: external alternative NAD(P)H-ubiq...    183   9e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010268848.1|  PREDICTED: external alternative NAD(P)H-ubiq...    183   9e-51   
emb|CDY44749.1|  BnaC09g22310D                                          183   9e-51   Brassica napus [oilseed rape]
ref|NP_001190678.1|  NAD(P)H dehydrogenase B2                           183   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009375317.1|  PREDICTED: external alternative NAD(P)H-ubiq...    182   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_010422374.1|  PREDICTED: external alternative NAD(P)H-ubiq...    182   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006287294.1|  hypothetical protein CARUB_v10000488mg             182   3e-50   
ref|XP_010455838.1|  PREDICTED: external alternative NAD(P)H-ubiq...    181   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008364132.1|  PREDICTED: external alternative NAD(P)H-ubiq...    181   5e-50   
ref|XP_004146581.1|  PREDICTED: NAD(P)H dehydrogenase B3, mitocho...    181   5e-50   Cucumis sativus [cucumbers]
ref|XP_011001139.1|  PREDICTED: external alternative NAD(P)H-ubiq...    180   8e-50   Populus euphratica
ref|XP_002305652.1|  NADH dehydrogenase-like family protein             180   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_004158024.1|  PREDICTED: NAD(P)H dehydrogenase B3, mitocho...    179   2e-49   
ref|XP_006413774.1|  hypothetical protein EUTSA_v10024771mg             178   3e-49   Eutrema salsugineum [saltwater cress]
ref|XP_007148248.1|  hypothetical protein PHAVU_006G192400g             177   7e-49   Phaseolus vulgaris [French bean]
ref|NP_193880.5|  NAD(P)H dehydrogenase B3                              177   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451313.1|  PREDICTED: external alternative NAD(P)H-ubiq...    172   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_011043304.1|  PREDICTED: external alternative NAD(P)H-ubiq...    177   2e-48   Populus euphratica
ref|XP_010647594.1|  PREDICTED: external alternative NAD(P)H-ubiq...    168   2e-48   Vitis vinifera
emb|CBI14826.3|  unnamed protein product                                168   2e-48   Vitis vinifera
ref|XP_011086121.1|  PREDICTED: external alternative NAD(P)H-ubiq...    175   5e-48   
ref|XP_002316663.1|  NADH dehydrogenase-like family protein             175   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_002274523.1|  PREDICTED: external alternative NAD(P)H-ubiq...    175   6e-48   Vitis vinifera
ref|XP_003635673.2|  PREDICTED: external alternative NAD(P)H-ubiq...    168   7e-48   
ref|XP_006357530.1|  PREDICTED: external alternative NAD(P)H-ubiq...    174   1e-47   Solanum tuberosum [potatoes]
gb|AID21670.1|  At4g21490p-like protein                                 174   2e-47   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010095837.1|  External NADH-ubiquinone oxidoreductase 1          173   3e-47   
ref|XP_002319383.1|  NADH dehydrogenase-related family protein          173   4e-47   Populus trichocarpa [western balsam poplar]
ref|XP_008448220.1|  PREDICTED: external alternative NAD(P)H-ubiq...    172   5e-47   Cucumis melo [Oriental melon]
ref|XP_006597394.1|  PREDICTED: external alternative NAD(P)H-ubiq...    172   7e-47   
ref|XP_008230220.1|  PREDICTED: external alternative NAD(P)H-ubiq...    172   8e-47   Prunus mume [ume]
ref|XP_010268843.1|  PREDICTED: external alternative NAD(P)H-ubiq...    172   8e-47   Nelumbo nucifera [Indian lotus]
ref|XP_007043489.1|  NAD(P)H dehydrogenase B1 isoform 3                 168   1e-46   
ref|XP_007025802.1|  NAD(P)H dehydrogenase B2 isoform 2                 171   1e-46   
ref|XP_010686280.1|  PREDICTED: external alternative NAD(P)H-ubiq...    171   1e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002524685.1|  NADH dehydrogenase, putative                       170   3e-46   Ricinus communis
ref|XP_007025801.1|  NAD(P)H dehydrogenase B2 isoform 1                 170   4e-46   
ref|XP_011048461.1|  PREDICTED: external alternative NAD(P)H-ubiq...    170   4e-46   Populus euphratica
gb|KDP24191.1|  hypothetical protein JCGZ_25848                         170   4e-46   Jatropha curcas
ref|XP_010436462.1|  PREDICTED: external alternative NAD(P)H-ubiq...    169   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_003608247.1|  External NADH-ubiquinone oxidoreductase            170   5e-46   Medicago truncatula
ref|XP_002274469.1|  PREDICTED: external alternative NAD(P)H-ubiq...    170   5e-46   
gb|KHG06408.1|  External alternative NADH-ubiquinone oxidoreducta...    170   6e-46   Gossypium arboreum [tree cotton]
ref|XP_007215022.1|  hypothetical protein PRUPE_ppa003367mg             169   8e-46   
gb|KJB66647.1|  hypothetical protein B456_010G150000                    169   8e-46   Gossypium raimondii
ref|XP_004243314.1|  PREDICTED: external alternative NAD(P)H-ubiq...    169   9e-46   Solanum lycopersicum
ref|XP_007043484.1|  NAD(P)H dehydrogenase B4                           169   9e-46   
ref|XP_006285107.1|  hypothetical protein CARUB_v10006440mg             169   1e-45   Capsella rubella
ref|XP_003547132.1|  PREDICTED: external alternative NAD(P)H-ubiq...    169   1e-45   Glycine max [soybeans]
ref|XP_004139962.1|  PREDICTED: NAD(P)H dehydrogenase B2, mitocho...    169   1e-45   Cucumis sativus [cucumbers]
ref|XP_004293504.2|  PREDICTED: external alternative NAD(P)H-ubiq...    169   2e-45   Fragaria vesca subsp. vesca
ref|XP_006447382.1|  hypothetical protein CICLE_v10017486mg             168   3e-45   Citrus clementina [clementine]
ref|XP_007043487.1|  NADH dehydrogenase, putative isoform 1             167   3e-45   
ref|XP_002319927.1|  pyridine nucleotide-disulfide oxidoreductase...    167   3e-45   
ref|XP_007043488.1|  NADH dehydrogenase, putative isoform 2             167   4e-45   
ref|XP_006594628.1|  PREDICTED: external alternative NAD(P)H-ubiq...    167   4e-45   Glycine max [soybeans]
emb|CBI28383.3|  unnamed protein product                                167   4e-45   Vitis vinifera
ref|XP_008379566.1|  PREDICTED: external alternative NAD(P)H-ubiq...    166   2e-44   
gb|EYU24869.1|  hypothetical protein MIMGU_mgv1a003609mg                165   2e-44   Erythranthe guttata [common monkey flower]
emb|CDP14697.1|  unnamed protein product                                165   3e-44   Coffea canephora [robusta coffee]
ref|XP_011467787.1|  PREDICTED: LOW QUALITY PROTEIN: external alt...    164   5e-44   Fragaria vesca subsp. vesca
ref|XP_004507222.1|  PREDICTED: NAD(P)H dehydrogenase B3, mitocho...    164   5e-44   Cicer arietinum [garbanzo]
ref|XP_006594629.1|  PREDICTED: external alternative NAD(P)H-ubiq...    164   6e-44   Glycine max [soybeans]
ref|XP_011048463.1|  PREDICTED: external alternative NAD(P)H-ubiq...    164   7e-44   Populus euphratica
ref|XP_011048464.1|  PREDICTED: external alternative NAD(P)H-ubiq...    164   7e-44   Populus euphratica
gb|KDP20881.1|  hypothetical protein JCGZ_21352                         164   8e-44   Jatropha curcas
ref|XP_010035668.1|  PREDICTED: external alternative NAD(P)H-ubiq...    164   8e-44   Eucalyptus grandis [rose gum]
ref|XP_011085368.1|  PREDICTED: external alternative NAD(P)H-ubiq...    164   9e-44   Sesamum indicum [beniseed]
emb|CAN66469.1|  hypothetical protein VITISV_016566                     164   1e-43   Vitis vinifera
ref|XP_009393356.1|  PREDICTED: external alternative NAD(P)H-ubiq...    163   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007159245.1|  hypothetical protein PHAVU_002G221500g             163   1e-43   Phaseolus vulgaris [French bean]
ref|XP_009768472.1|  PREDICTED: external alternative NAD(P)H-ubiq...    162   2e-43   Nicotiana sylvestris
ref|XP_010931905.1|  PREDICTED: external alternative NAD(P)H-ubiq...    162   3e-43   Elaeis guineensis
ref|XP_011048462.1|  PREDICTED: external alternative NAD(P)H-ubiq...    162   4e-43   Populus euphratica
ref|XP_003530989.1|  PREDICTED: external alternative NAD(P)H-ubiq...    162   4e-43   Glycine max [soybeans]
ref|XP_002319384.1|  pyridine nucleotide-disulfide oxidoreductase...    162   4e-43   
gb|AFK40813.1|  unknown                                                 161   7e-43   Lotus japonicus
ref|XP_010095836.1|  External alternative NADH-ubiquinone oxidore...    160   9e-43   Morus notabilis
ref|XP_004136810.1|  PREDICTED: NAD(P)H dehydrogenase B1, mitocho...    160   1e-42   Cucumis sativus [cucumbers]
emb|CBI33303.3|  unnamed protein product                                154   1e-42   Vitis vinifera
gb|KHN41160.1|  External NADH-ubiquinone oxidoreductase 1, mitoch...    160   1e-42   Glycine soja [wild soybean]
gb|KEH36511.1|  NAD(P)H dehydrogenase B2                                160   2e-42   Medicago truncatula
dbj|BAM13876.1|  type II NAD(P)H dehydrogenase                          160   2e-42   Arum maculatum [cuckoo-pint]
ref|XP_010689480.1|  PREDICTED: external alternative NAD(P)H-ubiq...    159   3e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008803856.1|  PREDICTED: external alternative NAD(P)H-ubiq...    159   3e-42   Phoenix dactylifera
ref|XP_008793641.1|  PREDICTED: external alternative NAD(P)H-ubiq...    159   3e-42   Phoenix dactylifera
ref|XP_009375384.1|  PREDICTED: external alternative NAD(P)H-ubiq...    159   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_008230218.1|  PREDICTED: external alternative NAD(P)H-ubiq...    159   4e-42   Prunus mume [ume]
ref|XP_008803854.1|  PREDICTED: external alternative NAD(P)H-ubiq...    159   4e-42   Phoenix dactylifera
ref|XP_007217323.1|  hypothetical protein PRUPE_ppa019962mg             159   4e-42   Prunus persica
gb|AFN53706.1|  putative dead box ATP-dependent RNA helicase            162   5e-42   Linum usitatissimum
ref|XP_006582334.1|  PREDICTED: external alternative NAD(P)H-ubiq...    158   7e-42   Glycine max [soybeans]
ref|XP_004486261.1|  PREDICTED: NAD(P)H dehydrogenase B2, mitocho...    158   9e-42   
ref|XP_009350613.1|  PREDICTED: external alternative NAD(P)H-ubiq...    157   1e-41   Pyrus x bretschneideri [bai li]
dbj|BAM13872.1|  type II NAD(P)H dehydrogenase                          157   1e-41   Symplocarpus renifolius
ref|XP_011100342.1|  PREDICTED: external alternative NAD(P)H-ubiq...    157   2e-41   Sesamum indicum [beniseed]
gb|KHN07323.1|  External alternative NADH-ubiquinone oxidoreducta...    157   2e-41   Glycine soja [wild soybean]
ref|XP_003529293.1|  PREDICTED: external alternative NAD(P)H-ubiq...    157   2e-41   Glycine max [soybeans]
ref|XP_009420534.1|  PREDICTED: external alternative NAD(P)H-ubiq...    157   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN59739.1|  hypothetical protein VITISV_027063                     157   3e-41   Vitis vinifera
gb|KHN00103.1|  External alternative NADH-ubiquinone oxidoreducta...    156   3e-41   Glycine soja [wild soybean]
ref|XP_008368499.1|  PREDICTED: external alternative NAD(P)H-ubiq...    156   3e-41   
ref|XP_006447379.1|  hypothetical protein CICLE_v10014668mg             156   3e-41   
emb|CDP14696.1|  unnamed protein product                                156   3e-41   Coffea canephora [robusta coffee]
ref|XP_006469842.1|  PREDICTED: external alternative NAD(P)H-ubiq...    156   4e-41   Citrus sinensis [apfelsine]
ref|XP_002517991.1|  Rotenone-insensitive NADH-ubiquinone oxidore...    156   5e-41   Ricinus communis
gb|KEH29603.1|  NAD(P)H dehydrogenase B2                                155   6e-41   Medicago truncatula
ref|XP_010904945.1|  PREDICTED: external alternative NAD(P)H-ubiq...    155   8e-41   Elaeis guineensis
emb|CAA18713.1|  NADH dehydrogenase like protein                        154   9e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB77327.1|  hypothetical protein B456_012G131700                    155   9e-41   Gossypium raimondii
gb|KHN22896.1|  External NADH-ubiquinone oxidoreductase 1, mitoch...    155   1e-40   Glycine soja [wild soybean]
ref|XP_007132629.1|  hypothetical protein PHAVU_011G111200g             155   1e-40   Phaseolus vulgaris [French bean]
gb|KJB77326.1|  hypothetical protein B456_012G131700                    155   1e-40   Gossypium raimondii
dbj|BAM13873.1|  type II NAD(P)H dehydrogenase                          154   1e-40   Symplocarpus renifolius
ref|XP_008224954.1|  PREDICTED: external alternative NAD(P)H-ubiq...    154   1e-40   Prunus mume [ume]
sp|M1BYJ7.1|ENDB1_SOLTU  RecName: Full=External alternative NAD(P...    154   2e-40   Solanum tuberosum [potatoes]
ref|NP_001274854.1|  external alternative NAD(P)H-ubiquinone oxid...    154   2e-40   Solanum tuberosum [potatoes]
ref|XP_008455351.1|  PREDICTED: external alternative NAD(P)H-ubiq...    154   2e-40   Cucumis melo [Oriental melon]
gb|KHG23704.1|  putative NADH-ubiquinone oxidoreductase C3A11.07,...    153   3e-40   Gossypium arboreum [tree cotton]
ref|XP_008803855.1|  PREDICTED: external alternative NAD(P)H-ubiq...    154   3e-40   
gb|EYU24870.1|  hypothetical protein MIMGU_mgv1a003501mg                152   7e-40   Erythranthe guttata [common monkey flower]
ref|XP_004248145.1|  PREDICTED: external alternative NAD(P)H-ubiq...    152   7e-40   Solanum lycopersicum
ref|XP_011085370.1|  PREDICTED: external alternative NAD(P)H-ubiq...    152   7e-40   Sesamum indicum [beniseed]
ref|XP_010905569.1|  PREDICTED: external alternative NAD(P)H-ubiq...    152   1e-39   Elaeis guineensis
gb|KJB69423.1|  hypothetical protein B456_011G023000                    152   1e-39   Gossypium raimondii
ref|XP_010227355.1|  PREDICTED: external alternative NAD(P)H-ubiq...    152   1e-39   
ref|XP_009397153.1|  PREDICTED: external alternative NAD(P)H-ubiq...    152   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800394.1|  PREDICTED: external alternative NAD(P)H-ubiq...    152   1e-39   Phoenix dactylifera
ref|XP_009629691.1|  PREDICTED: external alternative NAD(P)H-ubiq...    152   2e-39   Nicotiana tomentosiformis
ref|XP_003563438.1|  PREDICTED: external alternative NAD(P)H-ubiq...    151   2e-39   Brachypodium distachyon [annual false brome]
ref|XP_007132630.1|  hypothetical protein PHAVU_011G111300g             151   2e-39   Phaseolus vulgaris [French bean]
gb|KEH29605.1|  NAD(P)H dehydrogenase B2                                151   2e-39   Medicago truncatula
gb|KEH29604.1|  NAD(P)H dehydrogenase B2                                151   2e-39   Medicago truncatula
ref|XP_011085371.1|  PREDICTED: external alternative NAD(P)H-ubiq...    151   3e-39   
ref|XP_010540864.1|  PREDICTED: external alternative NAD(P)H-ubiq...    150   3e-39   
gb|KDO55770.1|  hypothetical protein CISIN_1g0458263mg                  149   3e-39   Citrus sinensis [apfelsine]
ref|XP_006409015.1|  hypothetical protein EUTSA_v10001939mg             150   4e-39   Eutrema salsugineum [saltwater cress]
dbj|BAJ85439.1|  predicted protein                                      150   4e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93943.1|  predicted protein                                      150   4e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03005.1|  predicted protein                                      150   4e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02312.1|  predicted protein                                      150   4e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003539893.1|  PREDICTED: external alternative NAD(P)H-ubiq...    150   4e-39   
ref|XP_010035669.1|  PREDICTED: external alternative NAD(P)H-ubiq...    150   5e-39   Eucalyptus grandis [rose gum]
gb|EMT19151.1|  Putative NADH-ubiquinone oxidoreductase C3A11.07,...    150   6e-39   
tpg|DAA57351.1|  TPA: hypothetical protein ZEAMMB73_528090              145   8e-39   
ref|XP_006357529.1|  PREDICTED: external alternative NAD(P)H-ubiq...    150   8e-39   Solanum tuberosum [potatoes]
gb|KHN22897.1|  External NADH-ubiquinone oxidoreductase 1, mitoch...    150   8e-39   Glycine soja [wild soybean]
ref|XP_007214667.1|  hypothetical protein PRUPE_ppa003286mg             149   8e-39   Prunus persica
ref|XP_010234301.1|  PREDICTED: external alternative NAD(P)H-ubiq...    149   1e-38   Brachypodium distachyon [annual false brome]
ref|XP_002867844.1|  pyridine nucleotide-disulfide oxidoreductase...    149   1e-38   
ref|XP_004243316.1|  PREDICTED: external alternative NAD(P)H-ubiq...    149   2e-38   Solanum lycopersicum
ref|XP_009629693.1|  PREDICTED: external alternative NAD(P)H-ubiq...    148   2e-38   
ref|XP_004507221.1|  PREDICTED: NAD(P)H dehydrogenase B1, mitocho...    148   2e-38   Cicer arietinum [garbanzo]
gb|KDO55768.1|  hypothetical protein CISIN_1g041537mg                   148   2e-38   Citrus sinensis [apfelsine]
gb|KHG19479.1|  External NADH-ubiquinone oxidoreductase 1, mitoch...    148   2e-38   Gossypium arboreum [tree cotton]
ref|XP_009629692.1|  PREDICTED: external alternative NAD(P)H-ubiq...    147   4e-38   Nicotiana tomentosiformis
ref|XP_009595715.1|  PREDICTED: external alternative NAD(P)H-ubiq...    147   5e-38   Nicotiana tomentosiformis
ref|XP_009761586.1|  PREDICTED: external alternative NAD(P)H-ubiq...    147   7e-38   Nicotiana sylvestris
emb|CDY38082.1|  BnaC02g06910D                                          145   2e-37   Brassica napus [oilseed rape]
gb|EMS47178.1|  putative NADH-ubiquinone oxidoreductase C3A11.07,...    145   2e-37   Triticum urartu
ref|NP_001058394.1|  Os06g0684000                                       145   2e-37   
tpg|DAA57352.1|  TPA: hypothetical protein ZEAMMB73_528090              145   3e-37   
ref|NP_001142169.1|  uncharacterized protein LOC100274336               145   3e-37   Zea mays [maize]
ref|XP_008648930.1|  PREDICTED: external alternative NAD(P)H-ubiq...    145   3e-37   Zea mays [maize]
emb|CDX70722.1|  BnaC03g08060D                                          145   4e-37   
ref|XP_004970191.1|  PREDICTED: NAD(P)H dehydrogenase B3, mitocho...    145   4e-37   Setaria italica
gb|KGN46685.1|  hypothetical protein Csa_6G124000                       144   6e-37   Cucumis sativus [cucumbers]
dbj|BAD11592.1|  putative NADH dehydrogenase                            142   6e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CDX85484.1|  BnaA02g03290D                                          144   6e-37   
emb|CDX78714.1|  BnaA03g06260D                                          144   9e-37   
ref|XP_009131566.1|  PREDICTED: external alternative NAD(P)H-ubiq...    144   9e-37   Brassica rapa
ref|XP_009761590.1|  PREDICTED: external alternative NAD(P)H-ubiq...    143   1e-36   Nicotiana sylvestris
ref|XP_009761589.1|  PREDICTED: external alternative NAD(P)H-ubiq...    143   1e-36   Nicotiana sylvestris
ref|XP_010467369.1|  PREDICTED: external alternative NAD(P)H-ubiq...    143   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002438881.1|  hypothetical protein SORBIDRAFT_10g027690          143   1e-36   Sorghum bicolor [broomcorn]
ref|XP_010467370.1|  PREDICTED: external alternative NAD(P)H-ubiq...    143   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010516730.1|  PREDICTED: external alternative NAD(P)H-ubiq...    142   3e-36   Camelina sativa [gold-of-pleasure]
gb|EMT14300.1|  Putative NADH-ubiquinone oxidoreductase C3A11.07,...    143   3e-36   
gb|EAZ05553.1|  hypothetical protein OsI_27768                          142   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_006297302.1|  hypothetical protein CARUB_v10013317mg             142   4e-36   Capsella rubella
gb|EMS46851.1|  putative NADH-ubiquinone oxidoreductase C3A11.07,...    142   5e-36   Triticum urartu
ref|XP_006657263.1|  PREDICTED: external alternative NAD(P)H-ubiq...    144   5e-36   
ref|XP_006841824.1|  hypothetical protein AMTR_s00003p00269890          141   6e-36   
gb|EPS65039.1|  hypothetical protein M569_09737                         140   1e-35   Genlisea aurea
gb|EMS55962.1|  External NADH-ubiquinone oxidoreductase 1, mitoch...    140   1e-35   Triticum urartu
ref|XP_008657168.1|  PREDICTED: external alternative NAD(P)H-ubiq...    140   2e-35   Zea mays [maize]
gb|EMT01831.1|  External NADH-ubiquinone oxidoreductase 1, mitoch...    140   2e-35   
ref|XP_004966264.1|  PREDICTED: NAD(P)H dehydrogenase B1, mitocho...    140   3e-35   
ref|XP_010906380.1|  PREDICTED: external alternative NAD(P)H-ubiq...    139   3e-35   Elaeis guineensis
ref|XP_006654264.1|  PREDICTED: external alternative NAD(P)H-ubiq...    139   4e-35   Oryza brachyantha
emb|CDM84453.1|  unnamed protein product                                139   4e-35   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99151.1|  predicted protein                                      139   5e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002456448.1|  hypothetical protein SORBIDRAFT_03g036480          138   8e-35   Sorghum bicolor [broomcorn]
ref|XP_002886305.1|  NDB4 H dehydrogenase B4                            138   9e-35   Arabidopsis lyrata subsp. lyrata
gb|EPS60856.1|  hypothetical protein M569_13947                         131   1e-34   Genlisea aurea
ref|NP_179673.1|  NAD(P)H dehydrogenase B4                              138   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001055220.1|  Os05g0331200                                       137   2e-34   
ref|XP_006841827.1|  hypothetical protein AMTR_s00003p00270010          136   3e-34   
ref|XP_004972878.1|  PREDICTED: NAD(P)H dehydrogenase B2, mitocho...    136   4e-34   Setaria italica
ref|XP_006659819.1|  PREDICTED: external alternative NAD(P)H-ubiq...    138   4e-34   
ref|XP_003564358.1|  PREDICTED: external alternative NAD(P)H-ubiq...    136   6e-34   Brachypodium distachyon [annual false brome]
emb|CAN59740.1|  hypothetical protein VITISV_027064                     135   1e-33   Vitis vinifera
ref|XP_010906379.1|  PREDICTED: external alternative NAD(P)H-ubiq...    134   3e-33   Elaeis guineensis
gb|KFK40454.1|  hypothetical protein AALP_AA3G375100                    134   3e-33   Arabis alpina [alpine rockcress]
ref|XP_010906377.1|  PREDICTED: external alternative NAD(P)H-ubiq...    134   3e-33   Elaeis guineensis
ref|XP_010906376.1|  PREDICTED: external alternative NAD(P)H-ubiq...    134   3e-33   Elaeis guineensis
ref|XP_002869514.1|  hypothetical protein ARALYDRAFT_913700             133   7e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_008648932.1|  PREDICTED: external alternative NAD(P)H-ubiq...    132   9e-33   Zea mays [maize]
ref|XP_002445027.1|  hypothetical protein SORBIDRAFT_07g003070          132   9e-33   Sorghum bicolor [broomcorn]
gb|KHG19478.1|  External NADH-ubiquinone oxidoreductase 1, mitoch...    132   1e-32   Gossypium arboreum [tree cotton]
ref|NP_001143083.1|  uncharacterized protein LOC100275557               132   1e-32   Zea mays [maize]
gb|AFW61257.1|  hypothetical protein ZEAMMB73_607293                    132   1e-32   
ref|XP_001764062.1|  predicted protein                                  131   3e-32   
ref|XP_009126338.1|  PREDICTED: LOW QUALITY PROTEIN: external alt...    130   9e-32   
gb|EPS68710.1|  hypothetical protein M569_06057                         128   2e-31   Genlisea aurea
ref|XP_001766162.1|  predicted protein                                  127   5e-31   
ref|NP_567801.1|  NAD(P)H dehydrogenase B1                              126   2e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CAB79624.1|  putative NADH dehydrogenase                            126   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KFK40453.1|  hypothetical protein AALP_AA3G375000                    124   1e-29   Arabis alpina [alpine rockcress]
ref|XP_009137770.1|  PREDICTED: external alternative NAD(P)H-ubiq...    122   4e-29   Brassica rapa
ref|XP_006412982.1|  hypothetical protein EUTSA_v10024784mg             122   4e-29   Eutrema salsugineum [saltwater cress]
emb|CDY29891.1|  BnaA03g49120D                                          122   4e-29   Brassica napus [oilseed rape]
emb|CDY58724.1|  BnaC07g50650D                                          122   4e-29   Brassica napus [oilseed rape]
ref|XP_006285684.1|  hypothetical protein CARUB_v10007154mg             122   4e-29   Capsella rubella
ref|XP_001759207.1|  predicted protein                                  123   6e-29   
gb|AAM63256.1|  putative NADH dehydrogenase                             122   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438493.1|  PREDICTED: external alternative NAD(P)H-ubiq...    121   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010448013.1|  PREDICTED: external alternative NAD(P)H-ubiq...    121   1e-28   Camelina sativa [gold-of-pleasure]
gb|KIX08768.1|  hypothetical protein Z518_03425                         120   2e-28   Rhinocladiella mackenziei CBS 650.93
gb|ACR38315.1|  unknown                                                 114   4e-28   Zea mays [maize]
ref|XP_002977754.1|  hypothetical protein SELMODRAFT_107483             119   6e-28   
ref|XP_007732992.1|  NADH dehydrogenase                                 119   7e-28   Capronia epimyces CBS 606.96
gb|KIV87881.1|  hypothetical protein PV11_03399                         117   3e-27   Exophiala sideris
ref|XP_007728332.1|  NADH dehydrogenase                                 117   4e-27   Capronia coronata CBS 617.96
gb|KFK42260.1|  hypothetical protein AALP_AA2G232200                    112   5e-27   Arabis alpina [alpine rockcress]
ref|XP_009153730.1|  NADH dehydrogenase                                 117   5e-27   Exophiala dermatitidis NIH/UT8656
gb|KIW33172.1|  hypothetical protein PV07_00043                         117   6e-27   Cladophialophora immunda
gb|KIW86532.1|  hypothetical protein Z517_01930                         117   7e-27   Fonsecaea pedrosoi CBS 271.37
ref|XP_010906378.1|  PREDICTED: external alternative NAD(P)H-ubiq...    115   1e-26   
ref|XP_007749656.1|  NADH dehydrogenase                                 115   2e-26   Cladophialophora psammophila CBS 110553
gb|KIX92396.1|  hypothetical protein Z520_11871                         115   2e-26   Fonsecaea multimorphosa CBS 102226
gb|KIW87847.1|  hypothetical protein Z519_11431                         115   2e-26   Cladophialophora bantiana CBS 173.52
gb|KIW59825.1|  hypothetical protein PV05_00091                         114   5e-26   Exophiala xenobiotica
gb|KIV93533.1|  hypothetical protein PV10_04743                         114   6e-26   Exophiala mesophila
gb|EHL02758.1|  putative NADH-ubiquinone oxidoreductase C3A11.07,...    112   9e-26   Glarea lozoyensis 74030
gb|KIW21583.1|  hypothetical protein PV08_02163                         113   1e-25   Exophiala spinifera
gb|KEQ73946.1|  external NADH-ubiquinone oxidoreductase-like protein    113   1e-25   Aureobasidium namibiae CBS 147.97
ref|XP_008087376.1|  FAD/NAD(P)-binding protein                         113   1e-25   Glarea lozoyensis ATCC 20868
ref|XP_007761259.1|  NADH dehydrogenase                                 113   2e-25   Cladophialophora yegresii CBS 114405
gb|EME47391.1|  hypothetical protein DOTSEDRAFT_122942                  112   2e-25   
ref|XP_001801004.1|  hypothetical protein SNOG_10743                    112   2e-25   
ref|XP_008022348.1|  hypothetical protein SETTUDRAFT_146439             112   2e-25   
gb|KIW37277.1|  hypothetical protein PV06_10619                         112   3e-25   
ref|XP_007682354.1|  hypothetical protein COCMIDRAFT_31639              112   4e-25   
gb|EMD90715.1|  hypothetical protein COCHEDRAFT_1179822                 111   4e-25   
gb|KEF53465.1|  NADH dehydrogenase                                      112   4e-25   
ref|XP_007705202.1|  hypothetical protein COCSADRAFT_31149              111   4e-25   
ref|XP_007715269.1|  hypothetical protein COCCADRAFT_103981             111   7e-25   
gb|KEQ84503.1|  FAD/NAD(P)-binding domain-containing protein            110   9e-25   
ref|XP_003299290.1|  hypothetical protein PTT_10249                     110   9e-25   
dbj|GAM84907.1|  hypothetical protein ANO11243_029090                   110   1e-24   
ref|XP_001940280.1|  external NADH-ubiquinone oxidoreductase 1, m...    110   1e-24   
ref|XP_003842106.1|  similar to external NADH-ubiquinone oxidored...    110   1e-24   
ref|XP_007582829.1|  putative alternative nadh-dehydrogenase protein    110   1e-24   
gb|KIW64758.1|  hypothetical protein PV04_09668                         110   1e-24   
gb|KEQ64787.1|  external NADH-ubiquinone oxidoreductase-like protein    110   2e-24   
ref|XP_008730575.1|  hypothetical protein G647_08041                    109   2e-24   
gb|KIW03486.1|  hypothetical protein PV09_05253                         109   3e-24   
ref|XP_007289045.1|  NADH-ubiquinone oxidoreductase C3A11.07            109   3e-24   
ref|XP_007802614.1|  External alternative NADH-ubiquinone oxidore...    109   3e-24   
ref|XP_003855640.1|  hypothetical protein MYCGRDRAFT_107974             108   4e-24   
dbj|GAA97164.1|  hypothetical protein E5Q_03840                         110   4e-24   
gb|EEH21181.1|  hypothetical protein PABG_03412                         108   6e-24   
gb|EQB48144.1|  hypothetical protein CGLO_12648                         108   6e-24   
ref|XP_010757146.1|  hypothetical protein PADG_01982                    108   6e-24   
ref|XP_007280707.1|  alternative nadh-dehydrogenase                     108   6e-24   
gb|KIN04909.1|  hypothetical protein OIDMADRAFT_101786                  108   7e-24   
ref|XP_007792958.1|  putative alternative nadh-dehydrogenase protein    107   7e-24   
ref|XP_007923550.1|  hypothetical protein MYCFIDRAFT_88293              107   7e-24   
dbj|GAD95091.1|  alternative NADH-dehydrogenase                         108   8e-24   
gb|EER37394.1|  alternative NADH-dehydrogenase                          105   9e-24   
ref|XP_007674816.1|  hypothetical protein BAUCODRAFT_408622             108   9e-24   
ref|XP_001386827.1|  NADH dehydrogenase                                 107   1e-23   
ref|XP_002380323.1|  alternative NADH-dehydrogenase                     107   1e-23   
dbj|GAA88410.1|  alternative NADH-dehydrogenase                         107   1e-23   
ref|XP_008712901.1|  hypothetical protein HMPREF1541_10008              107   1e-23   
ref|XP_505856.1|  YALI0F25135p                                          107   1e-23   
ref|XP_001818887.2|  NADH-ubiquinone oxidoreductase C3A11.07            107   2e-23   
gb|EPQ63020.1|  NADH dehydrogenase                                      107   2e-23   
ref|XP_011117467.1|  hypothetical protein AOL_s00004g516                107   2e-23   
gb|EIT83429.1|  NADH-dehydrogenase                                      107   2e-23   
dbj|BAE56885.1|  unnamed protein product                                107   2e-23   
emb|CCU75142.1|  external NADH-ubiquinone oxidoreductase 1,mitoch...    107   2e-23   
gb|KEQ94477.1|  hypothetical protein AUEXF2481DRAFT_30450               107   2e-23   
gb|EKG20678.1|  hypothetical protein MPH_02033                          107   2e-23   
emb|CCC08390.1|  unnamed protein product                                107   2e-23   
ref|XP_959008.1|  alternative NADH-dehydrogenase                        107   2e-23   
gb|KEY79590.1|  alternative NADH dehydrogenase                          107   2e-23   
ref|XP_002623361.1|  alternative NADH-dehydrogenase                     107   2e-23   
ref|XP_001264565.1|  alternative NADH-dehydrogenase                     107   2e-23   
gb|EQL36701.1|  NADH dehydrogenase                                      107   2e-23   
gb|EGE78963.1|  alternative NADH-dehydrogenase                          107   2e-23   
ref|XP_752562.1|  alternative NADH-dehydrogenase                        107   2e-23   
ref|XP_001269074.1|  alternative NADH-dehydrogenase                     107   2e-23   
ref|XP_009851271.1|  hypothetical protein NEUTE1DRAFT_122492            107   2e-23   
gb|EPS25815.1|  hypothetical protein PDE_00751                          107   2e-23   
gb|KFH43960.1|  External alternative NADH-ubiquinone oxidoreducta...    107   2e-23   
gb|EWC48605.1|  mitochondrial external alternative NADH-ubiquinon...    107   3e-23   
gb|EEH03668.1|  alternative NADH-dehydrogenase                          106   3e-23   
gb|EMR90677.1|  putative external nadh-ubiquinone oxidoreductase ...    106   3e-23   
ref|XP_002795484.1|  external NADH-ubiquinone oxidoreductase            106   3e-23   
gb|EKV06761.1|  Alternative NADH-dehydrogenase                          106   3e-23   
ref|XP_007003977.1|  hypothetical protein TREMEDRAFT_43521              106   3e-23   
ref|XP_001553952.1|  hypothetical protein BC1G_07512                    106   3e-23   
gb|KGO70465.1|  FAD-dependent pyridine nucleotide-disulfide oxido...    106   3e-23   
gb|KGO42235.1|  FAD-dependent pyridine nucleotide-disulfide oxido...    106   3e-23   
ref|XP_003175812.1|  external NADH-ubiquinone oxidoreductase 1          106   3e-23   
emb|CDM34129.1|  Probable NADH-ubiquinone oxidoreductase C3A11.07...    106   3e-23   
ref|XP_001544258.1|  hypothetical protein HCAG_01305                    107   3e-23   
ref|XP_003717314.1|  hypothetical protein MGG_06276                     106   3e-23   
ref|XP_001210480.1|  hypothetical protein ATEG_00394                    106   3e-23   
ref|XP_002149337.1|  alternative NADH-dehydrogenase                     106   3e-23   
emb|CAE47920.1|  pyridine nucleotide-disulphide oxidoreductase fa...    107   3e-23   
ref|XP_001392541.2|  NADH-ubiquinone oxidoreductase C3A11.07            106   4e-23   
emb|CAK39927.1|  unnamed protein product                                106   4e-23   
ref|XP_002484822.1|  alternative NADH-dehydrogenase                     106   4e-23   
gb|EDK38335.2|  hypothetical protein PGUG_02433                         106   4e-23   
ref|XP_007591285.1|  hypothetical protein CFIO01_13464                  106   4e-23   
emb|CCF33169.1|  hypothetical protein CH063_05416                       106   5e-23   
gb|EPB86786.1|  NADH dehydrogenase                                      105   5e-23   
gb|EMF15232.1|  FAD/NAD(P)-binding domain-containing protein            105   6e-23   
ref|XP_007779327.1|  NADH dehydrogenase                                 105   6e-23   
gb|KGQ88580.1|  NADH dehydrogenase                                      105   6e-23   
gb|KHC63485.1|  NADH dehydrogenase                                      105   6e-23   
dbj|GAN07750.1|  NDE2 mitochondrial exteRNAl NADH dehydrogenase         105   6e-23   
ref|XP_001595102.1|  hypothetical protein SS1G_03190                    105   7e-23   
gb|EFQ25283.1|  hypothetical protein GLRG_00427                         105   7e-23   
gb|KGR10346.1|  NADH dehydrogenase                                      105   7e-23   
dbj|GAN08042.1|  FAD/NAD(P)-binding domain-containing protein           104   7e-23   
ref|XP_002558326.1|  Pc12g15240                                         105   7e-23   
gb|KGR06479.1|  NADH dehydrogenase                                      105   7e-23   
gb|KGQ84331.1|  NADH dehydrogenase                                      105   7e-23   
ref|XP_011112798.1|  hypothetical protein H072_7025                     105   7e-23   
ref|XP_007410304.1|  hypothetical protein MELLADRAFT_43514              105   8e-23   
gb|EIE81511.1|  hypothetical protein RO3G_06216                         103   8e-23   
ref|XP_009225696.1|  hypothetical protein GGTG_09580                    105   9e-23   
ref|XP_002421074.1|  external NADH-ubiquinone oxidoreductase, mit...    104   9e-23   
ref|XP_002848226.1|  alternative NADH-dehydrogenase                     105   9e-23   
gb|EPB85386.1|  NADH dehydrogenase                                      104   9e-23   
gb|EYE95446.1|  NADH dehydrogenase                                      105   1e-22   
ref|XP_001907894.1|  hypothetical protein                               105   1e-22   
gb|KDN61958.1|  hypothetical protein CSUB01_05179                       104   1e-22   
emb|CDS09556.1|  Putative NADH dehydrogenase                            104   1e-22   
gb|EDK40505.2|  hypothetical protein PGUG_04603                         105   1e-22   
gb|EEQ46660.1|  conserved hypothetical protein                          105   1e-22   
ref|XP_002615374.1|  hypothetical protein CLUG_04257                    104   1e-22   
gb|KGU04294.1|  NADH dehydrogenase                                      105   1e-22   
gb|KGQ86217.1|  NADH dehydrogenase                                      105   1e-22   
ref|XP_718052.1|  potential mitochondrial nonproton-pumping NADH ...    105   1e-22   
gb|KGR05086.1|  NADH dehydrogenase                                      105   1e-22   
gb|KHC70936.1|  NADH dehydrogenase                                      105   1e-22   
gb|KGU25232.1|  NADH dehydrogenase                                      105   1e-22   
emb|CCX05456.1|  Similar to External alternative NADH-ubiquinone ...    104   2e-22   
ref|XP_003018936.1|  pyridine nucleotide-disulfide oxidoreductase...    104   2e-22   
ref|XP_001484704.1|  hypothetical protein PGUG_02433                    104   2e-22   
emb|CDH57967.1|  nadh dehydrogenase                                     104   2e-22   
gb|EIE76083.1|  hypothetical protein RO3G_00787                         103   2e-22   
ref|XP_003010415.1|  pyridine nucleotide-disulphide oxidoreductas...    104   2e-22   
gb|ENH86499.1|  alternative nadh-dehydrogenase                          104   2e-22   
gb|EFW13189.1|  hypothetical protein CPSG_10212                         104   2e-22   
ref|XP_002543820.1|  hypothetical protein UREG_03337                    103   2e-22   
ref|XP_003067039.1|  external NADH-ubiquinone oxidoreductase 1, m...    104   2e-22   
ref|XP_001239430.1|  hypothetical protein CIMG_09051                    103   2e-22   
gb|EGD97648.1|  alternative NADH-dehydrogenase                          104   2e-22   
gb|EZF29105.1|  hypothetical protein H101_07211                         104   2e-22   
gb|EGC48001.1|  alternative NADH-dehydrogenase                          103   2e-22   
gb|KFH63522.1|  NADH dehydrogenase                                      103   2e-22   
ref|XP_003663079.1|  hypothetical protein MYCTH_2304512                 103   3e-22   
gb|ESZ98346.1|  hypothetical protein SBOR_1224                          104   3e-22   
ref|XP_658698.1|  hypothetical protein AN1094.2                         103   3e-22   
ref|XP_006684391.1|  FAD/NAD(P)-binding domain-containing protein       103   3e-22   
ref|XP_011102990.1|  nde1p                                              103   3e-22   
ref|XP_003389527.1|  PREDICTED: external alternative NAD(P)H-ubiq...    103   3e-22   
gb|KID92600.1|  alternative NADH-dehydrogenase                          103   3e-22   
ref|XP_006693176.1|  hypothetical protein CTHT_0027180                  103   3e-22   
ref|XP_003234576.1|  alternative NADH-dehydrogenase                     103   4e-22   
gb|EZF42548.1|  hypothetical protein H102_03835                         103   4e-22   
gb|EZF74152.1|  hypothetical protein H105_03863                         103   4e-22   
emb|CEP07287.1|  hypothetical protein                                   103   4e-22   
gb|EZF74153.1|  hypothetical protein H105_03863                         103   4e-22   
gb|KDN43963.1|  FAD/NAD(P)-binding domain-containing protein            103   4e-22   
dbj|GAM33359.1|  NADH dehydrogenase                                     103   4e-22   
ref|XP_002841654.1|  hypothetical protein                               103   5e-22   
ref|XP_001483874.1|  hypothetical protein PGUG_04603                    103   5e-22   
ref|XP_001229543.1|  hypothetical protein CHGG_03027                    103   5e-22   
gb|EIE84759.1|  hypothetical protein RO3G_09469                         101   6e-22   
ref|XP_007912486.1|  putative external nadh-ubiquinone oxidoreduc...    102   6e-22   
ref|XP_007807995.1|  hypothetical protein MAC_01655                     102   7e-22   
emb|CEG76861.1|  Putative NADH dehydrogenase                            102   7e-22   
gb|KEY68983.1|  hypothetical protein S7711_03290                        102   7e-22   
gb|KFA64574.1|  hypothetical protein S40285_04566                       102   8e-22   
emb|CEI95363.1|  Putative NADH dehydrogenase                            102   8e-22   
gb|KFA52877.1|  hypothetical protein S40293_00834                       102   8e-22   
ref|XP_003958023.1|  hypothetical protein KAFR_0F02920                  102   8e-22   
gb|AJS62883.1|  Nde1p                                                   102   8e-22   
emb|CEG70339.1|  Putative NADH dehydrogenase                            102   8e-22   
emb|CEJ02176.1|  Putative NADH dehydrogenase                            102   9e-22   
gb|KEZ45304.1|  External alternative NADH-ubiquinone oxidoreducta...    102   9e-22   
gb|ESW96155.1|  External NADH-ubiquinone oxidoreductase 1, mitoch...    102   1e-21   
gb|EHN00860.1|  Nde1p                                                   102   1e-21   
emb|CEJ90596.1|  Putative FAD/NAD(P)-binding domain-containing pr...    102   1e-21   
emb|CEP15370.1|  hypothetical protein                                   101   1e-21   
ref|XP_006674634.1|  alternative NADH-dehydrogenase                     102   1e-21   
gb|KIE01571.1|  alternative NADH-dehydrogenase                          102   1e-21   
dbj|GAC94532.1|  potential mitochondrial NADH dehydrogenase             102   1e-21   
ref|XP_011273472.1|  External NADH-ubiquinone oxidoreductase 1,mi...    101   1e-21   
dbj|BAK05629.1|  predicted protein                                      101   1e-21   
gb|KFY14476.1|  hypothetical protein V491_06037                       99.8    2e-21   
gb|KFY16475.1|  hypothetical protein V491_05332                       99.8    2e-21   
gb|KFG82453.1|  hypothetical protein MANI_117794                        101   2e-21   
emb|CCJ28803.1|  unnamed protein product                                100   2e-21   
gb|KID78374.1|  alternative NADH-dehydrogenase                          101   2e-21   
gb|KHO01168.1|  Pyridine nucleotide-disulfide oxidoreductase, FAD...    101   2e-21   
ref|XP_007818677.2|  alternative NADH-dehydrogenase                     101   2e-21   
emb|CCO33859.1|  NADH dehydrogenase                                   97.8    2e-21   
gb|AJS63754.1|  Nde1p                                                   101   2e-21   
gb|KHJ34491.1|  putative fad nad -binding protein                       101   2e-21   
gb|AJS85577.1|  Nde1p                                                   101   2e-21   
gb|EEU07031.1|  Nde1p                                                   101   2e-21   
gb|AJS95601.1|  Nde1p                                                   101   2e-21   
ref|NP_013865.1|  NADH-ubiquinone reductase (H(+)-translocating) ...    101   2e-21   
gb|AJS72061.1|  Nde1p                                                   101   2e-21   
gb|AFR92919.2|  NADH dehydrogenase                                      101   2e-21   
gb|AJS86887.1|  Nde1p                                                   101   2e-21   
gb|AJS64192.1|  Nde1p                                                   101   2e-21   
gb|KIR45230.1|  NADH dehydrogenase                                      101   2e-21   
gb|EIF49278.1|  nadh dehydrogenase                                    99.0    2e-21   
gb|EGA57307.1|  Nde1p                                                   101   2e-21   
gb|AJS99080.1|  Nde1p                                                   101   2e-21   
emb|CCE40240.1|  hypothetical protein CPAR2_102780                      101   2e-21   
ref|XP_567114.1|  NADH dehydrogenase                                    101   2e-21   
emb|CCF52274.1|  probable NDE1-mitochondrial cytosolically direct...    101   3e-21   
emb|CCE27541.1|  probable NDE1-mitochondrial cytosolically direct...    101   3e-21   
ref|XP_458790.2|  DEHA2D07568p                                          100   3e-21   
gb|EWG89421.1|  Nde1p                                                   101   3e-21   
gb|KGB75306.1|  NADH dehydrogenase                                      100   3e-21   
ref|XP_007832349.1|  External alternative NADH-ubiquinone oxidore...    100   3e-21   
emb|CDI53242.1|  probable NDE1-mitochondrial cytosolically direct...    100   3e-21   
gb|ELR05254.1|  NADH dehydrogenase                                      100   3e-21   
gb|EST04775.1|  NADH-dehydrogenase                                      100   3e-21   
gb|KFZ06017.1|  hypothetical protein V501_07803                         100   4e-21   
gb|KFY71679.1|  hypothetical protein V499_08142                         100   4e-21   
ref|XP_007306837.1|  FAD/NAD-P-binding domain-containing protein        100   4e-21   
emb|CDH08550.1|  probable Rotenone-insensitive NADH-ubiquinone ox...    100   4e-21   
gb|EFX03867.1|  alternative NADH-dehydrogenase                          100   4e-21   
gb|KFZ15037.1|  hypothetical protein V502_05796                         100   4e-21   
emb|CDF89582.1|  ZYBA0S04-07734g1_1                                     100   4e-21   
gb|KIR83806.1|  NADH dehydrogenase                                      100   5e-21   
ref|XP_003191806.1|  NADH dehydrogenase                                 100   5e-21   
gb|KIR51517.1|  NADH dehydrogenase                                      100   5e-21   
ref|XP_011388517.1|  putative NADH-ubiquinone reductase (H(+)-tra...    100   5e-21   
gb|KJE02650.1|  NADH dehydrogenase                                      100   5e-21   
gb|KIL86728.1|  hypothetical protein FAVG1_09984                        100   5e-21   
gb|KGQ04713.1|  External alternative NADH-ubiquinone oxidoreductase     100   6e-21   
gb|KFY53677.1|  hypothetical protein V496_07413                         100   6e-21   
ref|XP_008597080.1|  NADH dehydrogenase                                 100   6e-21   
gb|KFY96123.1|  hypothetical protein V500_02571                       99.8    7e-21   
emb|CCG81647.1|  Alternative NADH-dehydrogenase                       99.8    7e-21   
ref|XP_007869988.1|  FAD/NAD P-binding domain-containing protein      99.8    7e-21   
ref|XP_004204928.1|  Piso0_000215                                     99.8    7e-21   



>ref|XP_009603008.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Nicotiana tomentosiformis]
Length=584

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++RF+RTFR+NPSLSKLLIVFTVSGG LVAYSEA K +E+ N G+L E N++KK+VVVLG
Sbjct  7    IERFSRTFRDNPSLSKLLIVFTVSGGGLVAYSEAAKSYENPNSGELVEANNRKKKVVVLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNIIRKK+V
Sbjct  67   TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVESRSVVEPIRNIIRKKHV  126

Query  527  DMQYCEAECIKID  565
            D  Y EAEC+KID
Sbjct  127  DAYYWEAECVKID  139



>ref|XP_009777442.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Nicotiana sylvestris]
Length=584

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++RF++TFR+NPSLSKLLIVFTVSGG LVAYSEA K +E+ N G+L E N++KK+VVVLG
Sbjct  7    IERFSKTFRDNPSLSKLLIVFTVSGGGLVAYSEAAKSYENPNAGELVEANNRKKKVVVLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNIIRKK+V
Sbjct  67   TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVESRSVVEPIRNIIRKKHV  126

Query  527  DMQYCEAECIKID  565
            D  Y EAEC+KID
Sbjct  127  DAYYWEAECVKID  139



>ref|XP_004232796.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Solanum lycopersicum]
Length=584

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++RF++TFR+NPSLSKLLIVFTVSGG LVAYSEA K ++++N G L E N++KK+VVVLG
Sbjct  7    IERFSKTFRDNPSLSKLLIVFTVSGGGLVAYSEAGKSNDNSNAGALVEANNRKKKVVVLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNIIRK+  
Sbjct  67   TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVESRSVVEPIRNIIRKRYA  126

Query  527  DMQYCEAECIKID  565
            +  Y EAECIKID
Sbjct  127  EAYYWEAECIKID  139



>ref|XP_006347139.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Solanum tuberosum]
Length=584

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++RF++TFR+NPS SKLLIVFTVSGG LVAYSEA K ++++N G+L E N++KK+VVVLG
Sbjct  7    IERFSKTFRDNPSFSKLLIVFTVSGGGLVAYSEAGKSNDNSNAGELVEANNRKKKVVVLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNIIRK+  
Sbjct  67   TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVESRSVVEPIRNIIRKRYA  126

Query  527  DMQYCEAECIKID  565
            +  Y EAECIKID
Sbjct  127  EAYYWEAECIKID  139



>ref|XP_011096201.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Sesamum indicum]
Length=581

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF+ TFRENPSL+KLL+VFTVSGGSL+AYSEA   +E + + + TE + +KKRVVVLG
Sbjct  4    FRRFSTTFRENPSLAKLLVVFTVSGGSLMAYSEAKSENEMH-IVNPTETDSKKKRVVVLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLK+ SYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RKKNV
Sbjct  63   TGWAGTSFLKNLKNSSYDVQVISPRNYFAFTPLLPSVTCGTVEPRSIVEPIRNIVRKKNV  122

Query  527  DMQYCEAECIKIDA  568
             + Y EAEC KIDA
Sbjct  123  AVHYWEAECFKIDA  136



>emb|CDO99637.1| unnamed protein product [Coffea canephora]
Length=585

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGS--LVAYSEATKPHESNNLGDLTEVNHQKKRVVV  340
            ++RF+RTFR+N S SKLL+V  +SGG+  LVAYS+AT P  S+N+ D  E   +KK+VVV
Sbjct  7    LERFSRTFRQNRSTSKLLLVVALSGGTSGLVAYSDAT-PQNSSNIVDSAEPEIKKKKVVV  65

Query  341  LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKK  520
            LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVT GTVE RSIVEPIRNIIRKK
Sbjct  66   LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTSGTVEPRSIVEPIRNIIRKK  125

Query  521  NVDMQYCEAECIKIDA  568
             VD+QY EAEC+KIDA
Sbjct  126  KVDIQYSEAECVKIDA  141



>ref|XP_010057754.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial isoform X2 [Eucalyptus grandis]
Length=580

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 114/134 (85%), Gaps = 3/134 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++RF+R F ++PSLSK++++F VSGG LVAY+EA    ++       E   +KKRVVVLG
Sbjct  7    LERFSRAFHDHPSLSKIVVLFAVSGGGLVAYAEANSGAQAIVP---VEAESKKKRVVVLG  63

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFL+N+K+P+YD+QVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI+RKKN+
Sbjct  64   TGWAGTSFLRNIKNPTYDIQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIVRKKNM  123

Query  527  DMQYCEAECIKIDA  568
            D+++ EAEC+KIDA
Sbjct  124  DIRFLEAECVKIDA  137



>ref|XP_010538314.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010538323.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Tarenaya hassleriana]
Length=582

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +RF+R F ++PSLS++L++ T+SGG L+AYSEA   H + ++  + E   +KK+V++LGT
Sbjct  8    ERFSRAFHDHPSLSRILVISTISGGGLIAYSEANASHGTKDIAPV-ETGTRKKKVLLLGT  66

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKNL +PSY+VQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RKKN+D
Sbjct  67   GWAGTSFLKNLNNPSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGRKKNID  126

Query  530  MQYCEAECIKID  565
            M Y EAEC KID
Sbjct  127  MSYLEAECFKID  138



>gb|KCW75033.1| hypothetical protein EUGRSUZ_E03807 [Eucalyptus grandis]
Length=623

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 114/134 (85%), Gaps = 3/134 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++RF+R F ++PSLSK++++F VSGG LVAY+EA    ++       E   +KKRVVVLG
Sbjct  69   LERFSRAFHDHPSLSKIVVLFAVSGGGLVAYAEANSGAQAIVP---VEAESKKKRVVVLG  125

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFL+N+K+P+YD+QVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI+RKKN+
Sbjct  126  TGWAGTSFLRNIKNPTYDIQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIVRKKNM  185

Query  527  DMQYCEAECIKIDA  568
            D+++ EAEC+KIDA
Sbjct  186  DIRFLEAECVKIDA  199



>gb|KCW75032.1| hypothetical protein EUGRSUZ_E03807 [Eucalyptus grandis]
Length=642

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 114/134 (85%), Gaps = 3/134 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++RF+R F ++PSLSK++++F VSGG LVAY+EA    ++       E   +KKRVVVLG
Sbjct  69   LERFSRAFHDHPSLSKIVVLFAVSGGGLVAYAEANSGAQAIVP---VEAESKKKRVVVLG  125

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFL+N+K+P+YD+QVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI+RKKN+
Sbjct  126  TGWAGTSFLRNIKNPTYDIQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIVRKKNM  185

Query  527  DMQYCEAECIKIDA  568
            D+++ EAEC+KIDA
Sbjct  186  DIRFLEAECVKIDA  199



>ref|XP_011086117.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Sesamum indicum]
 ref|XP_011086118.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Sesamum indicum]
 ref|XP_011086119.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Sesamum indicum]
 ref|XP_011086120.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Sesamum indicum]
Length=577

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 111/134 (83%), Gaps = 2/134 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             QRF R FR NP L ++LIVFTVSGG ++A+SEA +  E+    D +E + +KK+VVVLG
Sbjct  4    FQRFCRIFRVNPWLVRMLIVFTVSGGCVLAFSEAKQ--ENGMTSDSSEADSKKKKVVVLG  61

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG +FLKNLK+PSYDVQVISPRNYFAFTPLLPSVTCGT+E RSI+EP+RNI+RKKNV
Sbjct  62   TGWAGINFLKNLKNPSYDVQVISPRNYFAFTPLLPSVTCGTLEPRSIIEPVRNIVRKKNV  121

Query  527  DMQYCEAECIKIDA  568
            ++ Y EAEC  IDA
Sbjct  122  NIHYWEAECFNIDA  135



>ref|XP_008441960.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Cucumis melo]
Length=584

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R F ++PS+S+LL++ TVSGGSLVAY++A   +   ++     ++ +KK+VVVLGTG
Sbjct  9    RVSRVFHDHPSVSRLLVIVTVSGGSLVAYADAGPTNGVPSIASTANLDEKKKKVVVLGTG  68

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGTSFLKN+KDPSY+VQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIRN++RKK VD+
Sbjct  69   WAGTSFLKNIKDPSYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNLVRKKRVDI  128

Query  533  QYCEAECIKIDA  568
            ++ EAEC KIDA
Sbjct  129  RFNEAECYKIDA  140



>ref|XP_010087909.1| putative NADH-ubiquinone oxidoreductase [Morus notabilis]
 gb|EXB30583.1| putative NADH-ubiquinone oxidoreductase [Morus notabilis]
Length=664

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVV--  340
             QR +R FR+NPSLSKLL+V TVSGG LVAY+EA + +        +EV+   K+  V  
Sbjct  85   FQRVSRVFRDNPSLSKLLVVVTVSGGGLVAYAEANQVNSPQITNSSSEVDFVSKKKKVVV  144

Query  341  LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKK  520
            LGTGWAGTSFL+NLK PSY+VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RKK
Sbjct  145  LGTGWAGTSFLRNLKSPSYEVQVVSPRNYFAFTPLLPSVTCGTVEPRSIVEPIRNIVRKK  204

Query  521  NVDMQYCEAECIKIDA  568
            +VD+Q+CEAECIKIDA
Sbjct  205  SVDVQFCEAECIKIDA  220



>ref|XP_011086124.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Sesamum indicum]
 ref|XP_011086125.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Sesamum indicum]
 ref|XP_011086126.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Sesamum indicum]
Length=580

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF RTFR NP L+++LIVF  SGG ++A+S+     E+    D +E + +KK+VVVLG
Sbjct  4    FRRFCRTFRVNPWLARMLIVFATSGGGVLAFSDVKS--ENGMTFDSSEADSKKKKVVVLG  61

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLKNLK+PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSI EP+RNI+RKKNV
Sbjct  62   TGWAGISFLKNLKNPSYDVQVISPRNYFAFTPLLPSVTCGTVEPRSIAEPVRNIVRKKNV  121

Query  527  DMQYCEAECIKIDA  568
            ++ Y EAEC KIDA
Sbjct  122  NIHYWEAECFKIDA  135



>gb|KDO75712.1| hypothetical protein CISIN_1g007975mg [Citrus sinensis]
Length=485

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R +R F +  SLSKL+++ TV GGSL+AYSEA    ++ ++    E+  +KK+VVVLGT
Sbjct  8    ERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAP-PEMGIKKKKVVVLGT  66

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKNL +PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI+RKKNVD
Sbjct  67   GWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVD  126

Query  530  MQYCEAECIKIDA  568
            + + EAEC KIDA
Sbjct  127  ICFWEAECFKIDA  139



>ref|XP_010057753.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial isoform X1 [Eucalyptus grandis]
Length=581

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 114/135 (84%), Gaps = 4/135 (3%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++RF+R F ++PSLSK++++F VSGG LVAY+EA    ++       E   +KKRVVVLG
Sbjct  7    LERFSRAFHDHPSLSKIVVLFAVSGGGLVAYAEANSGAQAIVP---VEAESKKKRVVVLG  63

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRK-KN  523
            TGWAGTSFL+N+K+P+YD+QVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI+RK KN
Sbjct  64   TGWAGTSFLRNIKNPTYDIQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIVRKQKN  123

Query  524  VDMQYCEAECIKIDA  568
            +D+++ EAEC+KIDA
Sbjct  124  MDIRFLEAECVKIDA  138



>ref|XP_010431858.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Camelina sativa]
Length=584

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++++V T+SGG L+AYSEA   + SN    + E   +KK+VV+LG
Sbjct  7    FERFSKAFQDHPSLTRIIVVSTISGGGLIAYSEANASYGSNGSAAVVETGTKKKKVVLLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RKKNV
Sbjct  67   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGRKKNV  126

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  127  DTSYLEAECFKID  139



>gb|KDO75711.1| hypothetical protein CISIN_1g007975mg [Citrus sinensis]
Length=515

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R +R F +  SLSKL+++ TV GGSL+AYSEA    ++ ++    E+  +KK+VVVLGT
Sbjct  8    ERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAP-PEMGIKKKKVVVLGT  66

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKNL +PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI+RKKNVD
Sbjct  67   GWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVD  126

Query  530  MQYCEAECIKIDA  568
            + + EAEC KIDA
Sbjct  127  ICFWEAECFKIDA  139



>ref|XP_002872730.1| hypothetical protein ARALYDRAFT_911770 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48989.1| hypothetical protein ARALYDRAFT_911770 [Arabidopsis lyrata subsp. 
lyrata]
Length=583

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++L+V T+SGG L+AYSEA   + +N  G + E   +KK+VV+LG
Sbjct  7    FERFSKAFQDHPSLTRILVVSTISGGGLIAYSEANASYGANGAG-IVETGTKKKKVVLLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RKKNV
Sbjct  66   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGRKKNV  125

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  126  DTSYLEAECFKID  138



>gb|KFK32231.1| nad h dehydrogenase b2 [Arabis alpina]
Length=581

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 110/133 (83%), Gaps = 3/133 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RFA+ F+++PSLS++L+V T+SGG ++AYSEA   + +N++    E   +KK+VV+LG
Sbjct  7    FERFAKAFQDSPSLSRILVVSTISGGGVIAYSEANASYGANSV---VETGTKKKKVVLLG  63

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL + SY+VQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RKKNV
Sbjct  64   TGWAGTSFLKNLDNSSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGRKKNV  123

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  124  DTSYLEAECFKID  136



>gb|AAD48975.1|AF162444_7 contains similarity to Pfam family PF00070 - Pyridine nucleotide-disulphide 
oxidoreductase class-I; score=26.1, E=0.0008, 
N=1 [Arabidopsis thaliana]
 emb|CAB81044.1| AT4g05020 [Arabidopsis thaliana]
Length=583

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++L+V T+SGG L+AYSEA   + +N  G + E   +KK+VV+LG
Sbjct  7    FERFSKAFKDHPSLTRILVVSTISGGGLIAYSEANASYGANG-GAVVETGTKKKKVVLLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RKKNV
Sbjct  66   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGRKKNV  125

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  126  DTSYLEAECFKID  138



>gb|EYU43419.1| hypothetical protein MIMGU_mgv1a003457mg [Erythranthe guttata]
Length=584

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             QRF+RTFR+NPSL K+LIVFTVSGG LVAYSEA K     +  + +EV+ +KKRVVVLG
Sbjct  7    FQRFSRTFRDNPSLGKMLIVFTVSGGGLVAYSEA-KADGGIHAVNPSEVDVKKKRVVVLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL + SYDVQVISPRN+FAFTPLLPSVTCGTVE RSIVEPIRNI+RKKNV
Sbjct  66   TGWAGTSFLKNLSNSSYDVQVISPRNFFAFTPLLPSVTCGTVEPRSIVEPIRNIVRKKNV  125

Query  527  DMQYCEAECIKIDA  568
            D+ Y EAEC  IDA
Sbjct  126  DVHYWEAECFNIDA  139



>ref|XP_010538689.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Tarenaya hassleriana]
Length=583

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +RF+R F ++PSLS++L++ T+SGG L+AYSEA   + +N +  + E   +KK+V++LGT
Sbjct  8    ERFSRAFHDHPSLSRILVISTISGGGLIAYSEANASYGTNGVAPV-ETGTRKKKVLLLGT  66

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKNL + SY+VQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI RKK++D
Sbjct  67   GWAGTSFLKNLNNASYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIGRKKSID  126

Query  530  MQYCEAECIKID  565
            M Y EAEC KID
Sbjct  127  MSYLEAECFKID  138



>ref|XP_006467902.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Citrus sinensis]
 gb|KDO75710.1| hypothetical protein CISIN_1g007975mg [Citrus sinensis]
Length=583

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R +R F +  SLSKL+++ TV GGSL+AYSEA    ++ ++    E+  +KK+VVVLGT
Sbjct  8    ERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAP-PEMGIKKKKVVVLGT  66

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKNL +PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI+RKKNVD
Sbjct  67   GWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVD  126

Query  530  MQYCEAECIKIDA  568
            + + EAEC KIDA
Sbjct  127  ICFWEAECFKIDA  139



>ref|XP_006449209.1| hypothetical protein CICLE_v10014723mg [Citrus clementina]
 gb|ESR62449.1| hypothetical protein CICLE_v10014723mg [Citrus clementina]
Length=583

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R +R F +  SLSKL+++ TV GGSL+AYSEA    ++ ++    E+  +KK+VVVLGT
Sbjct  8    ERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAP-PEMGIKKKKVVVLGT  66

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKNL +PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI+RKKNVD
Sbjct  67   GWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVD  126

Query  530  MQYCEAECIKIDA  568
            + + EAEC KIDA
Sbjct  127  ICFWEAECFKIDA  139



>ref|XP_010422373.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Camelina sativa]
Length=583

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++++V T+SGG L+AYSEA   + +     + E+  +KK+VV+LG
Sbjct  7    FERFSKAFQDHPSLTRIIVVSTISGGGLIAYSEANASYGATGSAAVVEIGTKKKKVVLLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RKKNV
Sbjct  67   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGRKKNV  126

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  127  DTSYLEAECFKID  139



>ref|XP_008383824.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Malus domestica]
Length=585

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 112/135 (83%), Gaps = 1/135 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEAT-KPHESNNLGDLTEVNHQKKRVVVL  343
              R ++ F + P  SK+L+V  VSGG  VAY+EAT +P   ++   + +V+++K+++VVL
Sbjct  7    FDRVSKAFHDYPKASKMLVVVAVSGGGYVAYAEATPEPKLISSAPVIDQVDNKKQKIVVL  66

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFL+NLK+P+Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RKKN
Sbjct  67   GTGWAGTSFLRNLKNPNYEVQIISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVRKKN  126

Query  524  VDMQYCEAECIKIDA  568
            VD+Q+ EA C+KIDA
Sbjct  127  VDVQFTEAACLKIDA  141



>ref|XP_010431865.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X2 [Camelina sativa]
Length=583

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++++V T+SGG L+AYSEA   + SN    + E   +KK+VV+LG
Sbjct  7    FERFSKAFQDHPSLTRIIVVSTISGGGLIAYSEANASYGSNGSAAVVETGTKKKKVVLLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV
Sbjct  67   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGR-KNV  125

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  126  DTSYLEAECFKID  138



>ref|XP_009114515.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Brassica rapa]
 emb|CDY16620.1| BnaA09g19980D [Brassica napus]
Length=579

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F++ PSLS++++V T+SGG L+AYSEA      N    + E   +KK+VV+LG
Sbjct  8    FERFSKAFQDYPSLSRIIVVSTISGGGLIAYSEA------NGTNGVVETGTKKKKVVLLG  61

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RKKNV
Sbjct  62   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGRKKNV  121

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  122  DTSYLEAECFKID  134



>ref|NP_567283.1| NAD(P)H dehydrogenase B2 [Arabidopsis thaliana]
 sp|Q94BV7.1|NDB2_ARATH RecName: Full=External alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial; AltName: Full=External alternative 
NADH dehydrogenase NDB2; AltName: Full=NADH:ubiquinone reductase 
(non-electrogenic) NDB2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK63960.1| AT4g05020/T32N4_4 [Arabidopsis thaliana]
 gb|AAN72252.1| At4g05020/T32N4_4 [Arabidopsis thaliana]
 gb|AEE82460.1| NAD(P)H dehydrogenase B2 [Arabidopsis thaliana]
Length=582

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++L+V T+SGG L+AYSEA   + +N  G + E   +KK+VV+LG
Sbjct  7    FERFSKAFKDHPSLTRILVVSTISGGGLIAYSEANASYGANG-GAVVETGTKKKKVVLLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV
Sbjct  66   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGR-KNV  124

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  125  DTSYLEAECFKID  137



>ref|XP_010268847.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=583

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R +R F + PSLSKL+++FTVSGGSLVAYSE +K +   N    + ++ +KKRVVVLGT
Sbjct  8    ERTSRAFHDYPSLSKLIVLFTVSGGSLVAYSE-SKSYNGANSALSSHMDSKKKRVVVLGT  66

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKNL    YDV V+SPRNYFAFTPLLPSVTCG VE RSI+EPIRNI+ KKN D
Sbjct  67   GWAGTSFLKNLDSSLYDVHVVSPRNYFAFTPLLPSVTCGKVEARSIIEPIRNIVSKKNGD  126

Query  530  MQYCEAECIKIDA  568
             ++ EAEC K+DA
Sbjct  127  FRFWEAECTKVDA  139



>ref|XP_010268848.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X2 [Nelumbo nucifera]
Length=579

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R +R F + PSLSKL+++FTVSGGSLVAYSE +K +   N    + ++ +KKRVVVLGT
Sbjct  8    ERTSRAFHDYPSLSKLIVLFTVSGGSLVAYSE-SKSYNGANSALSSHMDSKKKRVVVLGT  66

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKNL    YDV V+SPRNYFAFTPLLPSVTCG VE RSI+EPIRNI+ KKN D
Sbjct  67   GWAGTSFLKNLDSSLYDVHVVSPRNYFAFTPLLPSVTCGKVEARSIIEPIRNIVSKKNGD  126

Query  530  MQYCEAECIKIDA  568
             ++ EAEC K+DA
Sbjct  127  FRFWEAECTKVDA  139



>emb|CDY44749.1| BnaC09g22310D [Brassica napus]
Length=579

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F++ PSLS++++V T+SGG L+AYSEA      N    + E   +KK+VV+LG
Sbjct  8    FERFSKAFQDYPSLSRIIVVSTISGGGLIAYSEA------NGTNAVVETGTRKKKVVLLG  61

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RKKNV
Sbjct  62   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGRKKNV  121

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  122  DTSYLEAECFKID  134



>ref|NP_001190678.1| NAD(P)H dehydrogenase B2 [Arabidopsis thaliana]
 gb|AEE82461.1| NAD(P)H dehydrogenase B2 [Arabidopsis thaliana]
Length=619

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++L+V T+SGG L+AYSEA   + +N  G + E   +KK+VV+LG
Sbjct  7    FERFSKAFKDHPSLTRILVVSTISGGGLIAYSEANASYGANG-GAVVETGTKKKKVVLLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV
Sbjct  66   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGR-KNV  124

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  125  DTSYLEAECFKID  137



>ref|XP_009375317.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Pyrus x bretschneideri]
Length=586

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEA-TKPHESNNLGDLTEVNHQKKRVVVL  343
              R ++ F + P  SK+L+V  VSGG  VAY+EA ++P   ++   + +  ++KK++VVL
Sbjct  7    FDRVSKAFHDYPKASKMLVVVAVSGGGYVAYAEANSEPKLISSTPGIDQGENKKKKIVVL  66

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFL+NLK+P+Y+VQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RKKN
Sbjct  67   GTGWAGTSFLRNLKNPNYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVRKKN  126

Query  524  VDMQYCEAECIKIDA  568
            VD+Q+ EA C+KIDA
Sbjct  127  VDVQFSEAACLKIDA  141



>ref|XP_010422374.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X2 [Camelina sativa]
Length=582

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++++V T+SGG L+AYSEA   + +     + E+  +KK+VV+LG
Sbjct  7    FERFSKAFQDHPSLTRIIVVSTISGGGLIAYSEANASYGATGSAAVVEIGTKKKKVVLLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV
Sbjct  67   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGR-KNV  125

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  126  DTSYLEAECFKID  138



>ref|XP_006287294.1| hypothetical protein CARUB_v10000488mg, partial [Capsella rubella]
 gb|EOA20192.1| hypothetical protein CARUB_v10000488mg, partial [Capsella rubella]
Length=614

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++L+V T+SGG L+AYSEA   + +N    L E   +KK+VV+LG
Sbjct  40   FERFSKAFQDHPSLTRILVVSTISGGGLIAYSEANASYGANGAA-LVETGTRKKKVVLLG  98

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV
Sbjct  99   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGR-KNV  157

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  158  DTSYLEAECFKID  170



>ref|XP_010455838.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Camelina sativa]
Length=583

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF++ F+++PSL+++++V T+SGG L+AYSEA   +  N    + E   +KK+VV+LG
Sbjct  7    FERFSKAFQDHPSLTRIIVVSTISGGGLIAYSEANASYGVNGSAAVVETGTRKKKVVLLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL +  Y+VQ+ISPRNYFAFTPLLPSVTCGTVE RS+VEP+RNI R KNV
Sbjct  67   TGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPVRNIGR-KNV  125

Query  527  DMQYCEAECIKID  565
            D  Y EAEC KID
Sbjct  126  DTSYLEAECFKID  138



>ref|XP_008364132.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Malus domestica]
Length=586

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEA-TKPHESNNLGDLTEVNHQKKRVVVLGT  349
            R ++ F + P  SK+L+V  VSGG  VAY+EA ++P   ++   + +  ++KK++ VLGT
Sbjct  9    RVSKAFHDYPKASKMLVVVAVSGGGYVAYAEANSEPKLISSAPGIDQGENKKKKIXVLGT  68

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFL+NLK+P+Y+VQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RKKNVD
Sbjct  69   GWAGTSFLRNLKNPNYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVRKKNVD  128

Query  530  MQYCEAECIKIDA  568
            +Q+ EA C+KIDA
Sbjct  129  VQFSEAACLKIDA  141



>ref|XP_004146581.1| PREDICTED: NAD(P)H dehydrogenase B3, mitochondrial-like [Cucumis 
sativus]
 gb|KGN64627.1| hypothetical protein Csa_1G071890 [Cucumis sativus]
Length=584

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R F ++PS+S+LL++ TVSGGSLVAY++A   +   ++     V+ +KK+VVVLGTG
Sbjct  9    RVSRVFHDHPSISRLLVLVTVSGGSLVAYADAGPTNGVPSIASTANVDEKKKKVVVLGTG  68

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGTSFLKN+KDPSY+VQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIRN++RKK VD+
Sbjct  69   WAGTSFLKNIKDPSYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNLVRKKRVDI  128

Query  533  QYCEAECIKIDA  568
            ++ EAEC KIDA
Sbjct  129  RFNEAECYKIDA  140



>ref|XP_011001139.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Populus euphratica]
Length=584

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 111/135 (82%), Gaps = 3/135 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGD-LTEVNHQKKRVVVL  343
             +R +R F + PSL+KL+++ TVSGG  VAY++A   + ++ +   ++E+  +KK+VVV+
Sbjct  7    FKRASRAFDDYPSLAKLVVICTVSGGGYVAYADANSSNGAHAVAPPVSEI--RKKKVVVI  64

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFLK L +PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIR+I+RKK+
Sbjct  65   GTGWAGTSFLKKLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRSIVRKKS  124

Query  524  VDMQYCEAECIKIDA  568
            V + YCEAEC KIDA
Sbjct  125  VSVSYCEAECFKIDA  139



>ref|XP_002305652.1| NADH dehydrogenase-like family protein [Populus trichocarpa]
 gb|EEE86163.1| NADH dehydrogenase-like family protein [Populus trichocarpa]
Length=584

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 110/135 (81%), Gaps = 3/135 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGD-LTEVNHQKKRVVVL  343
             +R +R F + PSL+KL++V TVSGG  VAY++A   + ++ +   + E+  +KK+VVV+
Sbjct  7    FKRASRAFDDYPSLAKLIVVCTVSGGGYVAYADANSSNGAHAVAPPVPEI--RKKKVVVI  64

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFLK L +PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIR+I+RKK+
Sbjct  65   GTGWAGTSFLKKLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRSIVRKKS  124

Query  524  VDMQYCEAECIKIDA  568
            V + YCEAEC KIDA
Sbjct  125  VSVSYCEAECFKIDA  139



>ref|XP_004158024.1| PREDICTED: NAD(P)H dehydrogenase B3, mitochondrial-like [Cucumis 
sativus]
Length=584

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R F ++PS+S+LL++ +VSGGSLVAY++A   +   ++     V+ +KK+VVVLGTG
Sbjct  9    RVSRVFHDHPSISRLLVLVSVSGGSLVAYADAGPTNGVPSIASTANVDEKKKKVVVLGTG  68

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGTSFLKN+KDPSY+VQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIRN++RKK VD+
Sbjct  69   WAGTSFLKNIKDPSYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNLVRKKRVDI  128

Query  533  QYCEAECIKIDA  568
            ++ EAEC KIDA
Sbjct  129  RFNEAECYKIDA  140



>ref|XP_006413774.1| hypothetical protein EUTSA_v10024771mg [Eutrema salsugineum]
 dbj|BAJ33803.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55227.1| hypothetical protein EUTSA_v10024771mg [Eutrema salsugineum]
Length=578

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R +R F + PSLS++L+V T+SGG L+AYSEA     +N +    E   +KK+VV+LG
Sbjct  7    FERLSRAFHDYPSLSRILVVSTISGGGLIAYSEANASSSNNGV----ETGTRKKKVVLLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLK+L + SY++QVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI +KKNV
Sbjct  63   TGWAGASFLKDLNNSSYEIQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGKKKNV  122

Query  527  DMQYCEAECIKID  565
            +M + EAEC +ID
Sbjct  123  EMSFLEAECFRID  135



>ref|XP_007148248.1| hypothetical protein PHAVU_006G192400g [Phaseolus vulgaris]
 gb|ESW20242.1| hypothetical protein PHAVU_006G192400g [Phaseolus vulgaris]
Length=577

 Score =   177 bits (450),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 105/135 (78%), Gaps = 10/135 (7%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFT-VSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
            +QR +  FREN S  KL+++ T VSGG L+AY E+  P E+     +TE    KK+VVVL
Sbjct  7    LQRLSGAFRENQSHFKLVLLCTAVSGGGLLAYGESVAPEEA-----ITE----KKKVVVL  57

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWA TSFLKNL +P YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI +KK 
Sbjct  58   GTGWASTSFLKNLNNPKYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIFKKKK  117

Query  524  VDMQYCEAECIKIDA  568
            VD+Q+ EAEC KIDA
Sbjct  118  VDVQFSEAECFKIDA  132



>ref|NP_193880.5| NAD(P)H dehydrogenase B3 [Arabidopsis thaliana]
 sp|F4JJJ3.1|NDB3_ARATH RecName: Full=External alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial; AltName: Full=External alternative 
NADH dehydrogenase NDB3; AltName: Full=NADH:ubiquinone reductase 
(non-electrogenic) NDB3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE84459.1| NAD(P)H dehydrogenase B3 [Arabidopsis thaliana]
Length=580

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R ++ F + PSLSK+L+V T+SGG L+ YSEA   + +N +    E   +K++VV+LG
Sbjct  7    FERLSQAFHDYPSLSKILVVSTISGGGLIVYSEANPSYSNNGV----ETKTRKRKVVLLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLK L + SY+VQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RK+NV
Sbjct  63   TGWAGASFLKTLNNSSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIARKQNV  122

Query  527  DMQYCEAECIKID  565
            +M + EAEC KID
Sbjct  123  EMSFLEAECFKID  135



>ref|XP_010451313.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Camelina sativa]
Length=352

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R ++ F + PSLS++L+V T+SGG L+AYSEA   + +N  GD  E   +KK+VV+LG
Sbjct  7    FERLSKAFHDYPSLSRILVVSTISGGGLIAYSEANGSYSNN--GD--ETGTRKKKVVLLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWA  SFLK+L + SY+VQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV
Sbjct  63   TGWAAASFLKSLNNSSYEVQVISPRNYFAFTPLLPSVTCGTVESRSVVEPIRNIGR-KNV  121

Query  527  DMQYCEAECIKID  565
            +M + EAEC KID
Sbjct  122  EMSFVEAECFKID  134



>ref|XP_011043304.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Populus euphratica]
 ref|XP_011043305.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Populus euphratica]
 ref|XP_011043306.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Populus euphratica]
Length=581

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 110/138 (80%), Gaps = 12/138 (9%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGD----LTEVNHQKKRV  334
             +R +R F + PSL+KL++V T+SGG  VAY++A      N +G     L E+  +KK+V
Sbjct  7    FKRASRCFNDYPSLAKLVVVCTISGGCYVAYADA------NGIGGAPPALEEI--KKKKV  58

Query  335  VVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIR  514
            VVLGTGWAGTSFLK L +PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIR+I+R
Sbjct  59   VVLGTGWAGTSFLKKLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRSIVR  118

Query  515  KKNVDMQYCEAECIKIDA  568
            KK++D++Y EAEC KI+A
Sbjct  119  KKSIDIRYWEAECFKIEA  136



>ref|XP_010647594.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like, partial [Vitis vinifera]
Length=217

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  218  LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSY  397
            +++F  SGG L+AYSE+       +LG  +E +++KKRVVVLGTGWAGTSFLKNL + SY
Sbjct  1    MLLFFFSGGGLLAYSESKSYPGVRSLGS-SEDDNKKKRVVVLGTGWAGTSFLKNLNNSSY  59

Query  398  DVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            DVQV+SPRNYFAFTPLLPSVTCG+VE RSIVEPIRNI++KKNV++ + EAECIKIDA
Sbjct  60   DVQVVSPRNYFAFTPLLPSVTCGSVEARSIVEPIRNIVKKKNVEIHFWEAECIKIDA  116



>emb|CBI14826.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  218  LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSY  397
            +++F  SGG L+AYSE+       +LG  +E +++KKRVVVLGTGWAGTSFLKNL + SY
Sbjct  1    MLLFFFSGGGLLAYSESKSYPGVRSLGS-SEDDNKKKRVVVLGTGWAGTSFLKNLNNSSY  59

Query  398  DVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            DVQV+SPRNYFAFTPLLPSVTCG+VE RSIVEPIRNI++KKNV++ + EAECIKIDA
Sbjct  60   DVQVVSPRNYFAFTPLLPSVTCGSVEARSIVEPIRNIVKKKNVEIHFWEAECIKIDA  116



>ref|XP_011086121.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X2 [Sesamum indicum]
 ref|XP_011086122.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X2 [Sesamum indicum]
Length=558

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  215  LLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPS  394
            +LIVFTVSGG ++A+SEA +  E+    D +E + +KK+VVVLGTGWAG +FLKNLK+PS
Sbjct  1    MLIVFTVSGGCVLAFSEAKQ--ENGMTSDSSEADSKKKKVVVLGTGWAGINFLKNLKNPS  58

Query  395  YDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            YDVQVISPRNYFAFTPLLPSVTCGT+E RSI+EP+RNI+RKKNV++ Y EAEC  IDA
Sbjct  59   YDVQVISPRNYFAFTPLLPSVTCGTLEPRSIIEPVRNIVRKKNVNIHYWEAECFNIDA  116



>ref|XP_002316663.1| NADH dehydrogenase-like family protein [Populus trichocarpa]
 gb|EEE97275.1| NADH dehydrogenase-like family protein [Populus trichocarpa]
Length=581

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R +R F + PSL+KL+++ T+SGG  VAY++A     +  +  L E+  +KK+VVVLG
Sbjct  7    FKRASRCFDDYPSLAKLVVICTISGGCYVAYADANGTGSAPPV--LEEI--KKKKVVVLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLK L +PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIR+I+RKK++
Sbjct  63   TGWAGTSFLKKLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRSIVRKKSI  122

Query  527  DMQYCEAECIKIDA  568
            D++Y EAEC KI+A
Sbjct  123  DIRYWEAECFKIEA  136



>ref|XP_002274523.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Vitis vinifera]
Length=574

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 108/133 (81%), Gaps = 8/133 (6%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R  + FR+NPSLSKL++V TVSGG L+A++E T+P   ++       +  KK+VVVLG
Sbjct  7    FERAFKAFRDNPSLSKLMVVCTVSGGGLLAFAE-TRPFSGSD-------SVPKKKVVVLG  58

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLK  +++VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RKK +
Sbjct  59   TGWAGTSFLKNLKSSTFEVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVRKKGI  118

Query  527  DMQYCEAECIKID  565
            ++++ EAEC KID
Sbjct  119  NIEFKEAECYKID  131



>ref|XP_003635673.2| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Vitis vinifera]
Length=263

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTS  367
            F  + SL+ +   F  SGG L+AYSE+       +LG  +E +++KKRVVVLGTGWAGTS
Sbjct  2    FSYSFSLAFVCCFFFCSGGGLLAYSESKSYPGVRSLGS-SEDDNKKKRVVVLGTGWAGTS  60

Query  368  FLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEA  547
            FLKNL + SYDVQV+SPRNYFAFTPLLPSVTCG+VE RSIVEPIRNI++KKNV++ + EA
Sbjct  61   FLKNLNNSSYDVQVVSPRNYFAFTPLLPSVTCGSVEARSIVEPIRNIVKKKNVEIHFWEA  120

Query  548  ECIKIDA  568
            ECIKIDA
Sbjct  121  ECIKIDA  127



>ref|XP_006357530.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Solanum tuberosum]
Length=574

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 105/139 (76%), Gaps = 6/139 (4%)
 Frame = +2

Query  149  LSK*KKMQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKK  328
            +S+    QR +R F + P L KLL++FTVSGG L     AT  H +       ++  +KK
Sbjct  1    MSRYSFFQRASRAFNDYPHLPKLLVLFTVSGGGL-----ATVCHTAFADAGQDDII-KKK  54

Query  329  RVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNI  508
            ++VVLGTGWAGTSFLKNLKDPSY VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI
Sbjct  55   KIVVLGTGWAGTSFLKNLKDPSYSVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNI  114

Query  509  IRKKNVDMQYCEAECIKID  565
            ++KKN D+ + EAEC KID
Sbjct  115  VKKKNFDVDFKEAECFKID  133



>gb|AID21670.1| At4g21490p-like protein [Arabidopsis lyrata]
Length=579

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +RF+  F + PSLS++L+V T+SGG L+ YSEA   + +N +    E   +KK+VV+LG
Sbjct  7    FERFSNAFHDYPSLSRILVVSTISGGGLIVYSEANASYSNNGV----ETETRKKKVVLLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLK L + SY+VQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV
Sbjct  63   TGWAGASFLKTLNNSSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGR-KNV  121

Query  527  DMQYCEAECIKID  565
            +M + EAEC+KID
Sbjct  122  EMSFLEAECVKID  134



>ref|XP_010095837.1| External NADH-ubiquinone oxidoreductase 1 [Morus notabilis]
 gb|EXB62305.1| External NADH-ubiquinone oxidoreductase 1 [Morus notabilis]
Length=569

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R +R F + PSLSKLL++ TVSGG + AY+ A KP  +     +     +KK+VVVLGT
Sbjct  8    KRASRAFHQYPSLSKLLVIVTVSGGGVAAYNGA-KPFSATYARPVEGECEKKKKVVVLGT  66

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAG SFLKNLK+PSYDV V+SP NYFAFTPLLPSVTCGTVE RSIVEP+R+I RKK +D
Sbjct  67   GWAGVSFLKNLKNPSYDVHVVSPHNYFAFTPLLPSVTCGTVEARSIVEPVRSITRKKGID  126

Query  530  MQYCEAECIKIDA  568
            +Q+ EA C KIDA
Sbjct  127  VQFREAVCYKIDA  139



>ref|XP_002319383.1| NADH dehydrogenase-related family protein [Populus trichocarpa]
 gb|EEE95306.1| NADH dehydrogenase-related family protein [Populus trichocarpa]
Length=580

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            + R +R     P+ SKLL++FT+S G LVAY++ ++   +    +L +   +KKRVVVLG
Sbjct  7    INRASRALHGYPASSKLLVLFTLSSGGLVAYAD-SQSETAAPAAELNQNEWKKKRVVVLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLK+L   SYDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N 
Sbjct  66   TGWAGTSFLKDLDVSSYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNG  125

Query  527  DMQYCEAECIKIDA  568
            ++Q+ EAEC+KIDA
Sbjct  126  EIQFFEAECVKIDA  139



>ref|XP_008448220.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Cucumis melo]
 gb|ADN33896.1| NADH dehydrogenase [Cucumis melo subsp. melo]
Length=585

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +2

Query  185  TFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNH-QKKRVVVLGTGWAG  361
             FR++PS+SKLLIVFTVSGG LVA +     + S       +  + +KK+VVVLGTGWAG
Sbjct  13   AFRDHPSISKLLIVFTVSGGGLVAATNGRSLYHSVYADAFQQDGYCKKKKVVVLGTGWAG  72

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            TSFLKNLK  SYDV VISP NYFAFTPLLPSVTCGTVE RSIVEPIR I +KK +D+++ 
Sbjct  73   TSFLKNLKSSSYDVHVISPHNYFAFTPLLPSVTCGTVEARSIVEPIRTITKKKGLDIEFR  132

Query  542  EAECIKIDA  568
            EAEC KIDA
Sbjct  133  EAECYKIDA  141



>ref|XP_006597394.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X2 [Glycine max]
Length=577

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 10/135 (7%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFT-VSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
             Q  +R FR+N S  KL+++ T VSGG L AY E+  P E+ +         +KK+VVVL
Sbjct  7    FQHLSRAFRDNQSHLKLVLLCTAVSGGGLWAYGESVAPEEAVS---------EKKKVVVL  57

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWA TSF+KNLK+P Y+VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI ++K 
Sbjct  58   GTGWAATSFMKNLKNPKYEVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFKQKK  117

Query  524  VDMQYCEAECIKIDA  568
            VD+Q+ EAEC KIDA
Sbjct  118  VDVQFSEAECFKIDA  132



>ref|XP_008230220.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Prunus mume]
Length=581

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R F ++P  SKLL++ T+S G L+AY+E+     S ++ D      ++KRVVVLGTG
Sbjct  9    RASRAFNDHPVASKLLVLCTLSSGGLLAYAESQSNIGSPSVVDDKPDESRQKRVVVLGTG  68

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGTSFLK L   +YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N ++
Sbjct  69   WAGTSFLKYLDASAYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNGEI  128

Query  533  QYCEAECIKIDA  568
            ++CEAEC+KIDA
Sbjct  129  KFCEAECVKIDA  140



>ref|XP_010268843.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Nelumbo nucifera]
 ref|XP_010268844.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Nelumbo nucifera]
 ref|XP_010268846.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Nelumbo nucifera]
Length=580

 Score =   172 bits (435),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            +R    +P+ +K+ +VFTVS GSL+ YSE+   H + N  + ++   +KKRVVVLGTGWA
Sbjct  11   SRALHSHPAFTKVFVVFTVSTGSLLTYSESKSDHGTEN-DESSKTEAKKKRVVVLGTGWA  69

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            GTSFLK L   S+DVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIR I++KK+ ++Q+
Sbjct  70   GTSFLKGLDISSFDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRKIMKKKHGEIQF  129

Query  539  CEAECIKIDA  568
             EAEC+KIDA
Sbjct  130  WEAECVKIDA  139



>ref|XP_007043489.1| NAD(P)H dehydrogenase B1 isoform 3 [Theobroma cacao]
 gb|EOX99320.1| NAD(P)H dehydrogenase B1 isoform 3 [Theobroma cacao]
Length=394

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R+F   P+ SKLL++ T+S G LVAYSE ++   SN   ++   + +K+RVVVLGTG
Sbjct  9    RASRSFNGYPACSKLLVLCTLSSGGLVAYSE-SQTDVSNTSVEINAKDCKKRRVVVLGTG  67

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAG SFLK++   +YDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N ++
Sbjct  68   WAGISFLKDVDVSAYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNGEI  127

Query  533  QYCEAECIKIDA  568
            ++ EAECIKIDA
Sbjct  128  KFFEAECIKIDA  139



>ref|XP_007025802.1| NAD(P)H dehydrogenase B2 isoform 2 [Theobroma cacao]
 gb|EOY28424.1| NAD(P)H dehydrogenase B2 isoform 2 [Theobroma cacao]
Length=518

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 111/147 (76%), Gaps = 14/147 (10%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEA-----TKPH-------ESNNLGDL--  304
            + R +R F++ PSLS++++V T+SGG L+AY+EA     ++ H        SN    +  
Sbjct  7    LGRLSRAFQDYPSLSRIIVVSTISGGGLIAYAEANTYNGSRGHIAHADAITSNGAHGIAS  66

Query  305  TEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRS  484
            +E   +KK+VV+LGTGWAG SFLK+L +PSY+V+V+SPRN+F FTPLLPSVTCG VE RS
Sbjct  67   SEAVPKKKKVVLLGTGWAGMSFLKDLNNPSYEVEVVSPRNFFVFTPLLPSVTCGKVEARS  126

Query  485  IVEPIRNIIRKKNVDMQYCEAECIKID  565
            IVEPIRNIIRKKNVD+ + EAEC+KID
Sbjct  127  IVEPIRNIIRKKNVDISFSEAECVKID  153



>ref|XP_010686280.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 104/132 (79%), Gaps = 4/132 (3%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSG---GSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R FR +PSLSKLL+V  VSG   G L+AYS+ +KP+ + N+    E   ++K+VVVLGT
Sbjct  11   SRAFRNHPSLSKLLVVVAVSGSAGGGLLAYSD-SKPYNAENVVATPEAEIKRKKVVVLGT  69

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAG SFLK+LK+PSYDV VISPRNYFAFTPLLPSVT GTVE RSI EPIR +I+KK+V 
Sbjct  70   GWAGYSFLKDLKNPSYDVHVISPRNYFAFTPLLPSVTVGTVEARSICEPIRKMIKKKDVS  129

Query  530  MQYCEAECIKID  565
            + Y EAEC+ ID
Sbjct  130  VSYWEAECLSID  141



>ref|XP_002524685.1| NADH dehydrogenase, putative [Ricinus communis]
 gb|EEF37704.1| NADH dehydrogenase, putative [Ricinus communis]
Length=580

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R +R F + P LSK ++V  +SGG LVAY++A     +  L    E   ++K+VVVLGT
Sbjct  8    KRASRGFHDYPFLSKFVVVCAISGGGLVAYADANSSSAAAPL----EAVSKRKKVVVLGT  63

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLK L +PSYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RKKNVD
Sbjct  64   GWAGTSFLKKLDNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVRKKNVD  123

Query  530  MQYCEAECIKIDA  568
            + Y EAEC KIDA
Sbjct  124  VCYWEAECFKIDA  136



>ref|XP_007025801.1| NAD(P)H dehydrogenase B2 isoform 1 [Theobroma cacao]
 gb|EOY28423.1| NAD(P)H dehydrogenase B2 isoform 1 [Theobroma cacao]
Length=598

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 111/147 (76%), Gaps = 14/147 (10%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEA-----TKPH-------ESNNLGDL--  304
            + R +R F++ PSLS++++V T+SGG L+AY+EA     ++ H        SN    +  
Sbjct  7    LGRLSRAFQDYPSLSRIIVVSTISGGGLIAYAEANTYNGSRGHIAHADAITSNGAHGIAS  66

Query  305  TEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRS  484
            +E   +KK+VV+LGTGWAG SFLK+L +PSY+V+V+SPRN+F FTPLLPSVTCG VE RS
Sbjct  67   SEAVPKKKKVVLLGTGWAGMSFLKDLNNPSYEVEVVSPRNFFVFTPLLPSVTCGKVEARS  126

Query  485  IVEPIRNIIRKKNVDMQYCEAECIKID  565
            IVEPIRNIIRKKNVD+ + EAEC+KID
Sbjct  127  IVEPIRNIIRKKNVDISFSEAECVKID  153



>ref|XP_011048461.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Populus euphratica]
Length=580

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            + R +R     P+ SKLL++FT+S G LVAY++ ++   +    +L +   +KKRVVVLG
Sbjct  7    INRASRALHGYPASSKLLVLFTLSSGGLVAYAD-SQSETAAPAAELNQNECKKKRVVVLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLK+L   SYDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N 
Sbjct  66   TGWAGISFLKDLDVSSYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNG  125

Query  527  DMQYCEAECIKIDA  568
            ++Q+ EAEC+KIDA
Sbjct  126  EIQFYEAECVKIDA  139



>gb|KDP24191.1| hypothetical protein JCGZ_25848 [Jatropha curcas]
Length=580

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R ++ F    + SKLL++FTVSGG + AYSE ++        ++ +   +KKRVVVLG
Sbjct  7    FKRASQVFHGYSTYSKLLVLFTVSGGGVAAYSE-SQSEVGTPAAEVNQDERKKKRVVVLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLKNL   SYDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+R II+K+N 
Sbjct  66   TGWAGISFLKNLDVSSYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRKIIKKRNG  125

Query  527  DMQYCEAECIKIDA  568
            ++Q+ EAECIK+DA
Sbjct  126  EIQFWEAECIKVDA  139



>ref|XP_010436462.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial [Camelina sativa]
Length=531

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 103/133 (77%), Gaps = 5/133 (4%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R ++ F + PSLS++L+V T+SGG L+AYSE    + +N +    E   +KK+VV+LG
Sbjct  7    FERLSKAFHDYPSLSRILVVSTISGGGLMAYSEVNGSYSNNGV----ETRTRKKKVVLLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWA  SFLK+L + SY+VQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV
Sbjct  63   TGWAAASFLKSLNNSSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGR-KNV  121

Query  527  DMQYCEAECIKID  565
            +M + EAEC KID
Sbjct  122  EMSFLEAECFKID  134



>ref|XP_003608247.1| External NADH-ubiquinone oxidoreductase [Medicago truncatula]
 gb|ABD32606.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase; 
Calcium-binding EF-hand [Medicago truncatula]
 gb|AES90444.1| NAD(P)H dehydrogenase B2 [Medicago truncatula]
Length=578

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKL-LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
             QRF++ FR+  S  KL L+  TVSGG L+AY EA    ES           +KK+V+VL
Sbjct  7    FQRFSKNFRDYDSQFKLVLLCTTVSGGGLLAYGEAVATSES--------AVPEKKKVLVL  58

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFL+NL DP Y+V V+SPRNYF FTPLLPSVTCGTVE RSIVEP+RNI RKK+
Sbjct  59   GTGWAGTSFLRNLNDPRYEVHVVSPRNYFTFTPLLPSVTCGTVEARSIVEPVRNIFRKKH  118

Query  524  VDMQYCEAECIKIDA  568
            VD ++ EAEC+KIDA
Sbjct  119  VDSRFSEAECLKIDA  133



>ref|XP_002274469.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Vitis vinifera]
 emb|CBI28384.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 103/131 (79%), Gaps = 1/131 (1%)
 Frame = +2

Query  176  FARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            F+   R   S SKLL++ ++S G LVAYSE+     + +  ++ +   QKKRVVVLGTGW
Sbjct  7    FSGASRALGSSSKLLVILSISSGGLVAYSESQTDAGAQS-AEIKQKEPQKKRVVVLGTGW  65

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGTSFLK+L   SYDV+V+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNII+K+N ++Q
Sbjct  66   AGTSFLKDLDISSYDVKVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIIKKRNGEIQ  125

Query  536  YCEAECIKIDA  568
            Y EAEC+KIDA
Sbjct  126  YWEAECVKIDA  136



>gb|KHG06408.1| External alternative NADH-ubiquinone oxidoreductase, mitochondrial 
[Gossypium arboreum]
Length=598

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 111/147 (76%), Gaps = 14/147 (10%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEA-----TKPH-------ESNNLGDL--  304
             +R +R F + PSLSK+++V T+SGGSL+AY+EA     +K H        SN+   +  
Sbjct  7    FRRLSRAFNDYPSLSKVIVVSTISGGSLIAYAEANAFNGSKGHIAHADAVASNDDRRIAS  66

Query  305  TEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRS  484
            +E   +KK+VV+LGTGW G SFLK+L +P+Y+VQV+SPRN+F FTPLLPSVTCG VE RS
Sbjct  67   SEQVPKKKKVVLLGTGWGGMSFLKSLNNPNYEVQVVSPRNFFVFTPLLPSVTCGKVEARS  126

Query  485  IVEPIRNIIRKKNVDMQYCEAECIKID  565
            IVEPIRNIIRKKNV++ Y EAEC+KID
Sbjct  127  IVEPIRNIIRKKNVNISYSEAECVKID  153



>ref|XP_007215022.1| hypothetical protein PRUPE_ppa003367mg [Prunus persica]
 gb|EMJ16221.1| hypothetical protein PRUPE_ppa003367mg [Prunus persica]
Length=581

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R F  +P  SKLL++ T+S G L+AY+E+     S ++ D      +KKRVVVLGTG
Sbjct  9    RASRAFNGHPVASKLLVLCTLSSGGLLAYAESQSNVGSPSVVDDKPGESRKKRVVVLGTG  68

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGTSFLK L   +YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+R II+K+N ++
Sbjct  69   WAGTSFLKYLDASAYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRKIIKKRNGEI  128

Query  533  QYCEAECIKIDA  568
            ++CEAEC+KIDA
Sbjct  129  KFCEAECVKIDA  140



>gb|KJB66647.1| hypothetical protein B456_010G150000 [Gossypium raimondii]
Length=598

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 111/147 (76%), Gaps = 14/147 (10%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEA-----TKPH-------ESNNLGDL--  304
             +R +R F + PSLSK+++V T+SGGSL+AY+EA     +K H        SN+   +  
Sbjct  7    FRRLSRAFDDYPSLSKIIVVSTISGGSLIAYAEANAFNGSKGHIAHADAVASNDDRRIAS  66

Query  305  TEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRS  484
            +E   +KK+VV+LGTGW G SFLK+L +P+Y+VQV+SPRN+F FTPLLPSVTCG VE RS
Sbjct  67   SEQVPKKKKVVLLGTGWGGMSFLKSLNNPNYEVQVVSPRNFFVFTPLLPSVTCGKVEARS  126

Query  485  IVEPIRNIIRKKNVDMQYCEAECIKID  565
            IVEPIRNIIRKKNV++ Y EAEC+KID
Sbjct  127  IVEPIRNIIRKKNVNISYSEAECVKID  153



>ref|XP_004243314.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial [Solanum lycopersicum]
Length=575

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 102/133 (77%), Gaps = 5/133 (4%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             QR +R F + P L KLL++FTVSGG L     AT  H +       ++  +KK++VVLG
Sbjct  7    FQRASRAFNDYPHLPKLLVLFTVSGGGL-----ATVCHTAFADAGQDDIIKKKKKIVVLG  61

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLKDPSY VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI++KKN 
Sbjct  62   TGWAGTSFLKNLKDPSYSVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVKKKNF  121

Query  527  DMQYCEAECIKID  565
            D ++ EAEC KID
Sbjct  122  DAEFKEAECYKID  134



>ref|XP_007043484.1| NAD(P)H dehydrogenase B4 [Theobroma cacao]
 gb|EOX99315.1| NAD(P)H dehydrogenase B4 [Theobroma cacao]
Length=577

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 4/134 (3%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHE--SNNLGDLTEVNHQKKRVVVLG  346
            + +R F+  PSLSKLL+V TV GGSL+A+S+  +P +  SN+ G   E N +KK+VVVLG
Sbjct  9    KVSRVFQTYPSLSKLLVVSTVGGGSLLAFSD-DRPFQRVSNDGGQKPECN-KKKKVVVLG  66

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWA TSFLKNLK  SY+VQV+SPRNYFAFTPLLPSVT GTVE RS+VEPIRNI++K+  
Sbjct  67   TGWAATSFLKNLKSDSYEVQVVSPRNYFAFTPLLPSVTSGTVEARSVVEPIRNIVKKRGY  126

Query  527  DMQYCEAECIKIDA  568
             + + EAEC+KIDA
Sbjct  127  QIDFKEAECLKIDA  140



>ref|XP_006285107.1| hypothetical protein CARUB_v10006440mg [Capsella rubella]
 gb|EOA18005.1| hypothetical protein CARUB_v10006440mg [Capsella rubella]
Length=580

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R ++ F ++ SLSK+L+V T+SGG L+ YSEA   + +N +   T+   +KK+VV+LG
Sbjct  7    FERLSKAFHDSASLSKILVVSTISGGGLMVYSEANASYSNNGVETGTK---RKKKVVLLG  63

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLK+L + SY+VQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV
Sbjct  64   TGWAGASFLKSLNNSSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIAR-KNV  122

Query  527  DMQYCEAECIKID  565
            +M + EAEC +ID
Sbjct  123  EMSFLEAECFRID  135



>ref|XP_003547132.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Glycine max]
Length=576

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 103/135 (76%), Gaps = 11/135 (8%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFT-VSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
             Q  +R FR+N S  KL+++ T VSGG L AY E+  P E+ +         +KK+VVVL
Sbjct  7    FQHLSRAFRDNQSHLKLVLLCTAVSGGGLWAYGESVAPEEAVS---------EKKKVVVL  57

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWA TSF+KNLK+P Y+VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI +KK 
Sbjct  58   GTGWAATSFMKNLKNPKYEVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFKKK-  116

Query  524  VDMQYCEAECIKIDA  568
            VD+Q+ EAEC KIDA
Sbjct  117  VDVQFSEAECFKIDA  131



>ref|XP_004139962.1| PREDICTED: NAD(P)H dehydrogenase B2, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004154535.1| PREDICTED: NAD(P)H dehydrogenase B2, mitochondrial-like [Cucumis 
sativus]
Length=585

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 101/128 (79%), Gaps = 1/128 (1%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNH-QKKRVVVLGTGWAGT  364
            F ++PS+SKLLIVFT+SGG LVA +     + S     + +  + +KK+VVVLGTGWAGT
Sbjct  14   FHDHPSISKLLIVFTLSGGGLVATTNGRSLYHSVYADAVQQDGYWKKKKVVVLGTGWAGT  73

Query  365  SFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCE  544
            SFLKNLK  SYDV VISP NYFAFTPLLPS+TCGTVE RSIVEPIR+I +KK +D+++ E
Sbjct  74   SFLKNLKSSSYDVHVISPHNYFAFTPLLPSITCGTVEARSIVEPIRSITKKKGLDIEFRE  133

Query  545  AECIKIDA  568
            AEC KIDA
Sbjct  134  AECYKIDA  141



>ref|XP_004293504.2| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial [Fragaria vesca subsp. vesca]
Length=730

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 8/135 (6%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDL--TEVNHQKKRVVV  340
            +Q+ ++ FR  P LSK+L+V  VSGG  VAY++A      N+  DL  +    ++K+VVV
Sbjct  157  LQKISKPFRAYPRLSKILLVVAVSGGGYVAYAQA------NSDSDLISSSPGAERKKVVV  210

Query  341  LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKK  520
            LGTGWAGTSFL++L + SYDVQV+SPRNYF FTPLLPSVTCGTVE RSI+EPIRNI+RKK
Sbjct  211  LGTGWAGTSFLRSLTNSSYDVQVVSPRNYFTFTPLLPSVTCGTVEPRSIIEPIRNIVRKK  270

Query  521  NVDMQYCEAECIKID  565
             +  Q+ EAEC+KID
Sbjct  271  KIGFQFTEAECLKID  285



>ref|XP_006447382.1| hypothetical protein CICLE_v10017486mg [Citrus clementina]
 ref|XP_006469839.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial-like [Citrus sinensis]
 gb|ESR60622.1| hypothetical protein CICLE_v10017486mg [Citrus clementina]
Length=584

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAG  361
            R F++   LSK+L++ TVSGGS VA+S+ ++P +    GD  E   +KK+VVVLGTGWAG
Sbjct  12   RAFQDRSLLSKILVIGTVSGGSAVAFSD-SRPFQ-RIYGDSGEGEFKKKKVVVLGTGWAG  69

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            T+FLKNLK  S++VQV+SPRNYFAFTPLLPSVT GTVE RSIVEP RNI+RKK +D+Q+ 
Sbjct  70   TTFLKNLKSNSFEVQVVSPRNYFAFTPLLPSVTNGTVEARSIVEPTRNIVRKKGMDIQFK  129

Query  542  EAECIKIDA  568
            EAEC KIDA
Sbjct  130  EAECYKIDA  138



>ref|XP_007043487.1| NADH dehydrogenase, putative isoform 1 [Theobroma cacao]
 gb|EOX99318.1| NADH dehydrogenase, putative isoform 1 [Theobroma cacao]
Length=580

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R+F   P+ SKLL++ T+S G LVAYSE ++   SN   ++   + +K+RVVVLGTG
Sbjct  9    RASRSFNGYPACSKLLVLCTLSSGGLVAYSE-SQTDVSNTSVEINAKDCKKRRVVVLGTG  67

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAG SFLK++   +YDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N ++
Sbjct  68   WAGISFLKDVDVSAYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNGEI  127

Query  533  QYCEAECIKIDA  568
            ++ EAECIKIDA
Sbjct  128  KFFEAECIKIDA  139



>ref|XP_002319927.1| pyridine nucleotide-disulfide oxidoreductase family protein [Populus 
trichocarpa]
 gb|EEE95850.1| pyridine nucleotide-disulfide oxidoreductase family protein [Populus 
trichocarpa]
Length=579

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             QR  RTF+E+P+  KLLIV TVSGG L+ +S+A+ P +   + D ++   +KK+VVVLG
Sbjct  7    FQRAFRTFQEHPTFFKLLIVSTVSGGGLLTFSDAS-PFQ-GLITDSSQNEGKKKKVVVLG  64

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLK  SYDVQV+SP N+FAFTPLLPSVT GTVE RSIVEPIRNI++KK  
Sbjct  65   TGWAGTSFLKNLKSSSYDVQVVSPNNFFAFTPLLPSVTNGTVEARSIVEPIRNIVKKKPY  124

Query  527  DMQYCEAECIKID  565
            ++++ EAEC KID
Sbjct  125  NVEFKEAECYKID  137



>ref|XP_007043488.1| NADH dehydrogenase, putative isoform 2 [Theobroma cacao]
 gb|EOX99319.1| NADH dehydrogenase, putative isoform 2 [Theobroma cacao]
Length=581

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R+F   P+ SKLL++ T+S G LVAYSE ++   SN   ++   + +K+RVVVLGTG
Sbjct  9    RASRSFNGYPACSKLLVLCTLSSGGLVAYSE-SQTDVSNTSVEINAKDCKKRRVVVLGTG  67

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAG SFLK++   +YDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N ++
Sbjct  68   WAGISFLKDVDVSAYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNGEI  127

Query  533  QYCEAECIKIDA  568
            ++ EAECIKIDA
Sbjct  128  KFFEAECIKIDA  139



>ref|XP_006594628.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Glycine max]
 gb|KHN08588.1| Putative NADH dehydrogenase [Glycine soja]
Length=576

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 102/135 (76%), Gaps = 10/135 (7%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFT-VSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
              R +  FR+N S  KL+++ T VSGG L AY E+  P E+     +TE    KK+VVVL
Sbjct  7    FHRLSSAFRDNQSHLKLVLLCTAVSGGGLWAYGESVAPEEA-----VTE----KKKVVVL  57

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWA TSF+KNL +P Y++QV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI ++K 
Sbjct  58   GTGWAATSFMKNLNNPKYEIQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFKQKK  117

Query  524  VDMQYCEAECIKIDA  568
            VD+Q+ EAEC KIDA
Sbjct  118  VDVQFSEAECFKIDA  132



>emb|CBI28383.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 107/134 (80%), Gaps = 9/134 (7%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFT-VSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
             +R  + FR+NPSLSKL++V T + GG L+A++E T+P   ++       +  KK+VVVL
Sbjct  7    FERAFKAFRDNPSLSKLMVVCTKIIGGGLLAFAE-TRPFSGSD-------SVPKKKVVVL  58

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFLKNLK  +++VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RKK 
Sbjct  59   GTGWAGTSFLKNLKSSTFEVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVRKKG  118

Query  524  VDMQYCEAECIKID  565
            +++++ EAEC KID
Sbjct  119  INIEFKEAECYKID  132



>ref|XP_008379566.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Malus domestica]
Length=580

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R F  +P+ SKLL++ T+S G L+AY+E ++ +  + + D  +   +KKRVVVLGTG
Sbjct  9    RASRAFNGHPAASKLLVLCTISSGGLLAYAE-SQSNVGSPIVDPNQNEPRKKRVVVLGTG  67

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGTSFLK L   +YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP RNII+K+N ++
Sbjct  68   WAGTSFLKYLDASAYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPXRNIIKKRNGEI  127

Query  533  QYCEAECIKIDA  568
            ++ EAEC+KIDA
Sbjct  128  KFWEAECVKIDA  139



>gb|EYU24869.1| hypothetical protein MIMGU_mgv1a003609mg [Erythranthe guttata]
Length=574

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 104/132 (79%), Gaps = 6/132 (5%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            QR +  +  NP L KLL++ TVSGG L+A S       S+   D ++V+ +KK+VVVLGT
Sbjct  9    QRASNAYSSNPRLYKLLVITTVSGGGLLAISN------SSAFADASQVDVKKKKVVVLGT  62

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKNLKDPSY+++V+SPRNYFAFTPLLPSVT GTVE RSIVEPIRNI+RKK  D
Sbjct  63   GWAGTSFLKNLKDPSYEIEVVSPRNYFAFTPLLPSVTNGTVEARSIVEPIRNIVRKKKFD  122

Query  530  MQYCEAECIKID  565
            +Q+ EAEC KID
Sbjct  123  VQFKEAECYKID  134



>emb|CDP14697.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAG  361
            R F   P  SKLLI+ ++S G L+AY++ ++P    ++ D      QKKRVVVLGTGWA 
Sbjct  9    RAFHGRPYASKLLILCSISSGGLIAYAD-SQPDGKMSIVDHGNKKSQKKRVVVLGTGWAA  67

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            TSFLK+L   SYDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RN+I+K+N ++ + 
Sbjct  68   TSFLKDLDISSYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNMIKKRNGEILFW  127

Query  542  EAECIKIDA  568
            EAEC+KIDA
Sbjct  128  EAECLKIDA  136



>ref|XP_011467787.1| PREDICTED: LOW QUALITY PROTEIN: external alternative NAD(P)H-ubiquinone 
oxidoreductase B1, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=564

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R   ++P   KLL++ TVSGG +VAY+E+     S  + D  +   +KKRVVVLGTG
Sbjct  9    RASRAIHDHPVAPKLLLLATVSGGGVVAYAESQSDVSSPPI-DSNQNEVKKKRVVVLGTG  67

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGTSFLK++    YDVQ++SPRNYFAFTPLLPS+TCGTVE RSIVEP+RN+I+K+N ++
Sbjct  68   WAGTSFLKHVDASHYDVQLVSPRNYFAFTPLLPSITCGTVEARSIVEPVRNMIKKRNGEI  127

Query  533  QYCEAECIKIDA  568
            +Y EAEC+KIDA
Sbjct  128  KYYEAECVKIDA  139



>ref|XP_004507222.1| PREDICTED: NAD(P)H dehydrogenase B3, mitochondrial-like [Cicer 
arietinum]
Length=575

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 101/130 (78%), Gaps = 7/130 (5%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTV-SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F E PS SK ++V T+ SGG LVAY++A   +  ++ GD       KK+VVVLGTGW
Sbjct  11   SRVFHEYPSWSKSVVVCTIISGGGLVAYNDARSAY--SDCGDQIP----KKKVVVLGTGW  64

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGTSF+K +KDPSYD+ V+SPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RK  +++Q
Sbjct  65   AGTSFVKTMKDPSYDIHVVSPRNYFAFTPLLPSVTCGTVEARSVVEPIRNISRKSGLNVQ  124

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  125  FSEAECYKID  134



>ref|XP_006594629.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X2 [Glycine max]
Length=575

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 11/135 (8%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFT-VSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
              R +  FR+N S  KL+++ T VSGG L AY E+  P E+     +TE    KK+VVVL
Sbjct  7    FHRLSSAFRDNQSHLKLVLLCTAVSGGGLWAYGESVAPEEA-----VTE----KKKVVVL  57

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWA TSF+KNL +P Y++QV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI +KK 
Sbjct  58   GTGWAATSFMKNLNNPKYEIQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFKKK-  116

Query  524  VDMQYCEAECIKIDA  568
            VD+Q+ EAEC KIDA
Sbjct  117  VDVQFSEAECFKIDA  131



>ref|XP_011048463.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial-like isoform X1 [Populus euphratica]
Length=579

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 106/136 (78%), Gaps = 8/136 (6%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNH---QKKRVV  337
             QR  RTF+ +P+  KLL+V TVSGG L+ +S+A+ P +    G +TE +    +KK+VV
Sbjct  7    FQRAFRTFQAHPTFFKLLVVSTVSGGGLLTFSDAS-PFQ----GLITESSQNEGKKKKVV  61

Query  338  VLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRK  517
            VLGTGWAGTSFLKNLK  SYDVQV+SP N+FAFTPLLPSVT GTVE RSIVEPIRNI++K
Sbjct  62   VLGTGWAGTSFLKNLKSSSYDVQVVSPNNFFAFTPLLPSVTNGTVEARSIVEPIRNIVKK  121

Query  518  KNVDMQYCEAECIKID  565
            K  ++++ EAEC KID
Sbjct  122  KPYNVEFKEAECYKID  137



>ref|XP_011048464.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial-like isoform X2 [Populus euphratica]
Length=579

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 106/136 (78%), Gaps = 8/136 (6%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNH---QKKRVV  337
             QR  RTF+ +P+  KLL+V TVSGG L+ +S+A+ P +    G +TE +    +KK+VV
Sbjct  7    FQRAFRTFQAHPTFFKLLVVSTVSGGGLLTFSDAS-PFQ----GLITESSQNEGKKKKVV  61

Query  338  VLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRK  517
            VLGTGWAGTSFLKNLK  SYDVQV+SP N+FAFTPLLPSVT GTVE RSIVEPIRNI++K
Sbjct  62   VLGTGWAGTSFLKNLKSSSYDVQVVSPNNFFAFTPLLPSVTNGTVEARSIVEPIRNIVKK  121

Query  518  KNVDMQYCEAECIKID  565
            K  ++++ EAEC KID
Sbjct  122  KPYNVEFKEAECYKID  137



>gb|KDP20881.1| hypothetical protein JCGZ_21352 [Jatropha curcas]
Length=582

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            +R+FR++P LSK ++V  VSGG LVAY++A   +         E   +KK+VVVLGTGWA
Sbjct  9    SRSFRDSPLLSKFVVVCAVSGGGLVAYADANSSNGVLARAPPPETVSKKKKVVVLGTGWA  68

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            GTSFLK L DPSYDVQVISPRNYFAFTPLLPSVT GTVE RSIVEPIRNI+RKK +D+ +
Sbjct  69   GTSFLKKLNDPSYDVQVISPRNYFAFTPLLPSVTVGTVEARSIVEPIRNIVRKKKMDVCF  128

Query  539  CEAECIKIDA  568
             E EC KIDA
Sbjct  129  SEGECFKIDA  138



>ref|XP_010035668.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Eucalyptus grandis]
 gb|KCW47121.1| hypothetical protein EUGRSUZ_K00928 [Eucalyptus grandis]
Length=580

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 102/140 (73%), Gaps = 8/140 (6%)
 Frame = +2

Query  167  MQRFA------RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKK  328
            M RFA      R F + PSLSKLL+V TVSGG +VA+S+ T P       D  +    KK
Sbjct  1    MSRFAFYERIFRAFHDRPSLSKLLLVSTVSGGGIVAFSDTT-PFPVA-YADSAQGQCPKK  58

Query  329  RVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNI  508
            +VVVLGTGWA TSFLKNLK+ SY+V+V+SPRNYFAFTPLLPSVT GTVE RSIVEPIRNI
Sbjct  59   KVVVLGTGWAATSFLKNLKNSSYEVEVVSPRNYFAFTPLLPSVTNGTVEARSIVEPIRNI  118

Query  509  IRKKNVDMQYCEAECIKIDA  568
            + KK    +Y EAEC KIDA
Sbjct  119  VNKKGPHCEYREAECYKIDA  138



>ref|XP_011085368.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial [Sesamum indicum]
Length=577

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGS-LVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            Q+ ++ +  +P LSKLL+VFT+SGG  L+A S+ +    S    D  + +  KK+VVVLG
Sbjct  8    QKASKAYYSHPHLSKLLVVFTLSGGGGLLAVSDNSPL--SAAYADAGQRDITKKKVVVLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLK+L  PSY+VQV+SPRNYFAFTPLLPSVT GTVE RSIVEPIRNI+RKK  
Sbjct  66   TGWAGTSFLKSLTHPSYEVQVVSPRNYFAFTPLLPSVTNGTVEARSIVEPIRNIVRKKKF  125

Query  527  DMQYCEAECIKID  565
            D Q+ EAEC KID
Sbjct  126  DAQFREAECYKID  138



>emb|CAN66469.1| hypothetical protein VITISV_016566 [Vitis vinifera]
Length=618

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 94/111 (85%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVIS  415
            SGG L+AYSE+       + G  +E +++KKRVVVLGTGWAGTSFLKNL + SYDVQV+S
Sbjct  65   SGGGLLAYSESKSYPGVRSFGS-SEDDNKKKRVVVLGTGWAGTSFLKNLNNSSYDVQVVS  123

Query  416  PRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            PRNYFAFTPLLPSVTCG+VE RSIVEPIRNI++KKNV++ + EAECIKIDA
Sbjct  124  PRNYFAFTPLLPSVTCGSVEARSIVEPIRNIVKKKNVEIHFWEAECIKIDA  174



>ref|XP_009393356.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=579

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 97/129 (75%), Gaps = 5/129 (4%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            AR +R  P+ SKL++VF  SGG LVAY++A     + + G        KK+VVVLGTGWA
Sbjct  12   ARAYRHRPTFSKLVLVFAASGGGLVAYADARAEVAAESPG-----VAPKKKVVVLGTGWA  66

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            GT+F+KN+   SYDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIR II KK  ++++
Sbjct  67   GTTFVKNIDSSSYDVQVISPRNYFAFTPLLPSVTCGTVEPRSIVEPIRKIITKKGGEIKF  126

Query  539  CEAECIKID  565
             EAEC KID
Sbjct  127  WEAECFKID  135



>ref|XP_007159245.1| hypothetical protein PHAVU_002G221500g [Phaseolus vulgaris]
 gb|ESW31239.1| hypothetical protein PHAVU_002G221500g [Phaseolus vulgaris]
Length=578

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 9/135 (7%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKL-LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
             +R +  F ++ S  KL L+  TVSGG ++AY EA    E+           +KK+VVVL
Sbjct  7    FKRLSSAFGDHGSNFKLVLLCTTVSGGGVLAYGEAVGASEA--------AVPEKKKVVVL  58

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFLKNL +P Y+V V+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI RKK 
Sbjct  59   GTGWAGTSFLKNLNNPRYEVHVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKM  118

Query  524  VDMQYCEAECIKIDA  568
            VD+Q+ EAEC+KIDA
Sbjct  119  VDVQFSEAECLKIDA  133



>ref|XP_009768472.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Nicotiana sylvestris]
Length=573

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 98/133 (74%), Gaps = 7/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             QR +R F + P L K+L++FTVSGG L A              D  + + +KK+VVVLG
Sbjct  7    FQRASRAFNDYPHLPKVLVLFTVSGGGLGAVCHTA-------YADAGQNDAKKKKVVVLG  59

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLKDPSY VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI++KK  
Sbjct  60   TGWAGTSFLKNLKDPSYSVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVKKKKF  119

Query  527  DMQYCEAECIKID  565
            D  + EAEC KID
Sbjct  120  DADFKEAECYKID  132



>ref|XP_010931905.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Elaeis guineensis]
Length=580

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            +R F   PS SKL+++ T SGG LVAY+++   H   +    ++V H+KK+VVVLGTGWA
Sbjct  12   SRAFHHRPSFSKLVVILTASGGGLVAYADSKSDHAIES----SQVAHKKKKVVVLGTGWA  67

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            GT+FLKNL    YDVQVISPRNYFAFTPLLPS+TCGTVE RSIVEPIR II+KK  D+++
Sbjct  68   GTTFLKNLDSSLYDVQVISPRNYFAFTPLLPSITCGTVEPRSIVEPIRKIIKKKGGDIKF  127

Query  539  CEAECIKID  565
             EAEC KID
Sbjct  128  WEAECFKID  136



>ref|XP_011048462.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Populus euphratica]
Length=577

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R  R F ++ ++SKLL++ +VSGG L+A+S+A      N      E + +KK+VV+LG
Sbjct  8    FERTLRAFNDHSTVSKLLVISSVSGGGLLAFSDA------NAFQSYAEGDGKKKKVVILG  61

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLKNLK  SYDV ++SPRNYFAFTPLLPSVT GTVEGRSIVEPIRNI RKK  
Sbjct  62   TGWAGVSFLKNLKSSSYDVHIVSPRNYFAFTPLLPSVTNGTVEGRSIVEPIRNIARKKPF  121

Query  527  DMQYCEAECIKID  565
             + + EAEC KID
Sbjct  122  GVGFKEAECYKID  134



>ref|XP_003530989.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Glycine max]
Length=580

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKL-LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
             +R +R FR++ S  KL L+  TVSGG ++AY EA    E+           +KK+VVVL
Sbjct  7    FERVSRAFRDHGSNFKLVLLCTTVSGGGVLAYGEAVAASEA------AATTTEKKKVVVL  60

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFL+NL +P Y+V V+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI RKK 
Sbjct  61   GTGWAGTSFLRNLDNPKYEVHVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKK  120

Query  524  VDMQYCEAECIKIDA  568
            +DMQ+ EAEC+KIDA
Sbjct  121  MDMQFSEAECLKIDA  135



>ref|XP_002319384.1| pyridine nucleotide-disulfide oxidoreductase family protein [Populus 
trichocarpa]
 gb|EEE95307.1| pyridine nucleotide-disulfide oxidoreductase family protein [Populus 
trichocarpa]
Length=577

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             +R  R F ++ ++SK+L++ +VSGG L+A+S+A      N      E + +KK+VVVLG
Sbjct  8    FERALRAFNDHSTVSKILVISSVSGGGLLAFSDA------NAFQSYAEGDGKKKKVVVLG  61

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLKNLK  SYDV ++SPRNYFAFTPLLPSVT GTVEGRSIVEPIRNI RKK  
Sbjct  62   TGWAGVSFLKNLKSSSYDVHIVSPRNYFAFTPLLPSVTNGTVEGRSIVEPIRNIARKKPF  121

Query  527  DMQYCEAECIKID  565
             + + EAEC KID
Sbjct  122  GVGFKEAECYKID  134



>gb|AFK40813.1| unknown [Lotus japonicus]
Length=574

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 97/132 (73%), Gaps = 10/132 (8%)
 Frame = +2

Query  176  FARTFRENPSLSKL-LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            F + FR++ S  KL L   TVSGG L+AY EA            +E   +KK+VVVLGTG
Sbjct  7    FEQAFRDHRSQLKLVLFCTTVSGGGLLAYGEAVAA---------SEPEQKKKKVVVLGTG  57

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGT+FL+NL +P Y+V V+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI RKK V+ 
Sbjct  58   WAGTTFLRNLNNPRYEVHVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKKVNA  117

Query  533  QYCEAECIKIDA  568
             + EAEC+KIDA
Sbjct  118  YFNEAECVKIDA  129



>ref|XP_010095836.1| External alternative NADH-ubiquinone oxidoreductase [Morus notabilis]
 gb|EXB62304.1| External alternative NADH-ubiquinone oxidoreductase [Morus notabilis]
Length=582

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIV--FTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            R ++ F   P  SKL++V   T+S G LVAYSE+         G + +  ++KKRVVVLG
Sbjct  9    RASQAFHGYPVASKLILVSTLTLSAGGLVAYSESESDIGCPG-GVVDQNENRKKRVVVLG  67

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLK+L    YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIR II+K+N 
Sbjct  68   TGWAGTSFLKDLDSSKYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRKIIKKRNG  127

Query  527  DMQYCEAECIKIDA  568
            ++Q+ EAEC+KIDA
Sbjct  128  EVQFFEAECVKIDA  141



>ref|XP_004136810.1| PREDICTED: NAD(P)H dehydrogenase B1, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004167391.1| PREDICTED: NAD(P)H dehydrogenase B1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN43583.1| hypothetical protein Csa_7G046710 [Cucumis sativus]
Length=574

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 105/132 (80%), Gaps = 6/132 (5%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R +R F  +P+ SKLL++ T+SGG L+AY+++    +S+  G + E    KKRV+VLGTG
Sbjct  9    RASRAFHGSPAYSKLLLISTLSGGGLLAYADS----QSDVGGSVEE--SPKKRVLVLGTG  62

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGTSFLK+L    YDVQV+SP+NYF+FTPLLPSVTCG+VE RSIVEP+RNI++K+  ++
Sbjct  63   WAGTSFLKDLDASKYDVQVVSPQNYFSFTPLLPSVTCGSVEARSIVEPVRNIVKKRKGEI  122

Query  533  QYCEAECIKIDA  568
            ++ EAEC+KIDA
Sbjct  123  KFWEAECLKIDA  134



>emb|CBI33303.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  305  TEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRS  484
            +E +++KKRVVVLGTGWAGTSFLKNL + SYDVQV+SPRNYFAFTPLLPSVTCG+VE RS
Sbjct  7    SEDDNKKKRVVVLGTGWAGTSFLKNLNNSSYDVQVVSPRNYFAFTPLLPSVTCGSVEARS  66

Query  485  IVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            IVEPIRNI++KKNV++ + EAECIKIDA
Sbjct  67   IVEPIRNIVKKKNVEIHFWEAECIKIDA  94



>gb|KHN41160.1| External NADH-ubiquinone oxidoreductase 1, mitochondrial [Glycine 
soja]
Length=644

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 97/130 (75%), Gaps = 10/130 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTV-SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F E PS SK ++V TV S G LVAY +A KP  +N          QKK+VVVLGTGW
Sbjct  83   SRVFNEYPSWSKSVVVCTVISSGGLVAYCDA-KPEYANQ--------SQKKKVVVLGTGW  133

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGTSFLKN+K  SYD+ V+SPRNYFAFTPLLPSVTCGTVE RS+VEPIR+I RK  V++ 
Sbjct  134  AGTSFLKNMKSNSYDIHVVSPRNYFAFTPLLPSVTCGTVEARSVVEPIRSITRKSGVNIH  193

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  194  FSEAECYKID  203



>gb|KEH36511.1| NAD(P)H dehydrogenase B2 [Medicago truncatula]
Length=578

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 98/134 (73%), Gaps = 9/134 (7%)
 Frame = +2

Query  170  QRFARTFREN-PSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            +RF +T R+N  ++  +LI  TVSG   VAY E   P E   + D       +K+VVVLG
Sbjct  8    ERFCKTLRDNRKTIKFVLIGTTVSGVGYVAYREFY-PSEVEAVTD-------RKKVVVLG  59

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWA TSF+KNL  P Y+VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI RKK V
Sbjct  60   TGWAATSFMKNLDSPKYEVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKRV  119

Query  527  DMQYCEAECIKIDA  568
            D+Q+ EAEC KIDA
Sbjct  120  DVQFSEAECFKIDA  133



>dbj|BAM13876.1| type II NAD(P)H dehydrogenase [Arum maculatum]
Length=581

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 7/128 (5%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQ--KKRVVVLGTGWAG  361
             R NP  S+LL+VF V GG LV Y+++       +LG  +E N    KK+VV+LGTGWAG
Sbjct  15   LRRNPGFSRLLVVFAVGGGGLVVYADSNA-----DLGVPSEQNKMPTKKKVVILGTGWAG  69

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            TSFLKNL    YDV V+SPRNYFAFTPLLPSVTCGTV+ RSIVEP+RNIIRKK   +++ 
Sbjct  70   TSFLKNLDSSLYDVHVVSPRNYFAFTPLLPSVTCGTVDARSIVEPVRNIIRKKGGGVKFW  129

Query  542  EAECIKID  565
            EA+C KID
Sbjct  130  EADCCKID  137



>ref|XP_010689480.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=579

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 102/130 (78%), Gaps = 3/130 (2%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            A+ F + P+ S++L +FTVS G +VAYSE        N+ +   +  +KK++VVLGTGWA
Sbjct  11   AKVFNDYPTYSRILFLFTVSSGGMVAYSEYQTGRGPQNIEN-KHMEPKKKKMVVLGTGWA  69

Query  359  GTSFLKNLKDPS-YDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            G SF+K+L DPS YDV+V+SPRNYFAFTPLLPSVTCGTVE RS+VEPIRNI++K+  +++
Sbjct  70   GISFIKDL-DPSIYDVKVVSPRNYFAFTPLLPSVTCGTVEARSVVEPIRNILKKRTGEIK  128

Query  536  YCEAECIKID  565
            +CEAEC KID
Sbjct  129  FCEAECTKID  138



>ref|XP_008803856.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial isoform X3 [Phoenix dactylifera]
Length=551

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 96/131 (73%), Gaps = 9/131 (7%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPH--ESNNLGDLTEVNHQKKRVVVLGTG  352
            +R F   P+ SKL+++   SGG LVAY+++   H  ES+ +         KK+VVVLGTG
Sbjct  12   SRAFHHRPTFSKLVVILAASGGGLVAYADSKSDHAIESSRVA-------PKKKVVVLGTG  64

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGT+FLKNL    YDVQV+SPRNYF FTPLLPS+TCGTVE RSIVEPIR II+KK  ++
Sbjct  65   WAGTTFLKNLDSSLYDVQVVSPRNYFTFTPLLPSITCGTVEPRSIVEPIRRIIKKKGGEI  124

Query  533  QYCEAECIKID  565
            ++ EAEC KID
Sbjct  125  KFWEAECFKID  135



>ref|XP_008793641.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Phoenix dactylifera]
Length=579

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 96/130 (74%), Gaps = 9/130 (7%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPH--ESNNLGDLTEVNHQKKRVVVLGTGW  355
            R F   P+ +KL+++   SGG LVAY+++   H  ES+ +         KK+VVVLGTGW
Sbjct  13   RAFHHRPNFTKLVVILAASGGGLVAYADSKSDHAIESSEVA-------PKKKVVVLGTGW  65

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGT+FLKNL    YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIR II+KK  +++
Sbjct  66   AGTTFLKNLDSSLYDVQVVSPRNYFAFTPLLPSVTCGTVEPRSIVEPIRKIIKKKGGEIK  125

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  126  FWEAECFKID  135



>ref|XP_009375384.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X2 [Pyrus x bretschneideri]
Length=517

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEA-TKPHESNNLGDLTEVNHQKKRVVVLGT  349
            R ++ F + P  SK+L+V  VSGG  VAY+EA ++P   ++   + +  ++KK++VVLGT
Sbjct  9    RVSKAFHDYPKASKMLVVVAVSGGGYVAYAEANSEPKLISSTPGIDQGENKKKKIVVLGT  68

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFL+NLK+P+Y+VQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RK+  D
Sbjct  69   GWAGTSFLRNLKNPNYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVRKEVED  128

Query  530  MQ  535
             Q
Sbjct  129  AQ  130



>ref|XP_008230218.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial [Prunus mume]
Length=582

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            +R  R++PSLSKLL+  TVSGG L A+ E T  H         +   +KK+VVVLGTGWA
Sbjct  11   SRLLRQHPSLSKLLVAVTVSGGGLAAFHETTPVHTVYADSVQEDQIAKKKKVVVLGTGWA  70

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            G SFLKNLK  +YDV+V+SP+NYF FTPLLPSVTCGTVE RSIVEPIR I +KK +++Q+
Sbjct  71   GVSFLKNLKSSNYDVEVVSPKNYFLFTPLLPSVTCGTVEARSIVEPIRCITKKKGLEVQF  130

Query  539  CEAECIKID  565
             EA C KID
Sbjct  131  REAVCHKID  139



>ref|XP_008803854.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial isoform X1 [Phoenix dactylifera]
Length=579

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 96/131 (73%), Gaps = 9/131 (7%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPH--ESNNLGDLTEVNHQKKRVVVLGTG  352
            +R F   P+ SKL+++   SGG LVAY+++   H  ES+ +         KK+VVVLGTG
Sbjct  12   SRAFHHRPTFSKLVVILAASGGGLVAYADSKSDHAIESSRVA-------PKKKVVVLGTG  64

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGT+FLKNL    YDVQV+SPRNYF FTPLLPS+TCGTVE RSIVEPIR II+KK  ++
Sbjct  65   WAGTTFLKNLDSSLYDVQVVSPRNYFTFTPLLPSITCGTVEPRSIVEPIRRIIKKKGGEI  124

Query  533  QYCEAECIKID  565
            ++ EAEC KID
Sbjct  125  KFWEAECFKID  135



>ref|XP_007217323.1| hypothetical protein PRUPE_ppa019962mg [Prunus persica]
 gb|EMJ18522.1| hypothetical protein PRUPE_ppa019962mg [Prunus persica]
Length=582

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            +R  R++PS+SKLL+V TVSGG L A+ E T  H         +   +KK+VVVLGTGWA
Sbjct  11   SRLLRKHPSVSKLLVVVTVSGGGLAAFHETTPVHTVYADSVQEDQIAKKKKVVVLGTGWA  70

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            G SFLKNLK  +YDV+V+SP+NYF FTPLLPSVTCGTVE RSIVEPIR I +KK +++Q+
Sbjct  71   GVSFLKNLKSSNYDVEVVSPKNYFLFTPLLPSVTCGTVEARSIVEPIRCITKKKGLEVQF  130

Query  539  CEAECIKID  565
             EA C KID
Sbjct  131  REAVCHKID  139



>gb|AFN53706.1| putative dead box ATP-dependent RNA helicase [Linum usitatissimum]
Length=1272

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 90/110 (82%), Gaps = 6/110 (5%)
 Frame = +2

Query  239  GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISP  418
            GG LVAY++A      N+L  +     +KKRVVVLGTGWAGTSFLK L DPSYDVQVISP
Sbjct  799  GGGLVAYADA------NSLSHVAPPEIKKKRVVVLGTGWAGTSFLKQLNDPSYDVQVISP  852

Query  419  RNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            RNYFAFTPLLPSVT GTVE RSIVEPIRNI++KKNVD++Y EAEC KID+
Sbjct  853  RNYFAFTPLLPSVTVGTVEPRSIVEPIRNIVKKKNVDVRYWEAECFKIDS  902



>ref|XP_006582334.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Glycine max]
Length=572

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 96/130 (74%), Gaps = 10/130 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTV-SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F E PS SK ++V TV S G LVAY +A KP  +N          QKK+VVVLGTGW
Sbjct  11   SRVFNEYPSWSKSVVVCTVISSGGLVAYCDA-KPEYANQ--------SQKKKVVVLGTGW  61

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGTSFLKN+K  SYD+ V+ PRNYFAFTPLLPSVTCGTVE RS+VEPIR+I RK  V++ 
Sbjct  62   AGTSFLKNMKSNSYDIHVVLPRNYFAFTPLLPSVTCGTVEARSVVEPIRSITRKSGVNIH  121

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  122  FSEAECYKID  131



>ref|XP_004486261.1| PREDICTED: NAD(P)H dehydrogenase B2, mitochondrial-like [Cicer 
arietinum]
Length=633

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 99/135 (73%), Gaps = 10/135 (7%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKL-LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
             +R ++TF ++ S  KL L+   VSGG ++AY E   P E+            KK+VVVL
Sbjct  63   FERLSKTFHDHRSHLKLVLLCSAVSGGGILAYGELA-PSEA--------AVTDKKKVVVL  113

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWA TSF+KNL +P Y+VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI RKK 
Sbjct  114  GTGWAATSFMKNLNNPRYEVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKK  173

Query  524  VDMQYCEAECIKIDA  568
            V++Q+ EAEC KIDA
Sbjct  174  VNVQFNEAECYKIDA  188



>ref|XP_009350613.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Pyrus x bretschneideri]
Length=582

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 96/130 (74%), Gaps = 2/130 (2%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVN-HQKKRVVVLGTGW  355
            +R F +  SLSK+L+V TVSGG L  + E TKP  +       E    +KK+VVVLGTGW
Sbjct  11   SRLFHQRSSLSKILVVVTVSGGGLATFHE-TKPVHTVYADSAQEAETSKKKKVVVLGTGW  69

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AG SFLKNL+  SYDV+V+SP+NYF FTPLLPSVTCGTVE RSIVEPIR I  KK +D++
Sbjct  70   AGVSFLKNLRSSSYDVEVVSPKNYFMFTPLLPSVTCGTVEARSIVEPIRKITDKKGLDVE  129

Query  536  YCEAECIKID  565
            + EAEC +ID
Sbjct  130  FREAECYRID  139



>dbj|BAM13872.1| type II NAD(P)H dehydrogenase [Symplocarpus renifolius]
Length=580

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 94/127 (74%), Gaps = 7/127 (6%)
 Frame = +2

Query  191  RENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNH--QKKRVVVLGTGWAGT  364
            R N + SKLL+VF V  G LV Y++A   H     G +TE +    KK+VVVLGTGWAGT
Sbjct  15   RRNSAFSKLLVVFAVGSGGLVVYADANPNH-----GLITEQSEVSAKKKVVVLGTGWAGT  69

Query  365  SFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCE  544
            SFLKNL    YDVQV+SPRNYFAFTPLLPSVTCGTV+ RS+VEPIR II+KK  ++++ E
Sbjct  70   SFLKNLDSSLYDVQVVSPRNYFAFTPLLPSVTCGTVDARSVVEPIRKIIKKKGGEIKFWE  129

Query  545  AECIKID  565
            AEC  ID
Sbjct  130  AECYNID  136



>ref|XP_011100342.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like [Sesamum indicum]
Length=577

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +2

Query  176  FARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            F R    + + +KLL V ++S GSL++Y+E+    + ++   + +   Q+K+VVVLGTGW
Sbjct  7    FNRILGGDRASAKLLFVCSLSSGSLISYAESPSNGDGSSFTQIQK-ETQRKKVVVLGTGW  65

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGTSFLK+L   SYDVQV+SPRNYFAFTPLLPSVTCGTV+ RSIVEP+RNII+K+N +++
Sbjct  66   AGTSFLKDLDISSYDVQVVSPRNYFAFTPLLPSVTCGTVDARSIVEPVRNIIKKRNGEIK  125

Query  536  YCEAECIKID  565
            + EAEC+KID
Sbjct  126  FWEAECLKID  135



>gb|KHN07323.1| External alternative NADH-ubiquinone oxidoreductase, mitochondrial 
[Glycine soja]
Length=581

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 99/135 (73%), Gaps = 6/135 (4%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKL-LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
              R +R FR++ S  KL L+  TVSGG +VAY EA                 +KK+VVVL
Sbjct  7    FDRVSRAFRDHGSNFKLVLLCTTVSGGGIVAYGEAAVAASEA-----AAAATEKKKVVVL  61

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFL+NL +P Y+V V+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI RKK 
Sbjct  62   GTGWAGTSFLRNLDNPKYEVHVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKK  121

Query  524  VDMQYCEAECIKIDA  568
            +DMQ+ EAEC+KIDA
Sbjct  122  MDMQFSEAECLKIDA  136



>ref|XP_003529293.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Glycine max]
Length=580

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 7/135 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKL-LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
              R +R FR++ S  KL L+  TVSGG +VAY EA    E+           +KK+VVVL
Sbjct  7    FDRVSRAFRDHGSNFKLVLLCTTVSGGGIVAYGEAVAASEA------AAAATEKKKVVVL  60

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFL+NL +P Y+V V+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI RKK 
Sbjct  61   GTGWAGTSFLRNLDNPKYEVHVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKK  120

Query  524  VDMQYCEAECIKIDA  568
            +DMQ+ EAEC+KIDA
Sbjct  121  MDMQFSEAECLKIDA  135



>ref|XP_009420534.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=576

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 96/128 (75%), Gaps = 7/128 (5%)
 Frame = +2

Query  185  TFRENPSLSKLLIVFTVSGGSLVAYSEA-TKPHESNNLGDLTEVNHQKKRVVVLGTGWAG  361
             FR +P+ SKL+++F  SGG LVAY++A T P    +          KK++VVLGTGWAG
Sbjct  11   AFRRSPAFSKLVLIFAASGGGLVAYADARTDPAAEPSQ------TAPKKKMVVLGTGWAG  64

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            T+F++N+    YDVQVISPRNYFAFTPLLPSVTCGTVE RSIVEPIR IIRKK  ++++ 
Sbjct  65   TTFVRNVDSSLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSIVEPIRKIIRKKGGEIKFW  124

Query  542  EAECIKID  565
            EAEC KID
Sbjct  125  EAECFKID  132



>emb|CAN59739.1| hypothetical protein VITISV_027063 [Vitis vinifera]
Length=578

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +2

Query  233  VSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVI  412
            +S G LVAYSE+     + +  ++ +   QKKRVVVLGTGWAGTSFLK+L   SYDV+V+
Sbjct  29   ISSGGLVAYSESQTDAGAQS-AEIKQKEPQKKRVVVLGTGWAGTSFLKDLDISSYDVKVV  87

Query  413  SPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNII+K++ ++QY EAEC+KIDA
Sbjct  88   SPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIIKKRSGEIQYWEAECVKIDA  139



>gb|KHN00103.1| External alternative NADH-ubiquinone oxidoreductase, mitochondrial 
[Glycine soja]
Length=578

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 9/135 (7%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKL-LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVL  343
             +R +R FR++ S  KL L+  TVSGG ++AY EA                 +KK+VVVL
Sbjct  7    FERVSRAFRDHGSNFKLVLLCTTVSGGGVLAYGEAVAE--------AAATTTEKKKVVVL  58

Query  344  GTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKN  523
            GTGWAGTSFL+NL +P Y+V V+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNI RKK 
Sbjct  59   GTGWAGTSFLRNLDNPKYEVHVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKK  118

Query  524  VDMQYCEAECIKIDA  568
            +DMQ+ EAEC+KIDA
Sbjct  119  MDMQFSEAECLKIDA  133



>ref|XP_008368499.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Malus domestica]
Length=582

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 95/130 (73%), Gaps = 2/130 (2%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVN-HQKKRVVVLGTGW  355
            +R F +  SL K+L+V TVSGG L  + E TKP  +       E    +KK+VVVLGTGW
Sbjct  11   SRLFHQRSSLXKILVVVTVSGGGLATFHE-TKPVHTVYADSAQEAETSRKKKVVVLGTGW  69

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AG SFLKNL+  SYDV+V+SP+NYF FTPLLPSVTCGTVE RSIVEPIR I  KK +D++
Sbjct  70   AGVSFLKNLRSSSYDVEVVSPKNYFMFTPLLPSVTCGTVEARSIVEPIRKITEKKGLDVE  129

Query  536  YCEAECIKID  565
            + EAEC +ID
Sbjct  130  FREAECYRID  139



>ref|XP_006447379.1| hypothetical protein CICLE_v10014668mg [Citrus clementina]
 ref|XP_006447380.1| hypothetical protein CICLE_v10014668mg [Citrus clementina]
 gb|ESR60619.1| hypothetical protein CICLE_v10014668mg [Citrus clementina]
 gb|ESR60620.1| hypothetical protein CICLE_v10014668mg [Citrus clementina]
Length=599

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVS--GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVV  340
            ++R +  F  + + S+LL++ T+S  GG LVAYSE ++    +   +  E   +KKRVV+
Sbjct  27   VRRASGAFSGSSTYSRLLVLCTLSLSGGGLVAYSE-SQSEPGSPASEHGEKEREKKRVVL  85

Query  341  LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKK  520
            LGTGWAG SFLK+L   SYDVQV+SP+NYFAFTPLLPSVTCGTVE RSI EP+RNII+K+
Sbjct  86   LGTGWAGISFLKDLDVSSYDVQVVSPQNYFAFTPLLPSVTCGTVEARSIAEPVRNIIKKR  145

Query  521  NVDMQYCEAECIKIDA  568
            N ++Q+ EAE IKIDA
Sbjct  146  NAEIQFWEAEAIKIDA  161



>emb|CDP14696.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 3/132 (2%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            QR    F ++P+++KLL+V +VSGG + A+S+A +P +     D    + +KK+VVVLGT
Sbjct  8    QRAKGAFHDHPTVTKLLVVLSVSGGGVAAFSDA-RPFQFG-YADAAH-DVKKKKVVVLGT  64

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLK+LKDPSYDV VISPRNYFAFTPLLPSVT GTVE RSIVEPIR+I+RKK  D
Sbjct  65   GWAGTSFLKSLKDPSYDVHVISPRNYFAFTPLLPSVTNGTVEARSIVEPIRSIVRKKKFD  124

Query  530  MQYCEAECIKID  565
            + + EAEC KID
Sbjct  125  VHFKEAECYKID  136



>ref|XP_006469842.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X1 [Citrus sinensis]
 ref|XP_006469843.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X2 [Citrus sinensis]
Length=606

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVS--GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVV  340
            ++R +  F  + + S+LL++ T+S  GG LVAYSE ++    +   +  E   +KKRVV+
Sbjct  34   VRRASGAFSGSSTYSRLLVLCTLSLSGGGLVAYSE-SQSEPGSPASEHGEKEREKKRVVL  92

Query  341  LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKK  520
            LGTGWAG SFLK+L   SYDVQV+SP+NYFAFTPLLPSVTCGTVE RSI EP+RNII+K+
Sbjct  93   LGTGWAGISFLKDLDVSSYDVQVVSPQNYFAFTPLLPSVTCGTVEARSIAEPVRNIIKKR  152

Query  521  NVDMQYCEAECIKIDA  568
            N ++Q+ EAE IKIDA
Sbjct  153  NAEIQFWEAEAIKIDA  168



>ref|XP_002517991.1| Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF44509.1| Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial 
precursor, putative [Ricinus communis]
Length=579

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            +R  R F +NP+  KLL++ TVS   L+A+S+A +    + + +  +   +KK+VVVLGT
Sbjct  8    ERVFRAFHDNPTFPKLLVLSTVSSCGLLAFSDANQSQ--SLVSESAQSECKKKKVVVLGT  65

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAG SFLKNLK  SY+V V+SPRNYFAFTPLLPSVT GTVE RSIVEP+RNI+RKK   
Sbjct  66   GWAGVSFLKNLKSSSYEVHVVSPRNYFAFTPLLPSVTNGTVEARSIVEPLRNIVRKKPFK  125

Query  530  MQYCEAECIKID  565
            +++ EAEC KID
Sbjct  126  VEFKEAECYKID  137



>gb|KEH29603.1| NAD(P)H dehydrogenase B2 [Medicago truncatula]
Length=569

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 97/131 (74%), Gaps = 14/131 (11%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTV-SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F E PS SK ++V T+ SGG L AYS++         GD       +K+VVVLGTGW
Sbjct  11   SRVFHEYPSWSKSVVVCTIISGGGLAAYSDS---------GD----QRPRKKVVVLGTGW  57

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGTSF+K++K+ SYD+ V+SPRNYFAFTPLLPSVTCGTVE RSI+EPIR I RK  +D+Q
Sbjct  58   AGTSFVKSMKNSSYDIHVVSPRNYFAFTPLLPSVTCGTVEARSIIEPIRKISRKSGLDVQ  117

Query  536  YCEAECIKIDA  568
            + EAEC KID+
Sbjct  118  FSEAECYKIDS  128



>ref|XP_010904945.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Elaeis guineensis]
Length=578

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 98/131 (75%), Gaps = 6/131 (5%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTG  352
            R ++ F  +P  SKLL++F V  G +VAY++A   H    + + +EV+  KK++VVLGTG
Sbjct  10   RASQAFHRSPKFSKLLVIFAVGAGGIVAYADAKSGH----VVESSEVS-GKKKLVVLGTG  64

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAG SFLKNL    YDVQV+SPRNYFAFTPLLPSVTCGTVE RSI+EPIRNI++KK   +
Sbjct  65   WAGMSFLKNLDTSLYDVQVVSPRNYFAFTPLLPSVTCGTVESRSIIEPIRNIVKKKG-GV  123

Query  533  QYCEAECIKID  565
            ++ EAEC  ID
Sbjct  124  KFWEAECFNID  134



>emb|CAA18713.1| NADH dehydrogenase like protein [Arabidopsis thaliana]
 emb|CAB81256.1| NADH dehydrogenase like protein [Arabidopsis thaliana]
Length=478

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 4/110 (4%)
 Frame = +2

Query  236  SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVIS  415
            SGG L+ YSEA   + +N +    E   +K++VV+LGTGWAG SFLK L + SY+VQVIS
Sbjct  18   SGGGLIVYSEANPSYSNNGV----ETKTRKRKVVLLGTGWAGASFLKTLNNSSYEVQVIS  73

Query  416  PRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            PRNYFAFTPLLPSVTCGTVE RS+VEPIRNI RK+NV+M + EAEC KID
Sbjct  74   PRNYFAFTPLLPSVTCGTVEARSVVEPIRNIARKQNVEMSFLEAECFKID  123



>gb|KJB77327.1| hypothetical protein B456_012G131700 [Gossypium raimondii]
Length=525

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVS--GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            R +R F   P+ +KLL++ T+S  GG +VAYSEA       ++  + E + +KKRVVVLG
Sbjct  9    RASRAFNGYPASAKLLLLCTLSLSGGGVVAYSEAQVDASKTSV-QVNEKDCKKKRVVVLG  67

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLK+L   +YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N 
Sbjct  68   TGWAGISFLKDLDVSAYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNG  127

Query  527  DMQYCEAECIKIDA  568
            ++Q+ EAEC+KIDA
Sbjct  128  EIQFWEAECMKIDA  141



>gb|KHN22896.1| External NADH-ubiquinone oxidoreductase 1, mitochondrial [Glycine 
soja]
Length=573

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 98/132 (74%), Gaps = 13/132 (10%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTV-SGGSLVAYSEATKPHESNNLGDLTEVNHQ--KKRVVVLGT  349
            +R F + PS +K ++V +V S G LVAY +A KP           VNH+  KK+VVVLGT
Sbjct  11   SRVFNDCPSWAKTVVVCSVISSGGLVAYCDA-KPEY---------VNHESKKKKVVVLGT  60

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLKN+K  SYD+ V+SPRNYFAFTPLLPSVTCGTVE RS+VEPIR+I RK  V+
Sbjct  61   GWAGTSFLKNMKSNSYDIHVVSPRNYFAFTPLLPSVTCGTVEARSVVEPIRSITRKSGVN  120

Query  530  MQYCEAECIKID  565
            + + EAEC KID
Sbjct  121  IHFSEAECYKID  132



>ref|XP_007132629.1| hypothetical protein PHAVU_011G111200g [Phaseolus vulgaris]
 gb|ESW04623.1| hypothetical protein PHAVU_011G111200g [Phaseolus vulgaris]
Length=575

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 94/130 (72%), Gaps = 10/130 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTV-SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F E PS SK ++V TV SGG  VA+ +  KP   N           KK+VVVLGTGW
Sbjct  12   SRVFNEYPSWSKSVLVCTVISGGGAVAFCD-VKPESGNE--------SPKKKVVVLGTGW  62

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGTSFLKN+K  SYD+ V+SPRNYFAFTPLLPSVTCGTVE RS+VEPIR+I RK  V++ 
Sbjct  63   AGTSFLKNMKSTSYDIHVVSPRNYFAFTPLLPSVTCGTVEARSVVEPIRSITRKSGVNIH  122

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  123  FSEAECYKID  132



>gb|KJB77326.1| hypothetical protein B456_012G131700 [Gossypium raimondii]
Length=582

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVS--GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            R +R F   P+ +KLL++ T+S  GG +VAYSEA       ++  + E + +KKRVVVLG
Sbjct  9    RASRAFNGYPASAKLLLLCTLSLSGGGVVAYSEAQVDASKTSV-QVNEKDCKKKRVVVLG  67

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLK+L   +YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N 
Sbjct  68   TGWAGISFLKDLDVSAYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNG  127

Query  527  DMQYCEAECIKIDA  568
            ++Q+ EAEC+KIDA
Sbjct  128  EIQFWEAECMKIDA  141



>dbj|BAM13873.1| type II NAD(P)H dehydrogenase [Symplocarpus renifolius]
Length=580

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = +2

Query  191  RENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSF  370
            R N + SKLL+VF V  G LV Y++A KP+ S  + + +EV   KK+VVVLGTGWAGTSF
Sbjct  15   RRNSAFSKLLVVFAVGSGGLVVYADA-KPNHSL-ITEQSEVP-AKKKVVVLGTGWAGTSF  71

Query  371  LKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAE  550
            LKN+    YDVQV+SPRNYFAFTPLLPSVTCGTV+ RS+VEPIR II+KK  ++++ EAE
Sbjct  72   LKNMDSSLYDVQVVSPRNYFAFTPLLPSVTCGTVDARSVVEPIRKIIKKKGGEIRFWEAE  131

Query  551  CIKID  565
            C  +D
Sbjct  132  CYNVD  136



>ref|XP_008224954.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial [Prunus mume]
Length=587

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEAT---KPHESNNLGDLTEVNHQKKRVV  337
              R +R F + PS+ K+L+V  VSG  LVAY+EA    K   S  +    EV+++KK+VV
Sbjct  7    FDRVSRAFHDYPSVPKVLVVVAVSGCGLVAYAEANPERKLASSAPVLTSAEVDNKKKKVV  66

Query  338  VLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRK  517
            VLGTGWAGTSFL+NLK+P Y+V VISPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI RK
Sbjct  67   VLGTGWAGTSFLRNLKNPDYEVHVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIARK  126

Query  518  KNVDMQYCEAECIKIDA  568
            K VD+Q+ EA C+KIDA
Sbjct  127  KTVDVQFSEAACLKIDA  143



>sp|M1BYJ7.1|ENDB1_SOLTU RecName: Full=External alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial; AltName: Full=External alternative 
NADH dehydrogenase NDB1; AltName: Full=NADH:ubiquinone reductase 
(non-electrogenic) NDB1; Flags: Precursor [Solanum tuberosum]
Length=577

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +2

Query  176  FARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
             ++    + S SKLL++ +VS G L+ Y+E+        + +  +   +KKRVVVLGTGW
Sbjct  7    LSKVLHSHSSYSKLLVLCSVSTGGLLVYAESN-VESGKQVVEQNQPESKKKRVVVLGTGW  65

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
             GTSFLK++   SYDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K++ ++Q
Sbjct  66   GGTSFLKDVDISSYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRSGEIQ  125

Query  536  YCEAECIKID  565
            + EAEC+KID
Sbjct  126  FWEAECLKID  135



>ref|NP_001274854.1| external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial 
[Solanum tuberosum]
 sp|Q9ST62.1|NDB1_SOLTU RecName: Full=External alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial; AltName: Full=External alternative 
NADH dehydrogenase NDB1; AltName: Full=NADH:ubiquinone reductase 
(non-electrogenic) NDB1; Flags: Precursor [Solanum tuberosum]
 emb|CAB52797.1| external rotenone-insensitive NADPH dehydrogenase [Solanum tuberosum]
Length=577

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +2

Query  176  FARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
             ++    + S SKLL++ +VS G L+ Y+E+        + +  +   +KKRVVVLGTGW
Sbjct  7    LSKVLHSHSSYSKLLVLCSVSTGGLLVYAESN-VESGKQVVEQNQPESKKKRVVVLGTGW  65

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
             GTSFLK++   SYDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K++ ++Q
Sbjct  66   GGTSFLKDVDISSYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRSGEIQ  125

Query  536  YCEAECIKID  565
            + EAEC+KID
Sbjct  126  FWEAECLKID  135



>ref|XP_008455351.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Cucumis melo]
Length=575

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 103/133 (77%), Gaps = 7/133 (5%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIV-FTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            R +  F  +P+ SKLL++  T+SGG L+AY+++    +S+  G + E    KKRVVVLGT
Sbjct  9    RASTAFHGSPAYSKLLLISTTLSGGGLLAYADS----QSDVGGSIEE--SPKKRVVVLGT  62

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GWAGTSFLK+L    YDVQV+SP+NYF+FTPLLPSVTCG+VE RSIVEP+RNI++K+  +
Sbjct  63   GWAGTSFLKDLDASKYDVQVVSPQNYFSFTPLLPSVTCGSVEARSIVEPVRNIVKKRKGE  122

Query  530  MQYCEAECIKIDA  568
            +++ EAEC KIDA
Sbjct  123  IKFWEAECFKIDA  135



>gb|KHG23704.1| putative NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial 
[Gossypium arboreum]
Length=540

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +2

Query  239  GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISP  418
            GG +VAYSEA       ++  + E + +KKRVVVLGTGWAG SFLK+L   +YDVQV+SP
Sbjct  33   GGGVVAYSEAQVDASKTSV-QVNEKDCKKKRVVVLGTGWAGISFLKDLDVSAYDVQVVSP  91

Query  419  RNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            RNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N ++Q+ EAEC+KIDA
Sbjct  92   RNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNGEIQFWEAECMKIDA  141



>ref|XP_008803855.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial isoform X2 [Phoenix dactylifera]
Length=578

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 10/131 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPH--ESNNLGDLTEVNHQKKRVVVLGTG  352
            +R F   P+ SKL+++   SGG LVAY+++   H  ES+ +         KK+VVVLGTG
Sbjct  12   SRAFHHRPTFSKLVVILAASGGGLVAYADSKSDHAIESSRVA-------PKKKVVVLGTG  64

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WAGT+FLKNL    YDVQV+SPRNYF FTPLLPS+TCGTVE RSIVEPIR II KK  ++
Sbjct  65   WAGTTFLKNLDSSLYDVQVVSPRNYFTFTPLLPSITCGTVEPRSIVEPIRRII-KKGGEI  123

Query  533  QYCEAECIKID  565
            ++ EAEC KID
Sbjct  124  KFWEAECFKID  134



>gb|EYU24870.1| hypothetical protein MIMGU_mgv1a003501mg [Erythranthe guttata]
Length=581

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 106/137 (77%), Gaps = 11/137 (8%)
 Frame = +2

Query  176  FARTFR-ENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGD-LTEVNHQ-----KKRV  334
            F R F  ++ S  KLL + ++S G L+AY+++     S+ +G+  T VN+Q     +KRV
Sbjct  7    FKRIFHGQHLSSPKLLALCSISSGGLIAYADSP----SDVVGESKTSVNNQIETKRRKRV  62

Query  335  VVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIR  514
            +VLGTGWAGTSFLK+L   +YDVQVISPRNYFAFTPLLPSVTCGTV+ RSIVEPIRNII+
Sbjct  63   LVLGTGWAGTSFLKDLDISTYDVQVISPRNYFAFTPLLPSVTCGTVDARSIVEPIRNIIK  122

Query  515  KKNVDMQYCEAECIKID  565
            K++ +++Y EAEC+K+D
Sbjct  123  KRDGEIKYWEAECLKVD  139



>ref|XP_004248145.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Solanum lycopersicum]
Length=577

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +2

Query  176  FARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
             ++    + S SKLL++ ++S G L+ Y+E+        + +  +   +KKRVVVLGTGW
Sbjct  7    LSKVLHSHSSYSKLLVLCSISTGGLLVYAESN-VESGKQVVEQNQPESKKKRVVVLGTGW  65

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
             GTSFLK+L   SYDV+V+SPRNYFAFTPLLPSVTCGTVE RS+VEP+RNII+K++ ++Q
Sbjct  66   GGTSFLKDLDISSYDVKVVSPRNYFAFTPLLPSVTCGTVEARSVVEPVRNIIKKRSGEIQ  125

Query  536  YCEAECIKID  565
            + EAEC+KID
Sbjct  126  FWEAECLKID  135



>ref|XP_011085370.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X1 [Sesamum indicum]
Length=571

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 7/130 (5%)
 Frame = +2

Query  176  FARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            F R   ++P+ +KLL++ ++S G +VAY+E  K      +        QKKRVVVLGTGW
Sbjct  7    FNRFLHDHPTSTKLLLLSSLSSGGVVAYAEGKKSVSPQEIT-------QKKRVVVLGTGW  59

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGTSFLK+L   +YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N +++
Sbjct  60   AGTSFLKDLDISTYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNGEIK  119

Query  536  YCEAECIKID  565
            + EAEC+KID
Sbjct  120  FWEAECLKID  129



>ref|XP_010905569.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Elaeis guineensis]
Length=578

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
              R ++    + + SKL++V  VS G +VAY++A   H+  +    ++V+  KK++VVLG
Sbjct  8    FDRASQALHHSRAFSKLIVVVAVSSGGIVAYADAKSDHDVES----SQVS-GKKKLVVLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNL    YDVQV+SPRNYFAFTPLLPS+TCGTVE RSIVEPIRNI+RKK  
Sbjct  63   TGWAGTSFLKNLDASLYDVQVVSPRNYFAFTPLLPSITCGTVEPRSIVEPIRNIVRKKG-  121

Query  527  DMQYCEAECIKID  565
             +++ EAEC KID
Sbjct  122  GVRFWEAECFKID  134



>gb|KJB69423.1| hypothetical protein B456_011G023000 [Gossypium raimondii]
Length=585

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 94/137 (69%), Gaps = 11/137 (8%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVV----  340
            R    F + PSLSK+++V T+S GSL+AYSEA     + N G+   V H           
Sbjct  9    RLCTAFHDYPSLSKIIVVSTLSSGSLIAYSEA-----NTNNGNRGRVAHADAVASKKKKV  63

Query  341  --LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIR  514
              LGTGWA  +FLKNL +  Y+V+V+SPRN+F FTPLLPSVTCG VE RSIVEPIRNIIR
Sbjct  64   VVLGTGWAAMTFLKNLNNSIYEVEVVSPRNFFLFTPLLPSVTCGKVEARSIVEPIRNIIR  123

Query  515  KKNVDMQYCEAECIKID  565
            KKN+D+ Y EAEC KID
Sbjct  124  KKNIDVSYREAECTKID  140



>ref|XP_010227355.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial isoform X2 [Brachypodium distachyon]
Length=529

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSY  397
            L++   SGG +VAY+++++  E++   +  +V  +KK+VVVLGTGWAGTSFLKNL    Y
Sbjct  29   LLLTAASGGGIVAYADSSRAEEASEPSE--QVAPRKKKVVVLGTGWAGTSFLKNLDCSRY  86

Query  398  DVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            DV+VISPRNYFAFTPLLPSVTCGTVE RSIVEPIR +  KK  D+ Y EAEC KIDA
Sbjct  87   DVKVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRRMFEKKKKDVTYYEAECFKIDA  143



>ref|XP_009397153.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=579

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 98/133 (74%), Gaps = 5/133 (4%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            + R ++  R  P++SKL+++  +S G ++AY++A   H+     +LT    +KK++VVLG
Sbjct  8    LDRASQAIRRRPTISKLIVICALSSGGVLAYADAKSDHDFET-SELT----RKKKLVVLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFL+NL    YDVQV+SPRNYF FTPLLPSVTCGTVE RSIVEPIR I+ KK  
Sbjct  63   TGWAGTSFLRNLDTSQYDVQVVSPRNYFLFTPLLPSVTCGTVEPRSIVEPIRKIMHKKVG  122

Query  527  DMQYCEAECIKID  565
             +++ EAEC KID
Sbjct  123  GIKFWEAECYKID  135



>ref|XP_008800394.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Phoenix dactylifera]
Length=578

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
              R ++    +P+ SKL++VF VS G +VAY++A    +S+++ + ++V+  KK++VVLG
Sbjct  8    FDRASQALNRSPAFSKLIVVFAVSSGGIVAYADA----KSDHVAESSQVSG-KKKLVVLG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFLKN+    YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+ KKN 
Sbjct  63   TGWAGMSFLKNVDASLYDVQVVSPRNYFAFTPLLPSVTCGTVEPRSIVEPIRNIV-KKNG  121

Query  527  DMQYCEAECIKID  565
             +++ EAEC  +D
Sbjct  122  GVKFWEAECFNVD  134



>ref|XP_009629691.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial-like [Nicotiana tomentosiformis]
Length=573

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 98/133 (74%), Gaps = 7/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
             QR +R F + P L K+L++FT+SGG L A              D  + + +KK+VVVLG
Sbjct  7    FQRASRAFNDYPHLPKVLVLFTISGGGLAAVCHTA-------YADAGQNDVKKKKVVVLG  59

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLKNLKDPSY VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI++KK  
Sbjct  60   TGWAGTSFLKNLKDPSYSVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVKKKKF  119

Query  527  DMQYCEAECIKID  565
            D  + EAEC KID
Sbjct  120  DADFKEAECYKID  132



>ref|XP_003563438.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial isoform X1 [Brachypodium distachyon]
 ref|XP_010227350.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial isoform X1 [Brachypodium distachyon]
 ref|XP_010227354.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial isoform X1 [Brachypodium distachyon]
Length=589

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSY  397
            L++   SGG +VAY+++++  E++   +  +V  +KK+VVVLGTGWAGTSFLKNL    Y
Sbjct  29   LLLTAASGGGIVAYADSSRAEEASEPSE--QVAPRKKKVVVLGTGWAGTSFLKNLDCSRY  86

Query  398  DVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            DV+VISPRNYFAFTPLLPSVTCGTVE RSIVEPIR +  KK  D+ Y EAEC KIDA
Sbjct  87   DVKVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRRMFEKKKKDVTYYEAECFKIDA  143



>ref|XP_007132630.1| hypothetical protein PHAVU_011G111300g [Phaseolus vulgaris]
 gb|ESW04624.1| hypothetical protein PHAVU_011G111300g [Phaseolus vulgaris]
Length=573

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 5/123 (4%)
 Frame = +2

Query  203  SLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNH-QKKRVVVLGTGWAGTSFLKN  379
            S S+ L+V T+SGG +VA+SE+    E  ++    E N   KK+VVVLGTGWA TSFLK+
Sbjct  15   SSSRFLLVCTLSGGGVVAFSESQTGAERPSI----EANGPSKKKVVVLGTGWAATSFLKD  70

Query  380  LKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIK  559
            L    YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+  ++ + EAEC+K
Sbjct  71   LDASLYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRKGEINFWEAECVK  130

Query  560  IDA  568
            ID+
Sbjct  131  IDS  133



>gb|KEH29605.1| NAD(P)H dehydrogenase B2 [Medicago truncatula]
Length=577

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            +R    +P  S  L++ T+SGG +VA SE+    E  N+ D      +K +VVVLGTGWA
Sbjct  11   SRALTTHPFSSNFLLLCTISGGGVVALSESKSEAERPNIEDQ---QPRKTKVVVLGTGWA  67

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
              SFLK L    YDVQV+SPRNYFAFTPLLPSVTCG+VE RSIVEP+RNII+K++ ++++
Sbjct  68   AASFLKGLDGSLYDVQVVSPRNYFAFTPLLPSVTCGSVEARSIVEPVRNIIKKRDGEIKF  127

Query  539  CEAECIKIDA  568
             EAEC+KIDA
Sbjct  128  WEAECVKIDA  137



>gb|KEH29604.1| NAD(P)H dehydrogenase B2 [Medicago truncatula]
Length=550

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            +R    +P  S  L++ T+SGG +VA SE+    E  N+ D      +K +VVVLGTGWA
Sbjct  11   SRALTTHPFSSNFLLLCTISGGGVVALSESKSEAERPNIEDQ---QPRKTKVVVLGTGWA  67

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
              SFLK L    YDVQV+SPRNYFAFTPLLPSVTCG+VE RSIVEP+RNII+K++ ++++
Sbjct  68   AASFLKGLDGSLYDVQVVSPRNYFAFTPLLPSVTCGSVEARSIVEPVRNIIKKRDGEIKF  127

Query  539  CEAECIKIDA  568
             EAEC+KIDA
Sbjct  128  WEAECVKIDA  137



>ref|XP_011085371.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X2 [Sesamum indicum]
Length=570

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 101/130 (78%), Gaps = 8/130 (6%)
 Frame = +2

Query  176  FARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            F R   ++P+ +KLL++ ++SGG +VAY+E  K      +        QKKRVVVLGTGW
Sbjct  7    FNRFLHDHPTSTKLLLLSSLSGG-VVAYAEGKKSVSPQEIT-------QKKRVVVLGTGW  58

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGTSFLK+L   +YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N +++
Sbjct  59   AGTSFLKDLDISTYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNGEIK  118

Query  536  YCEAECIKID  565
            + EAEC+KID
Sbjct  119  FWEAECLKID  128



>ref|XP_010540864.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Tarenaya hassleriana]
 ref|XP_010540865.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Tarenaya hassleriana]
Length=570

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 99/129 (77%), Gaps = 11/129 (9%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            +R FR  P+ SKLL++ T+SGGSLVAYS++             E  +QKK+VVVLGTGWA
Sbjct  11   SRAFRTAPASSKLLLLCTLSGGSLVAYSDSN-----------KEKENQKKKVVVLGTGWA  59

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            G SFLK+L    YDVQV+SP+NYFAFTPLLPSVTCGTVE RSIVEP+RNI+ KK  ++++
Sbjct  60   GISFLKDLDVSCYDVQVVSPQNYFAFTPLLPSVTCGTVEARSIVEPVRNIVNKKKGEVRF  119

Query  539  CEAECIKID  565
             EA+C+KID
Sbjct  120  WEADCVKID  128



>gb|KDO55770.1| hypothetical protein CISIN_1g0458263mg, partial [Citrus sinensis]
Length=443

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +2

Query  239  GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISP  418
            GGS VA+S+ ++P +    GD  E   +KK+VVVLGTGWAGT+FLK LK  S++VQV+SP
Sbjct  1    GGSAVAFSD-SRPFQ-RIYGDSGEGEFKKKKVVVLGTGWAGTTFLKILKSNSFEVQVVSP  58

Query  419  RNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            RNYFAFTPLLPSVT GTVE RSIVEPIRNI+RKK +D+Q+ EAEC KIDA
Sbjct  59   RNYFAFTPLLPSVTNGTVEARSIVEPIRNIVRKKGMDIQFKEAECYKIDA  108



>ref|XP_006409015.1| hypothetical protein EUTSA_v10001939mg [Eutrema salsugineum]
 gb|ESQ50468.1| hypothetical protein EUTSA_v10001939mg [Eutrema salsugineum]
Length=581

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQ---KKRVVVLGTGWA  358
            F+ NPS SKLL++ T SGG L+AYS+++ P +   + D T  + Q   KK+VVVLG+GW+
Sbjct  15   FKANPSASKLLVLSTFSGGGLLAYSDSS-PLKRVLVTDATHSDGQQIRKKKVVVLGSGWS  73

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            G SFL  L +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y
Sbjct  74   GYSFLNYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEY  131

Query  539  CEAECIKIDA  568
             EAEC+KIDA
Sbjct  132  KEAECVKIDA  141



>dbj|BAJ85439.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=576

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 93/130 (72%), Gaps = 10/130 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVS-GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F   P+ + L++V   S GG LVAY++ ++P +            +KK+VVVLGTGW
Sbjct  12   SRAFNNRPTFTGLVVVLAASSGGGLVAYAD-SQPDQPQGF--------KKKKVVVLGTGW  62

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGT+FL+NL    YDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D +
Sbjct  63   AGTTFLRNLDSKLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGDFK  122

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  123  FWEAECFKID  132



>dbj|BAJ93943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=576

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 93/130 (72%), Gaps = 10/130 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVS-GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F   P+ + L++V   S GG LVAY++ ++P +            +KK+VVVLGTGW
Sbjct  12   SRAFNNRPTFTGLVVVLAASSGGGLVAYAD-SQPDQPQGF--------KKKKVVVLGTGW  62

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGT+FL+NL    YDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D +
Sbjct  63   AGTTFLRNLDSKLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGDFK  122

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  123  FWEAECFKID  132



>dbj|BAK03005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=576

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 93/130 (72%), Gaps = 10/130 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVS-GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F   P+ + L++V   S GG LVAY++ ++P +            +KK+VVVLGTGW
Sbjct  12   SRAFNNRPTFTGLVVVLAASSGGGLVAYAD-SQPDQPQGF--------KKKKVVVLGTGW  62

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGT+FL+NL    YDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D +
Sbjct  63   AGTTFLRNLDSKLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGDFK  122

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  123  FWEAECFKID  132



>dbj|BAK02312.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=576

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 93/130 (72%), Gaps = 10/130 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVS-GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F   P+ + L++V   S GG LVAY++ ++P +            +KK+VVVLGTGW
Sbjct  12   SRAFNNRPTFTGLVVVLAASSGGGLVAYAD-SQPDQPQGF--------KKKKVVVLGTGW  62

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGT+FL+NL    YDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D +
Sbjct  63   AGTTFLRNLDSKLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGDFK  122

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  123  FWEAECFKID  132



>ref|XP_003539893.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like [Glycine max]
Length=573

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 97/131 (74%), Gaps = 6/131 (5%)
 Frame = +2

Query  176  FARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNH-QKKRVVVLGTG  352
            F RT R   S S  L++ T+SGG +VAYSE+    E  ++    E N   KK+VVVLGTG
Sbjct  7    FIRTSRVLNS-SNFLLLCTLSGGGVVAYSESQSGAERPSI----EANEPAKKKVVVLGTG  61

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WA TSFLK+L    YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+  ++
Sbjct  62   WAATSFLKDLDASLYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRKGEV  121

Query  533  QYCEAECIKID  565
             + EAEC+KID
Sbjct  122  NFWEAECVKID  132



>ref|XP_010035669.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Eucalyptus grandis]
 gb|KCW47122.1| hypothetical protein EUGRSUZ_K00929 [Eucalyptus grandis]
Length=580

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R +     +P+  K L++ T+S GSL+AYS++    +   LG   +   +KK+VVVLG
Sbjct  7    LKRASGYLHGHPAGFKALVLVTLSSGSLIAYSDSQSETDRVGLGP-NQKEQKKKKVVVLG  65

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAGTSFLK++   SY+VQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+N 
Sbjct  66   TGWAGTSFLKDIDISSYEVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNG  125

Query  527  DMQYCEAECIKIDA  568
            ++Q+ EAEC+KIDA
Sbjct  126  EIQFFEAECLKIDA  139



>gb|EMT19151.1| Putative NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial 
[Aegilops tauschii]
Length=603

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 93/130 (72%), Gaps = 10/130 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVFTVS-GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGW  355
            +R F   P+ + L++V   S GG LVAY++ ++P +            +KK+VVVLGTGW
Sbjct  12   SRAFNNRPTFTGLVVVLAASSGGGLVAYAD-SQPDQPQGF--------KKKKVVVLGTGW  62

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            AGT+FL+NL    YDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D +
Sbjct  63   AGTTFLRNLDSKLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGDFK  122

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  123  FWEAECFKID  132



>tpg|DAA57351.1| TPA: hypothetical protein ZEAMMB73_528090 [Zea mays]
Length=272

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            + R A   R  P   K L++F V   +L      T   + N +  + +    KK+VV+LG
Sbjct  9    VHRAAEAVRRTPRWKKRLVLFAVGASTL------TYACQDNRVLQICDGTGNKKKVVILG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+N 
Sbjct  63   TGWAGASFLRNIDTSLYDVHVVSPRNYFTFTPLLPSVTCGTVEARSIVEPIRNIVRKRNG  122

Query  527  DMQYCEAECIKID  565
              ++ EAECIKID
Sbjct  123  SFRFWEAECIKID  135



>ref|XP_006357529.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like [Solanum tuberosum]
Length=576

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 98/122 (80%), Gaps = 3/122 (2%)
 Frame = +2

Query  203  SLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQK-KRVVVLGTGWAGTSFLKN  379
            S S+LL+V  +S G L+ Y+E    +E   + + + ++ +K K++VVLGTGWAGTSFLK+
Sbjct  16   SCSRLLVVSCISSGGLLVYAENVDNNE--KIVERSRLDSKKRKKIVVLGTGWAGTSFLKD  73

Query  380  LKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIK  559
            +   SYD++V+SPRNYFAFTPLLPSVTCGTVE RS+VEP+RNII+K+N ++Q+ EAEC+K
Sbjct  74   MDISSYDIEVVSPRNYFAFTPLLPSVTCGTVEARSVVEPVRNIIKKRNGEIQFWEAECLK  133

Query  560  ID  565
            ID
Sbjct  134  ID  135



>gb|KHN22897.1| External NADH-ubiquinone oxidoreductase 1, mitochondrial [Glycine 
soja]
Length=631

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 97/131 (74%), Gaps = 6/131 (5%)
 Frame = +2

Query  176  FARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNH-QKKRVVVLGTG  352
            F RT R   S S  L++ T+SGG +VAYSE+    E  ++    E N   KK+VVVLGTG
Sbjct  65   FWRTSRVLNS-SNFLLLCTLSGGGVVAYSESQSGAERPSI----EANEPAKKKVVVLGTG  119

Query  353  WAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDM  532
            WA TSFLK+L    YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K+  ++
Sbjct  120  WAATSFLKDLDASLYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRKGEV  179

Query  533  QYCEAECIKID  565
             + EAEC+KID
Sbjct  180  NFWEAECVKID  190



>ref|XP_007214667.1| hypothetical protein PRUPE_ppa003286mg [Prunus persica]
 gb|EMJ15866.1| hypothetical protein PRUPE_ppa003286mg [Prunus persica]
Length=587

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEAT---KPHESNNLGDLTEVNHQKKRVV  337
              R +R F + PS+ K+L+V  VSG  LVAY+EA    K   S  +    EV+++KK+VV
Sbjct  7    FDRVSRAFHDYPSVPKVLVVVAVSGCGLVAYAEANPERKLASSAPVLTSAEVDNKKKKVV  66

Query  338  VLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRK  517
            VLGTGWAGTSFL+NLK+P Y+V VISPRNYFAFTPLLPSVTCGTVE RSIVEPIR I RK
Sbjct  67   VLGTGWAGTSFLRNLKNPDYEVHVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRKIARK  126

Query  518  KNVDMQYCEAECIKIDA  568
            K V +Q+ EA C+KIDA
Sbjct  127  KTVGVQFSEAACLKIDA  143



>ref|XP_010234301.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Brachypodium distachyon]
Length=580

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 95/129 (74%), Gaps = 6/129 (5%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVS-GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWA  358
            R  +  P+ + L++V   S GG LVAY+++    +S+ + D+ +   +KK+VVVLGTGW 
Sbjct  13   RAMKHRPTFTNLVLVLAASSGGGLVAYADS----QSDGVVDMPQ-GPKKKKVVVLGTGWG  67

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            GT+FL+NL    YDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D ++
Sbjct  68   GTTFLRNLDSKLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGDFKF  127

Query  539  CEAECIKID  565
             EAEC KID
Sbjct  128  WEAECFKID  136



>ref|XP_002867844.1| pyridine nucleotide-disulfide oxidoreductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44103.1| pyridine nucleotide-disulfide oxidoreductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=549

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = +2

Query  239  GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISP  418
            GG L+ YSEA   + +N +    E   +KK+VV+LGTGWAG SFLK L + SY+VQVISP
Sbjct  1    GGGLIVYSEANASYSNNGV----ETETRKKKVVLLGTGWAGASFLKTLNNSSYEVQVISP  56

Query  419  RNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            RNYFAFTPLLPSVTCGTVE RS+VEPIRNI R KNV+M + EAEC+KID
Sbjct  57   RNYFAFTPLLPSVTCGTVEARSVVEPIRNIGR-KNVEMSFLEAECVKID  104



>ref|XP_004243316.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like [Solanum lycopersicum]
Length=575

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = +2

Query  203  SLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQK-KRVVVLGTGWAGTSFLKN  379
            S S+LL+   +S G L+ Y+E    +E   + + + ++ +K K+VVVLGTGWAGTSFLK+
Sbjct  15   SCSRLLVASCISSGGLLVYAENVDNNE--KIVERSRLDSKKRKKVVVLGTGWAGTSFLKD  72

Query  380  LKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIK  559
            +   SYD++V+SPRNYFAFTPLLPSVTCGTVE RS+VEP+RNII+K+N ++Q+ EAEC+K
Sbjct  73   MDISSYDIEVVSPRNYFAFTPLLPSVTCGTVEARSVVEPVRNIIKKRNGEIQFWEAECLK  132

Query  560  ID  565
            ID
Sbjct  133  ID  134



>ref|XP_009629693.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X2 [Nicotiana tomentosiformis]
Length=481

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAG  361
            R      S S+LL+   +S G L+ Y+E      +  +   +  +  KK++VVLGTGWAG
Sbjct  9    RALHIRSSYSRLLVASCISSGGLIVYAECN-VDSNEKVVQKSRSDSGKKKIVVLGTGWAG  67

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            TSFLK++   SYD++V+SPRNYFAFTPLLPSVTCGTVE RS+VEP+RNII+K++ ++Q+ 
Sbjct  68   TSFLKDMDISSYDIEVVSPRNYFAFTPLLPSVTCGTVEARSVVEPVRNIIKKRSGEIQFW  127

Query  542  EAECIKID  565
            EAEC+KID
Sbjct  128  EAECLKID  135



>ref|XP_004507221.1| PREDICTED: NAD(P)H dehydrogenase B1, mitochondrial-like [Cicer 
arietinum]
Length=578

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = +2

Query  173  RFARTFRE-NPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGT  349
            R +R  +  +P  S  L++  +SGG +VA SE+    +   + D      +KK+VVVLGT
Sbjct  9    RASRALKSTSPFCSNFLLLCALSGGGVVALSESQSEAQHPKIEDREP---RKKKVVVLGT  65

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GW  TSFLK L    YDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K N +
Sbjct  66   GWGATSFLKGLDASLYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKTNGE  125

Query  530  MQYCEAECIKIDA  568
            +++ EAECIKIDA
Sbjct  126  IKFWEAECIKIDA  138



>gb|KDO55768.1| hypothetical protein CISIN_1g041537mg, partial [Citrus sinensis]
Length=547

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +2

Query  239  GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISP  418
            GG LVAYSE ++    +   +  E   +KKRVV+LGTGWAG SFLK+L   SYDVQV+SP
Sbjct  1    GGGLVAYSE-SQSEPGSPASEHGEKEREKKRVVLLGTGWAGISFLKDLDVSSYDVQVVSP  59

Query  419  RNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            +NYFAFTPLLPSVTCGTVE RSI EP+RNII+K+N ++Q+ EAE IKIDA
Sbjct  60   QNYFAFTPLLPSVTCGTVEARSIAEPVRNIIKKRNAEIQFWEAEAIKIDA  109



>gb|KHG19479.1| External NADH-ubiquinone oxidoreductase 1, mitochondrial [Gossypium 
arboreum]
Length=585

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 94/137 (69%), Gaps = 11/137 (8%)
 Frame = +2

Query  173  RFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVV----  340
            R    F + PSLSK+++V T+S GSL+AYSEA     + N G+   V H           
Sbjct  9    RLCTAFHDYPSLSKIIVVSTLSSGSLIAYSEA-----NTNNGNRGRVAHADAVASKKKKV  63

Query  341  --LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIR  514
              LGTGWA  +FLKNL +  Y+V+V+SPRN+F FTPLLPSVTCG VE RSIVEPIRNIIR
Sbjct  64   VVLGTGWAAMTFLKNLNNCIYEVEVVSPRNFFLFTPLLPSVTCGKVEARSIVEPIRNIIR  123

Query  515  KKNVDMQYCEAECIKID  565
            KK+ D++Y EAEC KID
Sbjct  124  KKHFDVRYREAECTKID  140



>ref|XP_009629692.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X1 [Nicotiana tomentosiformis]
Length=576

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAG  361
            R      S S+LL+   +S G L+ Y+E      +  +   +  +  KK++VVLGTGWAG
Sbjct  9    RALHIRSSYSRLLVASCISSGGLIVYAECN-VDSNEKVVQKSRSDSGKKKIVVLGTGWAG  67

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            TSFLK++   SYD++V+SPRNYFAFTPLLPSVTCGTVE RS+VEP+RNII+K++ ++Q+ 
Sbjct  68   TSFLKDMDISSYDIEVVSPRNYFAFTPLLPSVTCGTVEARSVVEPVRNIIKKRSGEIQFW  127

Query  542  EAECIKID  565
            EAEC+KID
Sbjct  128  EAECLKID  135



>ref|XP_009595715.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Nicotiana tomentosiformis]
Length=576

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 10/112 (9%)
 Frame = +2

Query  242  GSLVAYSEATKPHESNNLGDLTEVNHQ----KKRVVVLGTGWAGTSFLKNLKDPSYDVQV  409
            G L+ Y+E      SN  G     N+Q    KKR+VVLGTGWAGTSFLK+L   SYDVQV
Sbjct  29   GGLLVYAE------SNIEGRKQVENNQSVSEKKRIVVLGTGWAGTSFLKDLDISSYDVQV  82

Query  410  ISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            +SPRNYFAFTPLLPSVTCGTVE RSIVEP+RNII+K++ ++Q+CEAEC+KID
Sbjct  83   VSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRSGEIQFCEAECLKID  134



>ref|XP_009761586.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Nicotiana sylvestris]
 ref|XP_009761587.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Nicotiana sylvestris]
 ref|XP_009761588.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Nicotiana sylvestris]
Length=577

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  320  QKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPI  499
            +KKRVVVLGTGWAGTSFLK+L   SYDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEP+
Sbjct  54   EKKRVVVLGTGWAGTSFLKDLDISSYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPV  113

Query  500  RNIIRKKNVDMQYCEAECIKID  565
            RNII+K++ ++Q+CEAEC+KID
Sbjct  114  RNIIKKRSGEIQFCEAECLKID  135



>emb|CDY38082.1| BnaC02g06910D [Brassica napus]
Length=575

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 95/126 (75%), Gaps = 5/126 (4%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTS  367
            F+  PS SKLL++ T SGG L+ YS+++ P +     D  E+  +KK+VVVLG+GW+G S
Sbjct  14   FKAYPSASKLLLLSTCSGGGLLMYSDSS-PSKRTLTADGQEI--KKKKVVVLGSGWSGYS  70

Query  368  FLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEA  547
            FL +  +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y EA
Sbjct  71   FLSHFNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEYTEA  128

Query  548  ECIKID  565
            EC+KID
Sbjct  129  ECVKID  134



>gb|EMS47178.1| putative NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial 
[Triticum urartu]
Length=565

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 92/138 (67%), Gaps = 9/138 (7%)
 Frame = +2

Query  161  KKMQRFARTFRENPSL---SKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKR  331
            +   RF    R   S    +  L++   SGG +VAY+++ +  E+       E   +KK+
Sbjct  9    RAAARFLEDIRRPSSAGVSTAALLLTAASGGGIVAYADSARAEEA------PEPPPRKKK  62

Query  332  VVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNII  511
            VVVLGTGWAGTSFLKNL    Y+V+VISPRNYFAFTPLLPSVTCGTVE RS+VEPIR + 
Sbjct  63   VVVLGTGWAGTSFLKNLDSSRYEVKVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRRMF  122

Query  512  RKKNVDMQYCEAECIKID  565
             KK  D+ Y EAEC KID
Sbjct  123  EKKGKDVAYYEAECFKID  140



>ref|NP_001058394.1| Os06g0684000 [Oryza sativa Japonica Group]
 dbj|BAD45556.1| putative external rotenone-insensitive NADPH dehydrogenase [Oryza 
sativa Japonica Group]
 dbj|BAF20308.1| Os06g0684000 [Oryza sativa Japonica Group]
 gb|EEC81200.1| hypothetical protein OsI_24219 [Oryza sativa Indica Group]
 gb|EEE66237.1| hypothetical protein OsJ_22405 [Oryza sativa Japonica Group]
Length=588

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = +2

Query  218  LIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSY  397
            L+V   SGG LVAY+++   + S+   + ++   +KK+VVVLGTGWAGTSFLK+L    Y
Sbjct  30   LLVAAASGGGLVAYADSAGENASS---ETSQEAPRKKKVVVLGTGWAGTSFLKDLDCSKY  86

Query  398  DVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            +V+VISPRNYFAFTPLLPSVTCGTVE RSIVEPIR ++ KK  D+ + EAEC KIDA
Sbjct  87   EVKVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRKMLEKKRKDVAFYEAECFKIDA  143



>tpg|DAA57352.1| TPA: hypothetical protein ZEAMMB73_528090 [Zea mays]
Length=578

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            + R A   R  P   K L++F V   +L      T   + N +  + +    KK+VV+LG
Sbjct  9    VHRAAEAVRRTPRWKKRLVLFAVGASTL------TYACQDNRVLQICDGTGNKKKVVILG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+N 
Sbjct  63   TGWAGASFLRNIDTSLYDVHVVSPRNYFTFTPLLPSVTCGTVEARSIVEPIRNIVRKRNG  122

Query  527  DMQYCEAECIKID  565
              ++ EAECIKID
Sbjct  123  SFRFWEAECIKID  135



>ref|NP_001142169.1| uncharacterized protein LOC100274336 [Zea mays]
 gb|ACF87809.1| unknown [Zea mays]
Length=578

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            + R A   R  P   K L++F V   +L      T   + N +  + +    KK+VV+LG
Sbjct  9    VHRAAEAVRRTPRWKKRLVLFAVGASTL------TYACQDNRVLQICDGTGNKKKVVILG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+N 
Sbjct  63   TGWAGASFLRNIDTSLYDVHVVSPRNYFTFTPLLPSVTCGTVEARSIVEPIRNIVRKRNG  122

Query  527  DMQYCEAECIKID  565
              ++ EAECIKID
Sbjct  123  SFRFWEAECIKID  135



>ref|XP_008648930.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X1 [Zea mays]
 ref|XP_008648931.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X1 [Zea mays]
 gb|AFW75960.1| hypothetical protein ZEAMMB73_563877 [Zea mays]
Length=584

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = +2

Query  197  NPSLSKLLIVFTV-SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFL  373
             P  S   ++ T  SGG LVAY+++      +   D       +K+VVVLGTGWAGTSFL
Sbjct  20   RPGFSTAALLLTAASGGGLVAYADSAAESAPDPSQDAP-----RKKVVVLGTGWAGTSFL  74

Query  374  KNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAEC  553
            KNL    Y+V+VISPRNYFAFTPLLPSVTCGTVE RSI+EP+R +  KKN D+ +CEAEC
Sbjct  75   KNLDCSRYEVKVISPRNYFAFTPLLPSVTCGTVEPRSIIEPVRRMFEKKNKDVTFCEAEC  134

Query  554  IKIDA  568
             KIDA
Sbjct  135  FKIDA  139



>emb|CDX70722.1| BnaC03g08060D [Brassica napus]
Length=573

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 5/127 (4%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTS  367
            F+  PS +KLL++ T SGG L+ YS++  P  +    D  E   +KK+VVVLG+GW G S
Sbjct  14   FKTYPSAAKLLLLSTCSGGGLLVYSDSNPPKRTLT-ADGQET--KKKKVVVLGSGWGGYS  70

Query  368  FLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEA  547
            FL  L +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y EA
Sbjct  71   FLSYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEYTEA  128

Query  548  ECIKIDA  568
            EC+KIDA
Sbjct  129  ECVKIDA  135



>ref|XP_004970191.1| PREDICTED: NAD(P)H dehydrogenase B3, mitochondrial-like [Setaria 
italica]
Length=578

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 89/133 (67%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R A   R  P   K L+VF V  G+L      T   + N +  + +    KK+VV+LG
Sbjct  9    VRRAAEAVRRTPRWQKGLVVFAVGAGTL------TYACQDNQVLQVCDGTGNKKKVVILG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEP+RNI+RK+N 
Sbjct  63   TGWAGASFLRNIDTSLYDVHVVSPRNYFTFTPLLPSVTCGTVEARSIVEPVRNIVRKRNG  122

Query  527  DMQYCEAECIKID  565
              ++ EAEC +ID
Sbjct  123  AFRFWEAECFQID  135



>gb|KGN46685.1| hypothetical protein Csa_6G124000 [Cucumis sativus]
Length=595

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +2

Query  236  SGGSLVAYSEATKPHESNNLGDLTEVNH-QKKRVVVLGTGWAGTSFLKNLKDPSYDVQVI  412
            SGG LVA +     + S     + +  + +KK+VVVLGTGWAGTSFLKNLK  SYDV VI
Sbjct  40   SGGGLVATTNGRSLYHSVYADAVQQDGYWKKKKVVVLGTGWAGTSFLKNLKSSSYDVHVI  99

Query  413  SPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            SP NYFAFTPLLPS+TCGTVE RSIVEPIR+I +KK +D+++ EAEC KIDA
Sbjct  100  SPHNYFAFTPLLPSITCGTVEARSIVEPIRSITKKKGLDIEFREAECYKIDA  151



>dbj|BAD11592.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD13179.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAG93110.1| unnamed protein product [Oryza sativa Japonica Group]
Length=357

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 92/133 (69%), Gaps = 10/133 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVF-TVSGGSLVAYSEATKPHESNNLGDLTEVNHQ--KKRVVVLGT  349
            +R F   P+ + L++V    S G LVAY+++       N  D+        KK++VVLGT
Sbjct  12   SRAFNHRPTFTNLVLVLGAASSGGLVAYADS-------NSDDVVGKPQGPPKKKIVVLGT  64

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GW GT+FL+NL    YDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D
Sbjct  65   GWGGTTFLRNLDSRLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGD  124

Query  530  MQYCEAECIKIDA  568
            +++ EAEC KID+
Sbjct  125  IKFWEAECFKIDS  137



>emb|CDX85484.1| BnaA02g03290D [Brassica napus]
Length=575

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 94/126 (75%), Gaps = 5/126 (4%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTS  367
            F   PS SKLL++ T SGG L+ YS+++ P +     D  E+  +KK+VVVLG+GW+G S
Sbjct  14   FMAYPSASKLLLLSTCSGGGLLVYSDSS-PSKRTLTADGQEI--KKKKVVVLGSGWSGYS  70

Query  368  FLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEA  547
            FL +  +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y EA
Sbjct  71   FLSHFNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEYTEA  128

Query  548  ECIKID  565
            EC+KID
Sbjct  129  ECVKID  134



>emb|CDX78714.1| BnaA03g06260D [Brassica napus]
Length=574

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 5/127 (4%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTS  367
            F+  PS +KLL++ T SGG L+ YS++  P +     D  E   +KK+VVVLG+GW G S
Sbjct  14   FKTYPSAAKLLLLSTCSGGGLLVYSDSN-PLKRTLTADGQET--KKKKVVVLGSGWGGYS  70

Query  368  FLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEA  547
            FL  L +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y EA
Sbjct  71   FLSYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEYTEA  128

Query  548  ECIKIDA  568
            EC+KIDA
Sbjct  129  ECVKIDA  135



>ref|XP_009131566.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial [Brassica rapa]
Length=574

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 5/127 (4%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTS  367
            F+  PS +KLL++ T SGG L+ YS++  P +     D  E   +KK+VVVLG+GW G S
Sbjct  14   FKTYPSAAKLLLLSTCSGGGLLVYSDSN-PLKRTLTADGQET--KKKKVVVLGSGWGGYS  70

Query  368  FLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEA  547
            FL  L +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y EA
Sbjct  71   FLSYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEYTEA  128

Query  548  ECIKIDA  568
            EC+KIDA
Sbjct  129  ECVKIDA  135



>ref|XP_009761590.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X2 [Nicotiana sylvestris]
Length=527

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +2

Query  242  GSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPR  421
            G L+ Y+E+        + +   V+  KKRVVVLGTGWAGTSFLK+L   SYDV+V+SPR
Sbjct  29   GGLLVYAESNVESRKQVVEENQSVS-AKKRVVVLGTGWAGTSFLKDLDISSYDVRVVSPR  87

Query  422  NYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            NYFAFTPLLPSVTCGTVE RSIVEP+RNII+K + ++Q+CEA+C+KID
Sbjct  88   NYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKTSGEIQFCEAQCLKID  135



>ref|XP_009761589.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X1 [Nicotiana sylvestris]
Length=577

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +2

Query  242  GSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPR  421
            G L+ Y+E+        + +   V+  KKRVVVLGTGWAGTSFLK+L   SYDV+V+SPR
Sbjct  29   GGLLVYAESNVESRKQVVEENQSVS-AKKRVVVLGTGWAGTSFLKDLDISSYDVRVVSPR  87

Query  422  NYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            NYFAFTPLLPSVTCGTVE RSIVEP+RNII+K + ++Q+CEA+C+KID
Sbjct  88   NYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKTSGEIQFCEAQCLKID  135



>ref|XP_010467369.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial-like isoform X1 [Camelina sativa]
Length=581

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 5/130 (4%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQ---KKRVVVLGTGWA  358
            F+  PS SKLL+V T SGG ++ YS+++      +     + N Q   KK+VVVLG+GW+
Sbjct  14   FKAYPSASKLLVVSTFSGGGVLVYSDSSPLRRLLHADATLDENGQPIRKKKVVVLGSGWS  73

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            G SFL  L +P+YDVQ++SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y
Sbjct  74   GYSFLNYLNNPNYDVQIVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEY  131

Query  539  CEAECIKIDA  568
             EAEC+KIDA
Sbjct  132  TEAECVKIDA  141



>ref|XP_002438881.1| hypothetical protein SORBIDRAFT_10g027690 [Sorghum bicolor]
 gb|EER90248.1| hypothetical protein SORBIDRAFT_10g027690 [Sorghum bicolor]
Length=584

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = +2

Query  197  NPSLSKLLIVFTV-SGGSLVAYSEA---TKPHESNNLGDLTEVNHQKKRVVVLGTGWAGT  364
             P +S   ++F   SGG LVAY+++   + P  S            KK+++VLGTGWAGT
Sbjct  20   RPGVSTAALLFAAASGGGLVAYADSAAESAPEPSQGA--------PKKKLLVLGTGWAGT  71

Query  365  SFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCE  544
            SFLKNL    Y+V+VISPRNYFAFTPLLPSVTCGTVE RSI+EP+R +  KKN D+ +CE
Sbjct  72   SFLKNLDCSQYEVKVISPRNYFAFTPLLPSVTCGTVEPRSIIEPVRRMFEKKNKDVTFCE  131

Query  545  AECIKIDA  568
            AEC KIDA
Sbjct  132  AECFKIDA  139



>ref|XP_010467370.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial-like isoform X2 [Camelina sativa]
Length=615

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 5/130 (4%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQ---KKRVVVLGTGWA  358
            F+  PS SKLL+V T SGG ++ YS+++      +     + N Q   KK+VVVLG+GW+
Sbjct  14   FKAYPSASKLLVVSTFSGGGVLVYSDSSPLRRLLHADATLDENGQPIRKKKVVVLGSGWS  73

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            G SFL  L +P+YDVQ++SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y
Sbjct  74   GYSFLNYLNNPNYDVQIVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEY  131

Query  539  CEAECIKIDA  568
             EAEC+KIDA
Sbjct  132  TEAECVKIDA  141



>ref|XP_010516730.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial [Camelina sativa]
Length=581

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 95/130 (73%), Gaps = 5/130 (4%)
 Frame = +2

Query  188  FRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQ---KKRVVVLGTGWA  358
            F+ +PS SKLL++ T SGG ++ Y++++      +     + N Q   KK+VVVLG+GW+
Sbjct  14   FKAHPSTSKLLLLSTFSGGGVLVYTDSSPLRRLLHADATLDENGQPIRKKKVVVLGSGWS  73

Query  359  GTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQY  538
            G SFL  L +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y
Sbjct  74   GYSFLNYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEY  131

Query  539  CEAECIKIDA  568
             EAEC+KIDA
Sbjct  132  TEAECVKIDA  141



>gb|EMT14300.1| Putative NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial 
[Aegilops tauschii]
Length=649

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 6/110 (5%)
 Frame = +2

Query  236  SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVIS  415
            SGG +VAY+++ +  E+       E   +KK+VVVLGTGWAGTSFLKNL    Y+V+VIS
Sbjct  126  SGGGIVAYADSARAEEA------PEPPPRKKKVVVLGTGWAGTSFLKNLDSSRYEVKVIS  179

Query  416  PRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            PRNYFAFTPLLPSVTCGTVE RS+VEPIR +  KK  D+ Y EAEC KID
Sbjct  180  PRNYFAFTPLLPSVTCGTVEARSVVEPIRRMFEKKGKDVAYYEAECFKID  229



>gb|EAZ05553.1| hypothetical protein OsI_27768 [Oryza sativa Indica Group]
 gb|EAZ41479.1| hypothetical protein OsJ_26003 [Oryza sativa Japonica Group]
Length=580

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 92/133 (69%), Gaps = 10/133 (8%)
 Frame = +2

Query  179  ARTFRENPSLSKLLIVF-TVSGGSLVAYSEATKPHESNNLGDLTEVNHQ--KKRVVVLGT  349
            +R F   P+ + L++V    S G LVAY+++       N  D+        KK++VVLGT
Sbjct  12   SRAFNHRPTFTNLVLVLGAASSGGLVAYADS-------NSDDVVGKPQGPPKKKIVVLGT  64

Query  350  GWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVD  529
            GW GT+FL+NL    YDVQVISPRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D
Sbjct  65   GWGGTTFLRNLDSRLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGD  124

Query  530  MQYCEAECIKIDA  568
            +++ EAEC KID+
Sbjct  125  IKFWEAECFKIDS  137



>ref|XP_006297302.1| hypothetical protein CARUB_v10013317mg [Capsella rubella]
 gb|EOA30200.1| hypothetical protein CARUB_v10013317mg [Capsella rubella]
Length=581

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 8/137 (6%)
 Frame = +2

Query  176  FARTF---RENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQ---KKRVV  337
            + R F   + +PS+SKLL++ T SGG ++ Y++++      +     + + Q   KK+VV
Sbjct  7    YKRAFTLLKAHPSVSKLLVLSTFSGGGVLVYTDSSPLRRILHADATLDADGQPIKKKKVV  66

Query  338  VLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRK  517
            VLG+GW+G SFL  L +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR +IRK
Sbjct  67   VLGSGWSGYSFLNYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLIRK  126

Query  518  KNVDMQYCEAECIKIDA  568
            K    +Y EAEC+KIDA
Sbjct  127  KG--FEYTEAECVKIDA  141



>gb|EMS46851.1| putative NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial 
[Triticum urartu]
Length=569

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 9/110 (8%)
 Frame = +2

Query  236  SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVIS  415
            SGG LVAY++ ++P +            +KK+VVVLGTGWAGT+FL+NL    YDVQVIS
Sbjct  3    SGGGLVAYAD-SQPDQPQGF--------KKKKVVVLGTGWAGTTFLRNLDSKLYDVQVIS  53

Query  416  PRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            PRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D ++ EAEC KID
Sbjct  54   PRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGDFKFWEAECFKID  103



>ref|XP_006657263.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like [Oryza brachyantha]
Length=860

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 4/113 (4%)
 Frame = +2

Query  230  TVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQV  409
            TV GG LVAY+++     + N  + ++   +KK+VVVLGTGWAGTSFLK+L    Y+V+V
Sbjct  309  TVLGGGLVAYADSA----AENASEQSQEAPKKKKVVVLGTGWAGTSFLKDLDCSKYEVKV  364

Query  410  ISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            ISPRNYFAFTPLLPSVTCGTVE RSIVEPIR ++ KK  D+ + EAEC KIDA
Sbjct  365  ISPRNYFAFTPLLPSVTCGTVEARSIVEPIRKMLEKKRKDVTFYEAECFKIDA  417



>ref|XP_006841824.1| hypothetical protein AMTR_s00003p00269890 [Amborella trichopoda]
 gb|ERN03499.1| hypothetical protein AMTR_s00003p00269890 [Amborella trichopoda]
Length=529

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 5/118 (4%)
 Frame = +2

Query  215  LLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPS  394
            +L    VSGG LV Y+E TKP   N+   +TE + +KK+VVVLG+GWAGTSFLKNL    
Sbjct  1    MLKANKVSGGLLV-YAE-TKP---NSGSGVTETSQEKKKVVVLGSGWAGTSFLKNLDSSL  55

Query  395  YDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            YDVQV+S  NYFAFTPLLPSVTCGTVE RSIVEP+R+I++KK  D+Q+ EAE  KID+
Sbjct  56   YDVQVVSAHNYFAFTPLLPSVTCGTVEPRSIVEPVRSIVKKKKGDIQFLEAEVYKIDS  113



>gb|EPS65039.1| hypothetical protein M569_09737, partial [Genlisea aurea]
Length=552

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = +2

Query  239  GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISP  418
            GG L  + + +    + +  D  E++  +K+VVVLGTGWA TSFLKNL +PSYDVQVISP
Sbjct  3    GGLLTIHRDGSYARPAFSDADGGEIS--RKKVVVLGTGWAATSFLKNLNNPSYDVQVISP  60

Query  419  RNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            RNYFAFTPLLPSVT GTVE RSIVEPIRNI++KK  D ++ EAEC +ID
Sbjct  61   RNYFAFTPLLPSVTNGTVEARSIVEPIRNILKKKKFDAEFREAECYRID  109



>gb|EMS55962.1| External NADH-ubiquinone oxidoreductase 1, mitochondrial [Triticum 
urartu]
Length=573

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R     R  P   K L+V TV  G+L      +   + N +  +++    KK+VV+LG
Sbjct  9    VRRALEAVRRTPRWQKRLVVLTVGAGTL------SYACQDNRVLQISDGTGGKKKVVILG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+  
Sbjct  63   TGWAGASFLRNIDTSLYDVHVVSPRNYFMFTPLLPSVTCGTVEARSIVEPIRNIVRKRGG  122

Query  527  DMQYCEAECIKID  565
              ++ EAEC KID
Sbjct  123  AFRFWEAECYKID  135



>ref|XP_008657168.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like isoform X1 [Zea mays]
 gb|AFW84893.1| hypothetical protein ZEAMMB73_805701 [Zea mays]
Length=578

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 83/122 (68%), Gaps = 6/122 (5%)
 Frame = +2

Query  200  PSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKN  379
            P   K L+ F V   +L      T   + N +  + +V   KK+VV+LGTGWAG SFL+N
Sbjct  20   PRWKKRLVFFAVGASTL------TYACQDNRVLQICDVTGNKKKVVILGTGWAGASFLRN  73

Query  380  LKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIK  559
            +    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+N   ++ EAEC K
Sbjct  74   IDTSLYDVHVVSPRNYFTFTPLLPSVTCGTVEARSIVEPIRNIVRKRNGAFRFWEAECFK  133

Query  560  ID  565
            ID
Sbjct  134  ID  135



>gb|EMT01831.1| External NADH-ubiquinone oxidoreductase 1, mitochondrial [Aegilops 
tauschii]
Length=584

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R     R  P   K L+V TV  G+L      +   + N +  +++    KK+VV+LG
Sbjct  9    VRRALEAVRRTPRWQKRLVVLTVGAGTL------SYACQDNRVLQISDGTGGKKKVVILG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+  
Sbjct  63   TGWAGASFLRNIDTSLYDVHVVSPRNYFMFTPLLPSVTCGTVEARSIVEPIRNIVRKRGG  122

Query  527  DMQYCEAECIKID  565
              ++ EAEC KID
Sbjct  123  AFRFWEAECYKID  135



>ref|XP_004966264.1| PREDICTED: NAD(P)H dehydrogenase B1, mitochondrial-like isoform 
X1 [Setaria italica]
 ref|XP_004966265.1| PREDICTED: NAD(P)H dehydrogenase B1, mitochondrial-like isoform 
X2 [Setaria italica]
Length=583

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 88/120 (73%), Gaps = 11/120 (9%)
 Frame = +2

Query  218  LIVFTVSGGSLVAYSEA---TKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKD  388
            L++   SGG LVAY+++   + P  S++          KK+V+VLGTGWAGTSFLKNL  
Sbjct  27   LLLTAASGGGLVAYADSAAESAPEPSHDA--------PKKKVLVLGTGWAGTSFLKNLDC  78

Query  389  PSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
              Y+V+VISPRNYFAFTPLLPSVTCGTVE RSI+EPIR +  KK+ D+ + EAEC KIDA
Sbjct  79   SQYEVKVISPRNYFAFTPLLPSVTCGTVEPRSIIEPIRRMFEKKSKDVTFYEAECFKIDA  138



>ref|XP_010906380.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like isoform X5 [Elaeis guineensis]
Length=510

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 86/118 (73%), Gaps = 5/118 (4%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAG  361
            R F   P+ SKL+++   SGG LVAY+++   H   +    ++V   KK+VVVLGTGWAG
Sbjct  13   RAFHHRPTFSKLVVILAASGGGLVAYADSKSDHAIAS----SQVA-PKKKVVVLGTGWAG  67

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
            T+FLKNL    YDVQV+SPRNYFAFTPLLPS+TCGTVE  SIVEPIR II+K+  D Q
Sbjct  68   TTFLKNLDSSLYDVQVVSPRNYFAFTPLLPSITCGTVEPCSIVEPIRKIIKKEVEDAQ  125



>ref|XP_006654264.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Oryza brachyantha]
Length=579

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 7/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R A   R  P   K L+V TV  GSL   + A + ++   + D T     KK+VV++G
Sbjct  10   VRRAAEAVRRTPRWQKRLVVLTVGVGSL---TYACQDNQVLQINDGT----GKKKVVIVG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG +FL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+  
Sbjct  63   TGWAGATFLRNIDTSLYDVHVVSPRNYFTFTPLLPSVTCGTVEARSIVEPIRNIVRKRGG  122

Query  527  DMQYCEAECIKID  565
              ++ EAEC KID
Sbjct  123  AFRFWEAECYKID  135



>emb|CDM84453.1| unnamed protein product [Triticum aestivum]
Length=570

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 87/133 (65%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R     R  P   K L+V T   G+L      +   + N +  +++    KK+VV+LG
Sbjct  9    VRRALEAVRRTPRWQKRLVVLTAGAGTL------SYACQDNRVLQISDGTGGKKKVVILG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+  
Sbjct  63   TGWAGASFLRNIDTSLYDVHVVSPRNYFMFTPLLPSVTCGTVEARSIVEPIRNIVRKRGG  122

Query  527  DMQYCEAECIKID  565
              ++ EAEC KID
Sbjct  123  AFRFWEAECYKID  135



>dbj|BAJ99151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=573

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 88/133 (66%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R     R  P   + L++ TV  G+L      +   + N +  +++    KK+VV+LG
Sbjct  9    VRRAVEAVRRTPRWQRRLVLLTVGAGTL------SYACQDNRVLQISDGTGGKKKVVILG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+  
Sbjct  63   TGWAGASFLRNIDTSLYDVHVVSPRNYFMFTPLLPSVTCGTVEARSIVEPIRNIVRKRGG  122

Query  527  DMQYCEAECIKID  565
              ++ EAEC KID
Sbjct  123  AFRFWEAECYKID  135



>ref|XP_002456448.1| hypothetical protein SORBIDRAFT_03g036480 [Sorghum bicolor]
 gb|EES01568.1| hypothetical protein SORBIDRAFT_03g036480 [Sorghum bicolor]
Length=578

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 87/133 (65%), Gaps = 6/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R A   R  P   K L+ F V   +L      T   + N +  + +    KK+VV+LG
Sbjct  9    VRRAAEAVRRTPRWKKGLVFFAVGASTL------TFACQDNRVLQICDGTGNKKKVVILG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    Y+V V+SPRNYF FTPLLP+VTCGTVE RSIVEPIRNI+RK+N 
Sbjct  63   TGWAGASFLRNIDTSLYEVHVVSPRNYFTFTPLLPNVTCGTVEARSIVEPIRNIVRKRNG  122

Query  527  DMQYCEAECIKID  565
              ++ EAEC KID
Sbjct  123  AFRFWEAECFKID  135



>ref|XP_002886305.1| NDB4 H dehydrogenase B4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62564.1| NDB4 H dehydrogenase B4 [Arabidopsis lyrata subsp. lyrata]
Length=581

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 93/135 (69%), Gaps = 5/135 (4%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQ---KKRVVV  340
            QR    F+  PS SKLL+  + SGG ++ YS++       +     + + Q   KK+VVV
Sbjct  8    QRAFSLFKAYPSASKLLVFSSFSGGGVLVYSDSNPLKRVLHADATLDSDGQPIRKKKVVV  67

Query  341  LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKK  520
            LG+GW+G SFL  L +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RKK
Sbjct  68   LGSGWSGYSFLNYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKK  127

Query  521  NVDMQYCEAECIKID  565
                +Y EAEC+KID
Sbjct  128  G--FEYKEAECVKID  140



>gb|EPS60856.1| hypothetical protein M569_13947, partial [Genlisea aurea]
Length=163

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +2

Query  233  VSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVI  412
            VSG    AY++++K ++ N   D  +   QKK+VVVLGTGW  +SFL++L   +YDVQV+
Sbjct  1    VSGAGYFAYADSSK-YDQNLEEDRKKKLTQKKKVVVLGTGWGASSFLRDLDVSNYDVQVV  59

Query  413  SPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            SPRNYFAFTPLLPSVTCGTVE RS+VEP+RNIIRK+N  +Q+ EAEC+KID
Sbjct  60   SPRNYFAFTPLLPSVTCGTVEARSVVEPVRNIIRKRNGVIQFWEAECLKID  110



>ref|NP_179673.1| NAD(P)H dehydrogenase B4 [Arabidopsis thaliana]
 sp|Q9SKT7.1|NDB4_ARATH RecName: Full=External alternative NAD(P)H-ubiquinone oxidoreductase 
B4, mitochondrial; AltName: Full=External alternative 
NADH dehydrogenase NDB4; AltName: Full=NADH:ubiquinone reductase 
(non-electrogenic) NDB4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD20915.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|ABE65838.1| pyridine nucleotide-disulphide oxidoreductase family protein 
[Arabidopsis thaliana]
 gb|AEC07074.1| NAD(P)H dehydrogenase B4 [Arabidopsis thaliana]
Length=582

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 94/137 (69%), Gaps = 6/137 (4%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNH----QKKRVV  337
            QR +  F+  PS SK+L++ T SGG  V     + P +     D T  +     +KK+VV
Sbjct  8    QRASSLFKAYPSTSKILLLSTFSGGGGVLVYSDSNPLKRILHADATLDSDGNPIRKKKVV  67

Query  338  VLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRK  517
            VLG+GW+G SFL  L +P+YDVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++RK
Sbjct  68   VLGSGWSGYSFLSYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRK  127

Query  518  KNVDMQYCEAECIKIDA  568
            K    +Y EAEC+KIDA
Sbjct  128  KG--FEYKEAECVKIDA  142



>ref|NP_001055220.1| Os05g0331200 [Oryza sativa Japonica Group]
 gb|AAV43826.1| putative NADPH dehydrogenase [Oryza sativa Japonica Group]
 gb|AAV43902.1| putative NADPH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF17134.1| Os05g0331200 [Oryza sativa Japonica Group]
 gb|EAY97562.1| hypothetical protein OsI_19490 [Oryza sativa Indica Group]
 dbj|BAG94810.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63279.1| hypothetical protein OsJ_18089 [Oryza sativa Japonica Group]
Length=575

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 7/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R     R  P   K L+V T   GSL   + A + ++   + D T     KKRVV++G
Sbjct  10   VRRAVEAARRTPRWQKRLLVLTAGVGSL---TYACQDNQVLQINDGT----GKKRVVIVG  62

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK+  
Sbjct  63   TGWAGASFLRNIDTSLYDVHVVSPRNYFTFTPLLPSVTCGTVEARSIVEPIRNIVRKRGG  122

Query  527  DMQYCEAECIKID  565
              ++ EAEC KID
Sbjct  123  AFRFWEAECYKID  135



>ref|XP_006841827.1| hypothetical protein AMTR_s00003p00270010 [Amborella trichopoda]
 gb|ERN03502.1| hypothetical protein AMTR_s00003p00270010 [Amborella trichopoda]
Length=548

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  320  QKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPI  499
            +KK++VVLG+GWAGTSFLKN+    Y+VQV+SPRNYFAFTPLLPSVTCGTVE RSI+EPI
Sbjct  22   EKKKLVVLGSGWAGTSFLKNIDSSLYNVQVVSPRNYFAFTPLLPSVTCGTVEPRSIIEPI  81

Query  500  RNIIRKKNVDMQYCEAECIKIDA  568
            RNI++KK  ++++ EAECIKIDA
Sbjct  82   RNIVKKKKGEIRFSEAECIKIDA  104



>ref|XP_004972878.1| PREDICTED: NAD(P)H dehydrogenase B2, mitochondrial-like [Setaria 
italica]
Length=580

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 88/130 (68%), Gaps = 14/130 (11%)
 Frame = +2

Query  191  RENPSLSKLLIVFTV-SGGSLVAYSEATKPHESNNLGDLTEVNH----QKKRVVVLGTGW  355
            R  P +S LL+V    S G LVAY+++         G    V      Q+K+VVVLGTGW
Sbjct  16   RRRPGVSNLLLVVAAASSGGLVAYADS---------GSDAAVEKPQLPQRKKVVVLGTGW  66

Query  356  AGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQ  535
             GT+FL+NL    YDVQVISPRNYFAFTPLLPSVT GTVE RSIVEPIR ++ KK  +++
Sbjct  67   GGTTFLRNLDTRLYDVQVISPRNYFAFTPLLPSVTSGTVEPRSIVEPIRRVLEKKGEEIK  126

Query  536  YCEAECIKID  565
            + EAEC KID
Sbjct  127  FWEAECFKID  136



>ref|XP_006659819.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like [Oryza brachyantha]
Length=726

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 86/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  236  SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVIS  415
            S G LVAY+++    +S+++ D  E    KK+VVVLGTGW GT+FL+NL    YDVQVIS
Sbjct  178  SSGGLVAYADS----KSDDVLDKPE-GPPKKKVVVLGTGWGGTTFLRNLDSRLYDVQVIS  232

Query  416  PRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            PRNYFAFTPLLPSVTCGTVE RS+VEPIR I+ KK  D+++ EAEC KID+
Sbjct  233  PRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEKKGGDIKFWEAECFKIDS  283



>ref|XP_003564358.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B3, mitochondrial-like [Brachypodium distachyon]
Length=572

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 87/133 (65%), Gaps = 7/133 (5%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLG  346
            ++R     R  P   K ++ FTV  G+L   S A + +    + D T     KK++V+LG
Sbjct  9    VRRAVEAVRRTPRWQKRIVFFTVGVGTL---SYACQDNRVLQINDGT----GKKKLVILG  61

Query  347  TGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNV  526
            TGWAG SFL+N+    YDV V+SPRNYF FTPLLPSVTCGTVE RSIVEPIRNI+RK   
Sbjct  62   TGWAGASFLRNIDTSLYDVHVVSPRNYFMFTPLLPSVTCGTVEARSIVEPIRNIVRKNGG  121

Query  527  DMQYCEAECIKID  565
              ++ EAEC KID
Sbjct  122  AFRFWEAECYKID  134



>emb|CAN59740.1| hypothetical protein VITISV_027064 [Vitis vinifera]
Length=539

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 16/111 (14%)
 Frame = +2

Query  233  VSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVI  412
             +GG L+A++E T+P   ++       +  KK+VVVLGTGWAGTSFLKNLK  +++VQV+
Sbjct  2    ANGGGLLAFAE-TRPFSGSD-------SVPKKKVVVLGTGWAGTSFLKNLKSSTFEVQVV  53

Query  413  SPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNI+RK        EAEC KID
Sbjct  54   SPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVRK--------EAECYKID  96



>ref|XP_010906379.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X4 [Elaeis guineensis]
Length=544

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAG  361
            R F   P+ SKL+++   SGG LVAY+++   H   +    ++V   KK+VVVLGTGWAG
Sbjct  13   RAFHHRPTFSKLVVILAASGGGLVAYADSKSDHAIAS----SQVA-PKKKVVVLGTGWAG  67

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            T+FLKNL    YDVQV+SPRNYFAFTPLLPS+TCGTVE  SIVEPIR II+KK   +++ 
Sbjct  68   TTFLKNLDSSLYDVQVVSPRNYFAFTPLLPSITCGTVEPCSIVEPIRKIIKKKGE-IKFW  126

Query  542  EAECIKID  565
            EAEC KID
Sbjct  127  EAECFKID  134



>gb|KFK40454.1| hypothetical protein AALP_AA3G375100 [Arabis alpina]
Length=570

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 93/136 (68%), Gaps = 17/136 (13%)
 Frame = +2

Query  167  MQRFARTFRENPSLSKLLIVFTVS---GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVV  337
            ++R +  FR  P   KLL++ +     G SLVAYS+  +               +KK+++
Sbjct  7    LRRASLFFRATPDSYKLLLLSSTLTLSGASLVAYSDRKQV--------------EKKKIL  52

Query  338  VLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRK  517
            +LGTGWAG SFLK+L   SYDVQV+SP NYFAFTPLLPSVTCGTVE RSIVEP+RNI+ K
Sbjct  53   LLGTGWAGISFLKDLDLSSYDVQVVSPHNYFAFTPLLPSVTCGTVEARSIVEPVRNIVNK  112

Query  518  KNVDMQYCEAECIKID  565
            K  ++Q  EA+C+KID
Sbjct  113  KRGEIQLWEADCVKID  128



>ref|XP_010906377.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X2 [Elaeis guineensis]
Length=561

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAG  361
            R F   P+ SKL+++   SGG LVAY+++   H   +    ++V   KK+VVVLGTGWAG
Sbjct  13   RAFHHRPTFSKLVVILAASGGGLVAYADSKSDHAIAS----SQVA-PKKKVVVLGTGWAG  67

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            T+FLKNL    YDVQV+SPRNYFAFTPLLPS+TCGTVE  SIVEPIR II+KK   +++ 
Sbjct  68   TTFLKNLDSSLYDVQVVSPRNYFAFTPLLPSITCGTVEPCSIVEPIRKIIKKKGE-IKFW  126

Query  542  EAECIKID  565
            EAEC KID
Sbjct  127  EAECFKID  134



>ref|XP_010906376.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B2, mitochondrial-like isoform X1 [Elaeis guineensis]
Length=578

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = +2

Query  182  RTFRENPSLSKLLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAG  361
            R F   P+ SKL+++   SGG LVAY+++   H   +    ++V   KK+VVVLGTGWAG
Sbjct  13   RAFHHRPTFSKLVVILAASGGGLVAYADSKSDHAIAS----SQVA-PKKKVVVLGTGWAG  67

Query  362  TSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYC  541
            T+FLKNL    YDVQV+SPRNYFAFTPLLPS+TCGTVE  SIVEPIR II+KK   +++ 
Sbjct  68   TTFLKNLDSSLYDVQVVSPRNYFAFTPLLPSITCGTVEPCSIVEPIRKIIKKKGE-IKFW  126

Query  542  EAECIKID  565
            EAEC KID
Sbjct  127  EAECFKID  134



>ref|XP_002869514.1| hypothetical protein ARALYDRAFT_913700 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45773.1| hypothetical protein ARALYDRAFT_913700 [Arabidopsis lyrata subsp. 
lyrata]
Length=573

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 80/106 (75%), Gaps = 5/106 (5%)
 Frame = +2

Query  248  LVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNY  427
            +VAYS++      N    L     +KK+VVVLGTGWAG SFLK+L   SYDVQV+SP+NY
Sbjct  31   IVAYSDSNAEANKNEDQQL-----KKKKVVVLGTGWAGISFLKDLDITSYDVQVVSPQNY  85

Query  428  FAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            FAFTPLLPSVTCGTVE RSIVE +RNI +KK  +++  EA+C+KID
Sbjct  86   FAFTPLLPSVTCGTVEARSIVESVRNITKKKKGEIELWEADCVKID  131



>ref|XP_008648932.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial-like isoform X2 [Zea mays]
 gb|AFW75959.1| hypothetical protein ZEAMMB73_563877 [Zea mays]
Length=577

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 84/125 (67%), Gaps = 13/125 (10%)
 Frame = +2

Query  197  NPSLSKLLIVFTV-SGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFL  373
             P  S   ++ T  SGG LVAY+++      +   D       +K+VVVLGTGWAGTSFL
Sbjct  20   RPGFSTAALLLTAASGGGLVAYADSAAESAPDPSQDAP-----RKKVVVLGTGWAGTSFL  74

Query  374  KNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAEC  553
            KNL    Y+V+VISPRNYFAFTPLLPSVTCGTVE RSI+EP       KN D+ +CEAEC
Sbjct  75   KNLDCSRYEVKVISPRNYFAFTPLLPSVTCGTVEPRSIIEP-------KNKDVTFCEAEC  127

Query  554  IKIDA  568
             KIDA
Sbjct  128  FKIDA  132



>ref|XP_002445027.1| hypothetical protein SORBIDRAFT_07g003070 [Sorghum bicolor]
 gb|EES14522.1| hypothetical protein SORBIDRAFT_07g003070 [Sorghum bicolor]
Length=581

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 5/117 (4%)
 Frame = +2

Query  215  LLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPS  394
            LL+V   S G LVAY+++     S+   +  ++  +KK VVVLGTGW GT+FL+NL    
Sbjct  26   LLVVAAASSGGLVAYADSG----SDAAVEKPQLPPRKK-VVVLGTGWGGTTFLRNLDSRL  80

Query  395  YDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            YDVQVISPRNYFAFTPLLPSVT GTVE RSIVEPIR I+ KK  ++++ EAEC KID
Sbjct  81   YDVQVISPRNYFAFTPLLPSVTSGTVEPRSIVEPIRRILEKKGGEIKFWEAECFKID  137



>gb|KHG19478.1| External NADH-ubiquinone oxidoreductase 1, mitochondrial [Gossypium 
arboreum]
Length=577

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 88/119 (74%), Gaps = 11/119 (9%)
 Frame = +2

Query  227  FTVSGGSLVAYSEATKPHESNNLGDLTEVNH------QKKRVVVLGTGWAGTSFLKNLKD  388
            F  S GSL+AYSEA     + N G+   V H      +KK+VVVLGTGWA  +FLKNL +
Sbjct  19   FVCSSGSLIAYSEA-----NTNNGNRGRVAHADAVASKKKKVVVLGTGWAAMTFLKNLNN  73

Query  389  PSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
              Y+V+V+SPRN+F FTPLLPSVTCG VE RSIVEPIRNIIRKK+ D++Y EAEC KID
Sbjct  74   CIYEVEVVSPRNFFLFTPLLPSVTCGKVEARSIVEPIRNIIRKKHFDVRYREAECTKID  132



>ref|NP_001143083.1| uncharacterized protein LOC100275557 [Zea mays]
 gb|ACG28829.1| hypothetical protein [Zea mays]
Length=577

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 83/121 (69%), Gaps = 13/121 (11%)
 Frame = +2

Query  215  LLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQ----KKRVVVLGTGWAGTSFLKNL  382
            LL+V   S G LVAY+++         G    V       +K+VVVLGTGW GT+FL+NL
Sbjct  22   LLVVAAASSGGLVAYADS---------GSDAAVQQPQLPPRKKVVVLGTGWGGTTFLRNL  72

Query  383  KDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKI  562
                YDVQVISPRNYFAFTPLLPSVT GTVE RSIVEPIR ++ KK  ++++ EAEC KI
Sbjct  73   DSRLYDVQVISPRNYFAFTPLLPSVTSGTVEPRSIVEPIRRVLEKKGGEIKFWEAECFKI  132

Query  563  D  565
            D
Sbjct  133  D  133



>gb|AFW61257.1| hypothetical protein ZEAMMB73_607293 [Zea mays]
Length=577

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 86/117 (74%), Gaps = 5/117 (4%)
 Frame = +2

Query  215  LLIVFTVSGGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPS  394
            LL+V   S G LVAY+++     S+   +  ++  +KK VVVLGTGW GT+FL+NL    
Sbjct  22   LLVVAAASSGGLVAYADSG----SDAAVEQPQLPPRKK-VVVLGTGWGGTTFLRNLDSRL  76

Query  395  YDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            YDVQVISPRNYFAFTPLLPSVT GTVE RSIVEPIR ++ KK  ++++ EAEC KID
Sbjct  77   YDVQVISPRNYFAFTPLLPSVTSGTVEPRSIVEPIRRVLEKKGGEIKFWEAECFKID  133



>ref|XP_001764062.1| predicted protein [Physcomitrella patens]
 gb|EDQ71201.1| predicted protein [Physcomitrella patens]
Length=579

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +2

Query  242  GSLVAYSEATKPHESNNLGD-LTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISP  418
            G LVA ++A + + S+   + ++  N +K++VV+LGTGW G SFLKNL    YDV+V+SP
Sbjct  31   GLLVALADAGQDNSSSGSDEAVSAGNSRKQKVVILGTGWGGVSFLKNLDSSKYDVRVVSP  90

Query  419  RNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKIDA  568
            RNYF FTPLLPSVT GTVE RSI EPIR IIRKK  D+++ EAEC KIDA
Sbjct  91   RNYFVFTPLLPSVTSGTVEARSITEPIRRIIRKK--DVKFHEAECTKIDA  138



>ref|XP_009126338.1| PREDICTED: LOW QUALITY PROTEIN: external alternative NAD(P)H-ubiquinone 
oxidoreductase B4, mitochondrial-like [Brassica rapa]
Length=570

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 83/109 (76%), Gaps = 5/109 (5%)
 Frame = +2

Query  239  GGSLVAYSEATKPHESNNLGDLTEVNHQKKRVVVLGTGWAGTSFLKNLKDPSYDVQVISP  418
            GG L+ YS+++ P +     D  E+  +KK+VVVLG+GW+G SFL +  +P+YDVQV+SP
Sbjct  26   GGGLLVYSDSS-PSKRTLTADGQEI--KKKKVVVLGSGWSGYSFLSHFNNPNYDVQVVSP  82

Query  419  RNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKKNVDMQYCEAECIKID  565
            RN+F FTPLLPSVT GTVE RSIVEPIR ++RKK    +Y EAEC+KID
Sbjct  83   RNFFLFTPLLPSVTNGTVEARSIVEPIRGLMRKKG--FEYTEAECVKID  129



>gb|EPS68710.1| hypothetical protein M569_06057, partial [Genlisea aurea]
Length=518

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  338  VLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRK  517
            VLGTGWA  SFLK+L   SYDVQV+SPRNYFAFTPLLPSVTCGTVE RSIVEPIRNII+K
Sbjct  1    VLGTGWAAVSFLKDLDISSYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIIKK  60

Query  518  KNVDMQYCEAECIKID  565
            K  ++Q+ EAEC+ ID
Sbjct  61   KKGEIQFWEAECLAID  76



>ref|XP_001766162.1| predicted protein [Physcomitrella patens]
 gb|EDQ69011.1| predicted protein [Physcomitrella patens]
Length=553

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  323  KKRVVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIR  502
            KKRVVVLGTGW G SFLKNL    YDV +++PRNYF FTPLLPSVT G+VE RSI+EP+R
Sbjct  24   KKRVVVLGTGWGGMSFLKNLDSTLYDVSIVAPRNYFVFTPLLPSVTSGSVEARSIIEPVR  83

Query  503  NIIRKKNVDMQYCEAECIKIDA  568
             I+R K   +Q+ EAECIKIDA
Sbjct  84   RIVRSKGKQVQFHEAECIKIDA  105



>ref|NP_567801.1| NAD(P)H dehydrogenase B1 [Arabidopsis thaliana]
 sp|Q1JPL4.1|NDB1_ARATH RecName: Full=External alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial; AltName: Full=External alternative 
NADH dehydrogenase NDB1; AltName: Full=NADH:ubiquinone reductase 
(non-electrogenic) NDB1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABF57295.1| At4g28220 [Arabidopsis thaliana]
 gb|AEE85455.1| NAD(P)H dehydrogenase B1 [Arabidopsis thaliana]
Length=571

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  332  VVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNII  511
            VVVLGTGWAG SFLK+L   SYDVQV+SP+NYFAFTPLLPSVTCGTVE RSIVE +RNI 
Sbjct  52   VVVLGTGWAGISFLKDLDITSYDVQVVSPQNYFAFTPLLPSVTCGTVEARSIVESVRNIT  111

Query  512  RKKNVDMQYCEAECIKID  565
            +KKN +++  EA+C KID
Sbjct  112  KKKNGEIELWEADCFKID  129



>emb|CAB79624.1| putative NADH dehydrogenase [Arabidopsis thaliana]
Length=559

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  332  VVVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNII  511
            VVVLGTGWAG SFLK+L   SYDVQV+SP+NYFAFTPLLPSVTCGTVE RSIVE +RNI 
Sbjct  52   VVVLGTGWAGISFLKDLDITSYDVQVVSPQNYFAFTPLLPSVTCGTVEARSIVESVRNIT  111

Query  512  RKKNVDMQYCEAECIKID  565
            +KKN +++  EA+C KID
Sbjct  112  KKKNGEIELWEADCFKID  129



>gb|KFK40453.1| hypothetical protein AALP_AA3G375000 [Arabis alpina]
Length=578

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 98/138 (71%), Gaps = 8/138 (6%)
 Frame = +2

Query  170  QRFARTFRENPSLSKLLIVFTVSGGS--LVAYSEATKPHESNNLGDLTEVNHQ---KKRV  334
            QR +  F+  PS SKLL++ + SGG+  L+ +S+   P +S    D T  + Q   KK+V
Sbjct  9    QRASSFFKAYPSASKLLLLSSFSGGAGGLLVFSDYN-PLKSILASDATLSDGQPIKKKKV  67

Query  335  VVLGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIR  514
            VVLG GW+G SFL  LK+P+ DVQV+SPRN+F FTPLLPSVT GTVE RSIVEPIR ++R
Sbjct  68   VVLGNGWSGYSFLSYLKNPNLDVQVVSPRNFFLFTPLLPSVTNGTVEARSIVEPIRGLMR  127

Query  515  KKNVDMQYCEAECIKIDA  568
            KK    +Y EAEC+KIDA
Sbjct  128  KKG--FEYKEAECVKIDA  143



>ref|XP_009137770.1| PREDICTED: external alternative NAD(P)H-ubiquinone oxidoreductase 
B1, mitochondrial [Brassica rapa]
Length=570

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  341  LGTGWAGTSFLKNLKDPSYDVQVISPRNYFAFTPLLPSVTCGTVEGRSIVEPIRNIIRKK  520
            LGTGWAG SFLK+L   SYDVQV+SP+NYFAFTPLLPSVTCGTVE RSIVE +RNI +KK
Sbjct  54   LGTGWAGISFLKDLDISSYDVQVVSPQNYFAFTPLLPSVTCGTVEARSIVESVRNITKKK  113

Query  521  NVDMQYCEAECIKID  565
            N +++  EA+C+KID
Sbjct  114  NGEIELWEADCVKID  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960