BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J23

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACX42226.1|  heat shock protein 90                                   296   8e-92   Ipomoea nil [qian niu]
ref|XP_009767250.1|  PREDICTED: heat shock protein 81-1-like            217   1e-62   Nicotiana sylvestris
ref|XP_006348634.1|  PREDICTED: endoplasmin homolog                     216   6e-62   Solanum tuberosum [potatoes]
ref|XP_004239010.1|  PREDICTED: heat shock protein 81-1                 214   2e-61   Solanum lycopersicum
ref|XP_009627613.1|  PREDICTED: heat shock protein 81-1-like            214   3e-61   Nicotiana tomentosiformis
emb|CDP00492.1|  unnamed protein product                                210   6e-60   Coffea canephora [robusta coffee]
ref|XP_009627181.1|  PREDICTED: heat shock protein 90-1-like            209   2e-59   Nicotiana tomentosiformis
ref|XP_009776793.1|  PREDICTED: heat shock protein 90-1-like            204   5e-58   Nicotiana sylvestris
ref|XP_011101956.1|  PREDICTED: heat shock protein 90-1-like            201   1e-56   Sesamum indicum [beniseed]
gb|EYU28898.1|  hypothetical protein MIMGU_mgv1a001578mg                199   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_002267463.2|  PREDICTED: heat shock protein 90-1                 199   4e-56   Vitis vinifera
ref|XP_007045726.1|  Chaperone protein htpG family protein isoform 1    198   9e-56   
ref|XP_007045727.1|  Chaperone protein htpG family protein isoform 2    198   1e-55   
emb|CAN62743.1|  hypothetical protein VITISV_033107                     197   9e-55   Vitis vinifera
ref|XP_002535115.1|  heat shock protein, putative                       183   2e-54   Ricinus communis
gb|KJB30529.1|  hypothetical protein B456_005G148100                    194   3e-54   Gossypium raimondii
gb|KJB30532.1|  hypothetical protein B456_005G148100                    193   3e-54   Gossypium raimondii
gb|KJB30528.1|  hypothetical protein B456_005G148100                    194   4e-54   Gossypium raimondii
gb|KJB30530.1|  hypothetical protein B456_005G148100                    193   5e-54   Gossypium raimondii
gb|KJB30531.1|  hypothetical protein B456_005G148100                    193   6e-54   Gossypium raimondii
gb|KHG10495.1|  Heat shock cognate 90 kDa                               192   8e-54   Gossypium arboreum [tree cotton]
ref|XP_011021135.1|  PREDICTED: heat shock protein 83-like              190   7e-53   Populus euphratica
gb|KDO70251.1|  hypothetical protein CISIN_1g0038271mg                  183   2e-52   Citrus sinensis [apfelsine]
gb|KDO70248.1|  hypothetical protein CISIN_1g0038271mg                  183   3e-52   Citrus sinensis [apfelsine]
ref|XP_002311417.1|  heat shock family protein                          187   7e-52   Populus trichocarpa [western balsam poplar]
ref|XP_004297188.1|  PREDICTED: heat shock protein 83                   187   8e-52   Fragaria vesca subsp. vesca
ref|XP_010044352.1|  PREDICTED: heat shock protein 90-1                 185   5e-51   Eucalyptus grandis [rose gum]
ref|XP_008243784.1|  PREDICTED: heat shock protein 90-1                 184   9e-51   
ref|XP_006484274.1|  PREDICTED: heat shock protein 83-like              184   1e-50   Citrus sinensis [apfelsine]
ref|XP_007225664.1|  hypothetical protein PRUPE_ppa001590mg             184   1e-50   Prunus persica
ref|XP_010091648.1|  Endoplasmin-like protein                           182   5e-50   
ref|XP_006437833.1|  hypothetical protein CICLE_v10030743mg             181   7e-50   Citrus clementina [clementine]
gb|AIT39757.1|  heat shock protein 90kDa beta                           181   1e-49   Chrysanthemum boreale
ref|XP_002315997.1|  heat shock family protein                          179   8e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011009282.1|  PREDICTED: heat shock protein 90-1-like            178   1e-48   Populus euphratica
ref|XP_009355621.1|  PREDICTED: heat shock protein 83                   177   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_008339741.1|  PREDICTED: heat shock protein 83                   177   3e-48   
ref|XP_010943343.1|  PREDICTED: heat shock protein 83-like              177   3e-48   Elaeis guineensis
ref|XP_008788962.1|  PREDICTED: heat shock protein 83-like              171   3e-46   Phoenix dactylifera
gb|KHG08899.1|  Heat shock 83                                           171   3e-46   Gossypium arboreum [tree cotton]
gb|AFM30925.1|  chloroplast heat shock protein 90                       159   4e-46   Prunus persica
ref|XP_010554255.1|  PREDICTED: heat shock protein 90-1                 169   2e-45   Tarenaya hassleriana [spider flower]
emb|CDX83528.1|  BnaC07g22680D                                          169   3e-45   
ref|XP_008466112.1|  PREDICTED: heat shock protein 83                   169   3e-45   Cucumis melo [Oriental melon]
ref|XP_006395659.1|  hypothetical protein EUTSA_v10003676mg             168   6e-45   Eutrema salsugineum [saltwater cress]
emb|CDY04167.1|  BnaA09g19450D                                          167   7e-45   
ref|XP_009152136.1|  PREDICTED: heat shock protein 90-1-like            167   1e-44   Brassica rapa
ref|XP_004149483.1|  PREDICTED: heat shock protein 83-like              167   1e-44   
gb|KGN49798.1|  hypothetical protein Csa_5G135340                       167   1e-44   Cucumis sativus [cucumbers]
gb|KFK33530.1|  hypothetical protein AALP_AA5G025000                    166   2e-44   Arabis alpina [alpine rockcress]
gb|KDP31417.1|  hypothetical protein JCGZ_11793                         165   6e-44   Jatropha curcas
ref|XP_010261402.1|  PREDICTED: heat shock protein 83-like              165   7e-44   Nelumbo nucifera [Indian lotus]
emb|CDY33122.1|  BnaC09g22180D                                          164   9e-44   Brassica napus [oilseed rape]
gb|EPS65742.1|  heat shock protein 90                                   155   2e-43   Genlisea aurea
ref|XP_006292451.1|  hypothetical protein CARUB_v10018672mg             163   2e-43   Capsella rubella
ref|XP_009394558.1|  PREDICTED: heat shock protein 83-like              162   7e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003518802.1|  PREDICTED: heat shock protein 83-like              162   1e-42   
ref|XP_010528013.1|  PREDICTED: heat shock protein 90-1-like isof...    162   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_010528014.1|  PREDICTED: heat shock protein 90-1-like isof...    161   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_007157601.1|  hypothetical protein PHAVU_002G083000g             160   5e-42   Phaseolus vulgaris [French bean]
ref|XP_010681164.1|  PREDICTED: heat shock protein 90-1 isoform X1      159   8e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681165.1|  PREDICTED: heat shock protein 90-1 isoform X2      159   9e-42   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI27411.3|  unnamed protein product                                159   1e-41   Vitis vinifera
ref|XP_008807013.1|  PREDICTED: heat shock protein 83-like              159   1e-41   Phoenix dactylifera
ref|XP_010257890.1|  PREDICTED: heat shock protein 81-1-like            158   2e-41   Nelumbo nucifera [Indian lotus]
dbj|BAF01546.1|  heat shock like protein                                152   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389364.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    154   4e-41   
ref|XP_002875241.1|  hypothetical protein ARALYDRAFT_484305             157   4e-41   
ref|XP_010502419.1|  PREDICTED: heat shock protein 83-like              155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010514162.1|  PREDICTED: heat shock protein 83-like isofor...    155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010514161.1|  PREDICTED: heat shock protein 83-like isofor...    155   2e-40   
ref|XP_010425190.1|  PREDICTED: heat shock protein 83-like              155   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_003516650.1|  PREDICTED: heat shock protein 90-1-like            154   5e-40   Glycine max [soybeans]
ref|XP_010927990.1|  PREDICTED: heat shock protein 83-like isofor...    153   6e-40   
ref|XP_009418533.1|  PREDICTED: heat shock protein 83-like              154   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927989.1|  PREDICTED: heat shock protein 83-like isofor...    153   2e-39   Elaeis guineensis
ref|NP_849932.1|  chloroplast heat shock protein 90                     151   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178487.1|  chloroplast heat shock protein 90                     151   5e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19795.1|  At2g04030/F3C11.14                                      151   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006844092.1|  hypothetical protein AMTR_s00006p00252810          150   3e-38   Amborella trichopoda
ref|NP_001146412.1|  hypothetical protein                               144   4e-37   
gb|KEH17540.1|  heat shock protein 81-2                                 146   5e-37   Medicago truncatula
gb|KJB80448.1|  hypothetical protein B456_013G098300                    145   1e-36   Gossypium raimondii
ref|XP_008651357.1|  PREDICTED: hypothetical protein isoform X1         144   3e-36   
tpg|DAA61912.1|  TPA: hypothetical protein ZEAMMB73_416250              143   4e-36   
ref|XP_004514756.1|  PREDICTED: endoplasmin homolog                     139   2e-34   Cicer arietinum [garbanzo]
ref|XP_009114127.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    139   2e-34   
gb|AIZ68156.1|  heat shock protein 83-like protein                      138   3e-34   Ornithogalum longebracteatum [sea-onion]
ref|XP_002444835.1|  hypothetical protein SORBIDRAFT_07g028940          138   4e-34   Sorghum bicolor [broomcorn]
ref|XP_008677634.1|  PREDICTED: uncharacterized protein LOC100383...    137   1e-33   
ref|NP_001063456.1|  Os09g0474300                                       135   1e-33   
gb|AFW65129.1|  hypothetical protein ZEAMMB73_326674                    137   1e-33   
gb|EEC84746.1|  hypothetical protein OsI_31743                          136   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004957103.1|  PREDICTED: endoplasmin homolog                     135   2e-33   Setaria italica
gb|EEE69897.1|  hypothetical protein OsJ_29732                          135   4e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CAA72515.1|  heat shock protein                                     132   4e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KHN29931.1|  Heat shock protein 83                                   132   5e-32   Glycine soja [wild soybean]
ref|XP_004973760.1|  PREDICTED: endoplasmin homolog                     132   7e-32   Setaria italica
ref|XP_003574676.1|  PREDICTED: heat shock cognate 90 kDa protein...    127   3e-30   Brachypodium distachyon [annual false brome]
dbj|BAK00031.1|  predicted protein                                      123   9e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP29908.1|  hypothetical protein JCGZ_18477                         116   2e-26   Jatropha curcas
ref|XP_003578283.1|  PREDICTED: heat shock cognate 90 kDa protein...    116   2e-26   Brachypodium distachyon [annual false brome]
gb|EEE68898.1|  hypothetical protein OsJ_27736                          115   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062103.1|  Os08g0487800                                       115   3e-26   
ref|XP_001779894.1|  predicted protein                                  115   4e-26   
emb|CAA82945.1|  heat-shock protein                                     115   5e-26   Secale cereale
ref|XP_009381110.1|  PREDICTED: heat shock protein 83                   112   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB33205.1|  hypothetical protein B456_006G000500                    105   2e-24   Gossypium raimondii
gb|EPS70213.1|  hypothetical protein M569_04546                         107   3e-24   Genlisea aurea
ref|XP_002531697.1|  heat shock protein, putative                       109   4e-24   Ricinus communis
ref|XP_006664594.1|  PREDICTED: heat shock protein 83-like              108   1e-23   
ref|XP_004962890.1|  PREDICTED: heat shock protein 83-like isofor...    108   1e-23   
ref|XP_004962889.1|  PREDICTED: heat shock protein 83-like isofor...    108   1e-23   Setaria italica
ref|XP_006363008.1|  PREDICTED: endoplasmin homolog                     108   2e-23   Solanum tuberosum [potatoes]
ref|XP_003575983.1|  PREDICTED: heat shock protein 83                   107   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_008800616.1|  PREDICTED: heat shock protein 83                   107   3e-23   Phoenix dactylifera
ref|XP_010270190.1|  PREDICTED: heat shock protein 81-1-like isof...    107   3e-23   Nelumbo nucifera [Indian lotus]
ref|XP_006849050.1|  hypothetical protein AMTR_s00028p00187760          107   3e-23   Amborella trichopoda
gb|KCW88689.1|  hypothetical protein EUGRSUZ_A01044                     106   4e-23   Eucalyptus grandis [rose gum]
ref|XP_010045864.1|  PREDICTED: heat shock protein 83                   106   4e-23   Eucalyptus grandis [rose gum]
ref|XP_004243554.1|  PREDICTED: heat shock protein 83                   106   5e-23   Solanum lycopersicum
gb|EMS64316.1|  Heat shock protein 83                                   106   5e-23   Triticum urartu
gb|EMT31740.1|  Heat shock protein 83                                   105   7e-23   
gb|ACG47228.1|  heat shock protein 83                                   104   8e-23   Zea mays [maize]
ref|XP_008648551.1|  PREDICTED: heat shock protein 83-like isofor...    105   9e-23   
ref|XP_008648550.1|  PREDICTED: heat shock protein 83-like isofor...    105   1e-22   
dbj|BAK01596.1|  predicted protein                                      105   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002443262.1|  hypothetical protein SORBIDRAFT_08g016560          105   1e-22   
gb|ACN33229.1|  unknown                                                 105   1e-22   Zea mays [maize]
ref|XP_007049300.1|  Heat shock protein 89.1 isoform 2                  105   1e-22   
ref|XP_008674382.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    105   2e-22   
gb|KDO58428.1|  hypothetical protein CISIN_1g003713mg                   104   2e-22   Citrus sinensis [apfelsine]
emb|CDY66279.1|  BnaAnng22000D                                          102   2e-22   Brassica napus [oilseed rape]
ref|XP_008379983.1|  PREDICTED: heat shock protein 90-1-like            104   2e-22   
gb|KDO58427.1|  hypothetical protein CISIN_1g003713mg                   104   3e-22   Citrus sinensis [apfelsine]
ref|XP_002507383.1|  predicted protein                                  104   3e-22   Micromonas commoda
gb|EEC69377.1|  hypothetical protein OsI_38512                          104   3e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001066882.1|  Os12g0514500                                       104   3e-22   
ref|XP_002270014.3|  PREDICTED: heat shock protein 83 isoform X2        104   3e-22   Vitis vinifera
ref|XP_010657447.1|  PREDICTED: heat shock protein 83 isoform X1        104   3e-22   Vitis vinifera
ref|XP_010943850.1|  PREDICTED: heat shock protein 83-like              104   3e-22   Elaeis guineensis
ref|XP_010657448.1|  PREDICTED: heat shock protein 83 isoform X3        104   3e-22   Vitis vinifera
ref|XP_010905224.1|  PREDICTED: heat shock protein 83-like              103   4e-22   Elaeis guineensis
gb|EEE53305.1|  hypothetical protein OsJ_36277                          104   4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010270191.1|  PREDICTED: heat shock protein 81-1-like isof...    103   4e-22   Nelumbo nucifera [Indian lotus]
ref|WP_044194393.1|  heat shock protein 90                              102   1e-21   Hyalangium minutum
ref|XP_009798975.1|  PREDICTED: heat shock protein 83                   102   1e-21   Nicotiana sylvestris
ref|XP_006447753.1|  hypothetical protein CICLE_v10014316mg             102   1e-21   Citrus clementina [clementine]
ref|XP_010112788.1|  Heat shock protein 90                              102   1e-21   Morus notabilis
ref|XP_003617951.1|  Heat-shock protein                                 102   1e-21   Medicago truncatula
ref|XP_009605137.1|  PREDICTED: heat shock protein 83                   101   2e-21   Nicotiana tomentosiformis
gb|KHN43948.1|  Heat shock protein 90                                   101   3e-21   Glycine soja [wild soybean]
ref|XP_002992602.1|  hypothetical protein SELMODRAFT_448838             101   3e-21   
ref|XP_009127645.1|  PREDICTED: uncharacterized protein LOC103852496  94.7    3e-21   Brassica rapa
ref|XP_003519663.1|  PREDICTED: heat shock protein 83-like              101   3e-21   Glycine max [soybeans]
ref|XP_002968038.1|  hypothetical protein SELMODRAFT_88538              100   4e-21   
ref|XP_008342195.1|  PREDICTED: heat shock protein 90-1-like            100   4e-21   Malus domestica [apple tree]
ref|XP_009365237.1|  PREDICTED: heat shock protein 81-1                 100   5e-21   Pyrus x bretschneideri [bai li]
ref|WP_015352209.1|  heat shock protein 90                              100   5e-21   Myxococcus stipitatus
ref|XP_006660235.1|  PREDICTED: endoplasmin homolog                     100   5e-21   
gb|KJB10747.1|  hypothetical protein B456_001G220600                    100   6e-21   Gossypium raimondii
ref|XP_008464175.1|  PREDICTED: heat shock protein 81-1                 100   6e-21   Cucumis melo [Oriental melon]
gb|EYU43186.1|  hypothetical protein MIMGU_mgv1a001565mg                100   6e-21   Erythranthe guttata [common monkey flower]
ref|XP_011048941.1|  PREDICTED: heat shock protein 83 isoform X3        100   6e-21   Populus euphratica
ref|XP_011048939.1|  PREDICTED: heat shock protein 83 isoform X2        100   6e-21   Populus euphratica
ref|XP_011048938.1|  PREDICTED: heat shock protein 83 isoform X1        100   6e-21   Populus euphratica
gb|KJB10746.1|  hypothetical protein B456_001G220600                    100   7e-21   Gossypium raimondii
gb|KJB10745.1|  hypothetical protein B456_001G220600                    100   7e-21   Gossypium raimondii
ref|XP_002321183.2|  hypothetical protein POPTR_0014s16280g           99.4    1e-20   
ref|WP_019674841.1|  heat shock protein 90                            98.6    2e-20   Rheinheimera perlucida
ref|XP_009178256.1|  hypothetical protein T265_16367                  91.3    2e-20   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_004293459.1|  PREDICTED: heat shock protein 90-1               98.6    3e-20   Fragaria vesca subsp. vesca
ref|XP_007142495.1|  hypothetical protein PHAVU_008G285400g           98.6    3e-20   Phaseolus vulgaris [French bean]
gb|EMS50921.1|  Endoplasmin                                           98.2    4e-20   Triticum urartu
ref|WP_008607439.1|  heat shock protein 90                            97.8    4e-20   Alishewanella aestuarii
ref|WP_008984231.1|  heat shock protein 90                            97.8    4e-20   Alishewanella agri
ref|WP_008951423.1|  heat shock protein 90                            97.8    4e-20   Alishewanella jeotgali
emb|CDY08910.1|  BnaC08g11400D                                        97.8    5e-20   Brassica napus [oilseed rape]
ref|XP_010252714.1|  PREDICTED: heat shock protein 90-1-like          97.8    5e-20   Nelumbo nucifera [Indian lotus]
ref|XP_007214966.1|  hypothetical protein PRUPE_ppa001503mg           97.8    5e-20   Prunus persica
ref|XP_008229890.1|  PREDICTED: heat shock protein 90-1               97.8    5e-20   Prunus mume [ume]
ref|XP_001441660.1|  hypothetical protein                             96.7    6e-20   Paramecium tetraurelia strain d4-2
ref|XP_004140007.1|  PREDICTED: endoplasmin homolog                   97.4    6e-20   Cucumis sativus [cucumbers]
ref|XP_004169550.1|  PREDICTED: endoplasmin homolog                   97.4    6e-20   
emb|CDY22132.1|  BnaC01g39690D                                        97.4    7e-20   Brassica napus [oilseed rape]
ref|XP_009124159.1|  PREDICTED: heat shock protein 90-1-like isof...  97.4    7e-20   Brassica rapa
ref|XP_009124162.1|  PREDICTED: heat shock protein 90-1-like isof...  97.4    7e-20   Brassica rapa
ref|WP_043392274.1|  heat shock protein 90                            97.1    7e-20   Archangium violaceum
gb|EFA78289.1|  heat shock protein Hsp90 family protein               97.1    1e-19   Heterostelium album PN500
gb|KHN46925.1|  Heat shock protein 90                                 97.1    1e-19   Glycine soja [wild soybean]
ref|XP_010684690.1|  PREDICTED: heat shock protein 83-like            96.7    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_002614951.1|  heat shock protein 90                            96.3    1e-19   Stigmatella aurantiaca
ref|XP_010665948.1|  PREDICTED: heat shock protein 83                 96.7    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_002643356.1|  Chaperone protein HtpG                           96.3    1e-19   Cystobacter fuscus
tpg|DAA46735.1|  TPA: hypothetical protein ZEAMMB73_851694            94.4    1e-19   
ref|XP_003545075.2|  PREDICTED: heat shock protein 83-like            96.3    2e-19   
ref|WP_008221881.1|  heat shock protein 90                            95.9    2e-19   Rheinheimera nanhaiensis
ref|XP_011085393.1|  PREDICTED: heat shock protein 83                 96.3    2e-19   Sesamum indicum [beniseed]
ref|WP_027669870.1|  heat shock protein 90                            95.9    2e-19   Rheinheimera baltica
ref|XP_010547210.1|  PREDICTED: heat shock protein 83-like isofor...  96.3    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_003617952.1|  Heat-shock protein                               96.3    2e-19   
ref|XP_010547208.1|  PREDICTED: heat shock protein 90-1-like isof...  96.3    2e-19   Tarenaya hassleriana [spider flower]
emb|CBI28422.3|  unnamed protein product                              95.9    3e-19   Vitis vinifera
tpg|DAA46734.1|  TPA: hypothetical protein ZEAMMB73_851694            93.2    3e-19   
ref|XP_006407799.1|  hypothetical protein EUTSA_v10020096mg           95.5    4e-19   Eutrema salsugineum [saltwater cress]
ref|XP_009147028.1|  PREDICTED: heat shock protein 90-1-like          95.1    5e-19   Brassica rapa
ref|WP_013938260.1|  heat shock protein 90                            94.7    5e-19   Myxococcus macrosporus
emb|CDY35962.1|  BnaA05g29880D                                        95.1    5e-19   Brassica napus [oilseed rape]
ref|WP_011556000.1|  heat shock protein 90                            94.7    5e-19   Myxococcus xanthus
ref|XP_003063917.1|  predicted protein                                94.7    5e-19   Micromonas pusilla CCMP1545
tpg|DAA34121.1|  TPA: endoplasmic reticulum glucose-regulated pro...  90.5    6e-19   Amblyomma variegatum
ref|WP_002635883.1|  heat shock protein 90                            94.4    6e-19   Myxococcus hansupus
ref|XP_005643869.1|  heat shock protein Hsp90                         94.4    6e-19   Coccomyxa subellipsoidea C-169
ref|WP_031571687.1|  heat shock protein 90                            94.4    7e-19   Pararheinheimera texasensis
ref|WP_043419882.1|  heat shock protein 90                            89.7    8e-19   
gb|AAG21337.1|AF273735_1  hypothetical esophageal gland cell secr...  89.0    9e-19   Heterodera glycines
pdb|3PEH|A  Chain A, Crystal Structure Of The N-Terminal Domain O...  90.9    1e-18   Plasmodium falciparum 3D7
emb|CDY28017.1|  BnaC05g44190D                                        94.0    1e-18   Brassica napus [oilseed rape]
dbj|GAM27457.1|  hypothetical protein SAMD00019534_106330             94.0    1e-18   Acytostelium subglobosum LB1
gb|AAT97075.1|  tumor rejection antigen-like protein                  88.2    1e-18   Lymnaea stagnalis
ref|XP_008660989.1|  PREDICTED: endoplasmin homolog                   89.7    2e-18   
ref|XP_001458509.1|  hypothetical protein                             93.2    2e-18   Paramecium tetraurelia strain d4-2
gb|KFK38234.1|  hypothetical protein AALP_AA3G086500                  93.2    2e-18   Arabis alpina [alpine rockcress]
ref|XP_001439907.1|  hypothetical protein                             93.2    2e-18   Paramecium tetraurelia strain d4-2
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                   93.2    2e-18   Prunus mume [ume]
ref|XP_005651682.1|  heat shock protein Hsp90                         93.2    2e-18   Coccomyxa subellipsoidea C-169
ref|XP_001432500.1|  hypothetical protein                             93.2    2e-18   Paramecium tetraurelia strain d4-2
ref|XP_001899398.1|  Endoplasmin precursor                            93.2    2e-18   Brugia malayi [agent of lymphatic filariasis]
ref|WP_014399372.1|  heat shock protein 90                            92.8    2e-18   Corallococcus coralloides
ref|XP_008814600.1|  heat shock protein 90kDa beta                    93.2    2e-18   Plasmodium inui San Antonio 1
ref|WP_044528292.1|  heat shock protein 90                            87.4    2e-18   
ref|WP_034783035.1|  heat shock protein 90                            87.8    3e-18   
dbj|BAD94659.1|  HSP90-like protein                                   90.1    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|WP_035460329.1|  heat shock protein 90                            92.4    3e-18   Alcanivorax
emb|CDR16821.1|  endoplasmin, putative                                92.8    3e-18   
ref|XP_007049299.1|  Heat shock protein 89.1 isoform 1                92.8    3e-18   
ref|XP_005823214.1|  hypothetical protein GUITHDRAFT_160160           92.8    3e-18   Guillardia theta CCMP2712
ref|WP_011588770.1|  heat shock protein 90                            92.0    3e-18   Alcanivorax
ref|WP_006030487.1|  heat shock protein 90                            92.4    3e-18   Moritella sp. PE36
gb|EPN64930.1|  heat shock protein 90                                 87.4    3e-18   Pseudomonas syringae pv. actinidiae ICMP 19096
ref|XP_001770511.1|  predicted protein                                92.8    3e-18   
ref|WP_027073502.1|  heat shock protein 90                            92.0    3e-18   Mannheimia granulomatis
ref|XP_739675.1|  hypothetical protein                                86.7    4e-18   
ref|XP_001350620.1|  endoplasmin homolog precursor, putative          92.4    4e-18   Plasmodium falciparum 3D7
gb|EWC75399.1|  hypothetical protein C923_03940                       92.4    4e-18   Plasmodium falciparum UGT5.1
ref|WP_031799180.1|  hypothetical protein                             85.9    4e-18   
gb|AFD53632.1|  90 kDa heat shock protein                             87.0    4e-18   Cryptosporidium andersoni
gb|AFD53634.1|  90 kDa heat shock protein                             87.0    4e-18   Cryptosporidium andersoni
ref|XP_676606.1|  endoplasmin precursor                               92.4    4e-18   
gb|AHK14392.1|  90 kDa heat shock protein                             87.0    4e-18   Cryptosporidium andersoni
ref|WP_026861934.1|  heat shock protein 90                            92.0    4e-18   Idiomarina sediminum
ref|XP_010726769.1|  PREDICTED: heat shock protein 83-like            85.9    4e-18   
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                   92.4    4e-18   Brachypodium distachyon [annual false brome]
gb|ADQ85998.1|  90 kDa heat shock protein                             87.0    4e-18   Cryptosporidium andersoni
tpg|DAA61910.1|  TPA: hypothetical protein ZEAMMB73_416250            92.0    4e-18   
emb|CDS52035.1|  endoplasmin, putative                                92.0    4e-18   
gb|AHG52035.1|  90 kDa heat shock protein                             87.0    4e-18   Cryptosporidium andersoni
emb|CDO65499.1|  endoplasmin, putative                                92.4    4e-18   Plasmodium reichenowi
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                   92.0    5e-18   Cucumis melo [Oriental melon]
ref|XP_001702984.1|  heat shock protein 90C                           92.0    5e-18   Chlamydomonas reinhardtii
ref|XP_725468.1|  heat shock protein 90                               92.0    5e-18   Plasmodium yoelii
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg           92.0    6e-18   Prunus persica
emb|CDL62541.1|  Chaperone protein HtpG                               85.9    6e-18   Klebsiella pneumoniae IS39
ref|WP_038898318.1|  hypothetical protein                             84.7    7e-18   
gb|ADQ85997.1|  90 kDa heat shock protein                             86.7    7e-18   Cryptosporidium andersoni
gb|ADQ85996.1|  90 kDa heat shock protein                             86.7    7e-18   Cryptosporidium andersoni
ref|XP_001433808.1|  hypothetical protein                             91.7    8e-18   Paramecium tetraurelia strain d4-2
ref|WP_034773957.1|  heat shock protein 90                            91.3    8e-18   Idiomarina salinarum
emb|CDL43388.1|  Chaperone protein HtpG                               85.5    8e-18   Klebsiella pneumoniae ISC21
gb|EUD74449.1|  heat shock protein 90kDa beta                         91.3    8e-18   Plasmodium vinckei petteri
ref|NP_001058590.1|  Os06g0716700                                     91.3    9e-18   
gb|AAL79732.1|AC091774_23  heat shock protein 90                      91.3    9e-18   Oryza sativa Japonica Group [Japonica rice]
ref|WP_006534030.1|  molecular chaperone                              85.1    9e-18   
ref|WP_042905590.1|  heat shock protein 90                            86.7    9e-18   
ref|XP_001617311.1|  endoplasmin precursor                            91.3    9e-18   Plasmodium vivax
dbj|BAA90487.1|  heat shock protein 90                                91.3    9e-18   Oryza sativa [red rice]
ref|WP_044651172.1|  heat shock protein 90                            85.5    9e-18   
ref|WP_028535568.1|  heat shock protein 90                            90.9    9e-18   Paludibacterium yongneupense
gb|EGH17053.1|  heat shock protein 90                                 87.0    9e-18   Pseudomonas savastanoi pv. glycinea str. race 4
ref|XP_008622859.1|  heat shock protein 90kDa beta                    91.3    9e-18   
ref|WP_020412728.1|  heat shock protein 90                            90.9    1e-17   
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...  91.3    1e-17   
gb|EAZ02369.1|  hypothetical protein OsI_24473                        91.3    1e-17   
gb|EAZ38293.1|  hypothetical protein OsJ_22671                        91.3    1e-17   
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                   91.3    1e-17   
ref|XP_002413149.1|  tumor rejection antigen (gp96), putative         91.3    1e-17   
ref|WP_004629047.1|  molecular chaperone of HSP90 family              90.9    1e-17   
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                   91.3    1e-17   
gb|EWM45868.1|  histidine kinase-, DNA gyrase B-, and HSP90-like ...  89.4    1e-17   
ref|XP_002633285.1|  Hypothetical protein CBG06014                    90.9    1e-17   
ref|XP_004358722.1|  heat shock protein Hsp90 family protein          90.9    1e-17   
ref|WP_024973131.1|  heat shock protein 90                            90.5    1e-17   
ref|WP_026042313.1|  hypothetical protein                             85.9    1e-17   
emb|CDY10992.1|  BnaA03g46510D                                        91.3    1e-17   
dbj|BAF00175.1|  putative heat shock protein                          90.9    1e-17   
ref|WP_033879532.1|  heat shock protein 90                            85.9    1e-17   
ref|NP_187434.2|  HEAT SHOCK PROTEIN 89.1                             90.9    1e-17   
gb|AAF13098.1|AC009176_25  putative heat-shock protein                90.9    1e-17   
ref|WP_032621552.1|  heat shock protein 90                            86.7    1e-17   
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg           90.9    1e-17   
emb|CAP26348.2|  Protein CBG06014                                     90.9    1e-17   
gb|ABV82432.1|  Hsp90-like protein                                    90.9    1e-17   
emb|CDY34264.1|  BnaA01g13670D                                        90.9    1e-17   
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                   90.9    1e-17   
ref|XP_002390612.1|  hypothetical protein MPER_10079                  87.4    1e-17   
ref|WP_031341097.1|  heat shock protein 90                            84.3    1e-17   
emb|CDY24830.1|  BnaA08g14800D                                        90.9    1e-17   
ref|WP_022986633.1|  heat shock protein 90                            90.1    1e-17   
ref|WP_011333126.1|  heat shock protein 90                            90.1    1e-17   
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                   90.5    1e-17   
emb|CDX92620.1|  BnaC07g38780D                                        90.5    2e-17   
ref|XP_003140246.1|  endoplasmin                                      90.5    2e-17   
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                   90.5    2e-17   
ref|XP_002948054.1|  hypothetical protein VOLCADRAFT_79927            90.5    2e-17   
dbj|BAF33716.1|  heat shock protein 92                                90.5    2e-17   
gb|ADQ86003.1|  90 kDa heat shock protein                             85.1    2e-17   
gb|ADQ86002.1|  90 kDa heat shock protein                             85.1    2e-17   
gb|ADQ86000.1|  90 kDa heat shock protein                             85.1    2e-17   
ref|WP_031343579.1|  heat shock protein 90                            84.7    2e-17   
ref|WP_027910898.1|  heat shock protein 90                            90.1    2e-17   
ref|WP_027905507.1|  heat shock protein 90                            90.1    2e-17   
ref|NP_974606.1|  HSP90-like protein GRP94                            90.1    2e-17   
ref|NP_194150.1|  HSP90-like protein GRP94                            90.1    2e-17   
ref|WP_025820574.1|  heat shock protein 90                            89.7    2e-17   
emb|CDY03477.1|  BnaC01g16050D                                        90.1    2e-17   
dbj|BAB86368.1|  SHEPHERD                                             90.1    2e-17   
ref|XP_002432348.1|  Hsp90 protein, putative                          90.1    2e-17   
ref|WP_027677813.1|  heat shock protein 90                            89.7    2e-17   
gb|EJW87335.1|  glucose-regulated protein 94                          90.1    2e-17   
ref|WP_025128644.1|  heat shock protein 90                            89.7    2e-17   
ref|WP_028860370.1|  heat shock protein 90                            89.7    2e-17   
ref|WP_028498034.1|  heat shock protein 90                            89.7    2e-17   
ref|WP_011000942.1|  heat shock protein 90                            89.7    2e-17   
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441           90.1    2e-17   
ref|XP_003055958.1|  predicted protein                                90.1    2e-17   
gb|AAX19870.1|  unknown                                               87.0    2e-17   
gb|AFD53629.1|  90 kDa heat shock protein                             85.1    2e-17   
ref|WP_019717840.1|  heat shock protein 90                            89.7    2e-17   
ref|WP_016723299.1|  heat shock protein 90                            89.7    2e-17   
ref|XP_002262292.1|  endoplasmin homolog                              90.1    2e-17   
ref|WP_011495872.1|  heat shock protein 90                            89.7    2e-17   
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                   90.1    2e-17   
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg           90.1    2e-17   
ref|WP_020997101.1|  histidine kinase-, DNA gyrase B-, and HSP90-...  86.7    2e-17   
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                   90.1    3e-17   
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343           90.1    3e-17   
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                   90.1    3e-17   
ref|XP_008620345.1|  heat shock protein 90kDa beta                    90.1    3e-17   
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847           90.1    3e-17   
ref|WP_035244097.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_024647137.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_043546529.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_033453313.1|  heat shock protein 90                            89.4    3e-17   
gb|ADQ86001.1|  90 kDa heat shock protein                             85.1    3e-17   
gb|AGZ62517.1|  90 kDa heat shock protein                             84.7    3e-17   
ref|WP_042996745.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_018984766.1|  heat shock protein 90                            89.4    3e-17   
ref|XP_007002143.1|  heat-shock protein 90                            89.7    3e-17   
ref|XP_002882549.1|  hypothetical protein ARALYDRAFT_896948           89.7    3e-17   
ref|WP_032959715.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_013791576.1|  heat shock protein 90                            89.4    3e-17   
emb|CED59590.1|  chaperone protein HtpG (heat shock protein HtpG)     89.4    3e-17   
ref|WP_010927519.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_033839579.1|  heat shock protein 90                            89.4    3e-17   
emb|CEI86384.1|  Putative Heat shock protein 90-1                     85.5    3e-17   
ref|WP_033458405.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_034732437.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_015040923.1|  heat shock protein                               89.4    3e-17   
ref|WP_033472079.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_003819170.1|  heat shock protein                               89.4    3e-17   
ref|WP_027287379.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_010925852.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_033448043.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_015038845.1|  heat shock protein                               89.4    3e-17   
ref|WP_006086212.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_032958379.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_033449998.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_015064608.1|  heat shock protein                               89.4    3e-17   
ref|WP_011847045.1|  heat shock protein 90                            89.4    3e-17   
ref|WP_033451596.1|  heat shock protein 90                            89.4    4e-17   
ref|WP_033473166.1|  heat shock protein 90                            89.4    4e-17   
ref|WP_012587438.1|  heat shock protein 90                            89.4    4e-17   
ref|WP_006082056.1|  heat shock protein 90                            89.4    4e-17   
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...  89.7    4e-17   
ref|WP_033474192.1|  heat shock protein 90                            89.4    4e-17   
ref|XP_001701885.1|  heat shock protein 90B                           89.4    4e-17   
ref|WP_033453649.1|  heat shock protein 90                            89.4    4e-17   
ref|WP_012700538.1|  heat shock protein 90                            89.4    4e-17   
ref|WP_028759653.1|  heat shock protein 90                            89.4    4e-17   
ref|WP_005015758.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_024976202.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_024542240.1|  MULTISPECIES: heat shock protein 90              89.0    4e-17   
gb|AIL62752.1|  heat shock protein 90                                 89.4    4e-17   
ref|WP_037417754.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_014610749.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_037425271.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_011072100.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_011623012.1|  heat shock protein 90                            89.0    4e-17   
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                   89.4    4e-17   
ref|WP_037028706.1|  MULTISPECIES: heat shock protein 90              89.0    4e-17   
gb|EXI91919.1|  High temperature protein G                            88.6    4e-17   
gb|ACD26001.1|  heat shock protein Hsp90                              89.0    4e-17   
ref|WP_028352867.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_011717370.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_011626432.1|  heat shock protein 90                            89.0    4e-17   
gb|EFP65840.1|  Hsp90 protein                                         89.0    4e-17   
ref|WP_011789043.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_023265730.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_011919453.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_043171483.1|  heat shock protein 90                            88.6    4e-17   
ref|WP_041668475.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_039375999.1|  heat shock protein 90                            89.0    4e-17   
ref|WP_007648736.1|  heat shock protein 90                            89.0    4e-17   
gb|AFW75766.1|  hypothetical protein ZEAMMB73_790349                  89.4    4e-17   
gb|ACS62220.1|  heat shock protein Hsp90                              89.0    4e-17   
gb|ADQ85999.1|  90 kDa heat shock protein                             84.7    4e-17   
ref|WP_042346180.1|  heat shock protein 90                            84.7    4e-17   
ref|XP_008892102.1|  hypothetical protein PPTG_02652                  89.4    4e-17   
gb|EPY31234.1|  molecular chaperone HtpG                              87.8    4e-17   
ref|WP_011520321.1|  heat shock protein 90                            89.0    4e-17   
gb|END72637.1|  histidine kinase-, DNA gyrase B-, and HSP90-like ...  84.7    5e-17   
ref|WP_017170757.1|  heat shock protein 90                            86.3    5e-17   
ref|XP_006299404.1|  hypothetical protein CARUB_v10015564mg           89.4    5e-17   
emb|CCA85894.1|  chaperone Hsp90                                      89.0    5e-17   
ref|WP_022373071.1|  chaperone protein HtpG                           89.0    5e-17   
ref|WP_004376611.1|  heat shock protein 90                            89.0    5e-17   
ref|WP_042915741.1|  heat shock protein 90                            85.1    5e-17   
ref|WP_039567810.1|  heat shock protein 90                            89.0    5e-17   
ref|WP_006956503.1|  heat shock protein 90                            89.0    5e-17   
ref|WP_003277915.1|  heat shock protein 90                            89.0    5e-17   
gb|AHG78632.1|  Chaperone protein htpG                                89.0    5e-17   
ref|WP_039803253.1|  heat shock protein 90                            89.0    5e-17   
gb|AHG78615.1|  Chaperone protein htpG                                89.0    5e-17   
ref|NP_001151475.1|  endoplasmin precursor                            89.4    5e-17   
ref|WP_014617501.1|  heat shock protein 90                            89.0    5e-17   
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1             89.0    5e-17   
ref|WP_003268875.1|  heat shock protein 90                            89.0    5e-17   
ref|WP_013206551.1|  heat shock protein 90                            89.0    5e-17   
gb|AFW75767.1|  endoplasmin                                           89.0    5e-17   
gb|AHG76633.1|  Chaperone protein htpG                                88.6    5e-17   
ref|WP_031625734.1|  heat shock protein 90                            84.3    5e-17   
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...  89.0    5e-17   
ref|WP_033460270.1|  heat shock protein 90                            88.6    5e-17   
ref|WP_042801992.1|  heat shock protein 90                            88.6    5e-17   
ref|WP_011637009.1|  heat shock protein 90                            88.6    5e-17   
ref|WP_033462973.1|  heat shock protein 90                            88.6    5e-17   
ref|WP_010929604.1|  heat shock protein 90                            88.6    5e-17   
ref|WP_013213060.1|  heat shock protein 90                            88.6    6e-17   
ref|WP_043195740.1|  heat shock protein 90                            88.6    6e-17   
ref|WP_003807802.1|  heat shock protein                               88.6    6e-17   
ref|XP_004994487.1|  heat shock protein gp96                          89.0    6e-17   
ref|WP_019248757.1|  heat shock protein 90                            88.6    6e-17   
ref|XP_003288550.1|  hypothetical protein DICPUDRAFT_98061            89.0    6e-17   
ref|WP_034897813.1|  heat shock protein 90                            88.6    6e-17   
ref|XP_004224999.1|  endoplasmin precursor                            89.0    6e-17   
ref|WP_036557995.1|  heat shock protein 90                            88.6    6e-17   
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                   89.0    6e-17   
ref|WP_018025889.1|  hypothetical protein                             88.6    6e-17   
ref|WP_042044698.1|  heat shock protein 90                            88.6    6e-17   
gb|AAA27574.1|  heat shock protein                                    83.2    6e-17   
ref|WP_032639943.1|  heat shock protein 90                            87.0    6e-17   
ref|WP_011759429.1|  heat shock protein 90                            88.6    6e-17   
emb|CBN74418.1|  Heat shock protein 90                                89.0    6e-17   
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                  89.0    6e-17   
ref|WP_034037267.1|  heat shock protein 90                            88.6    6e-17   
ref|WP_023251263.1|  heat shock protein 90                            84.7    6e-17   
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                   89.0    6e-17   
gb|EPY36929.1|  molecular chaperone HtpG                              88.2    7e-17   
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                   89.0    7e-17   
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                   89.0    7e-17   
ref|WP_017222921.1|  heat shock protein 90                            88.6    7e-17   
ref|XP_009596271.1|  PREDICTED: endoplasmin homolog                   88.6    7e-17   
ref|WP_019331713.1|  hypothetical protein                             87.0    7e-17   
emb|CAA33132.1|  heat shock protein 90                                82.0    7e-17   
ref|WP_043213906.1|  heat shock protein 90                            88.2    7e-17   
ref|WP_042143000.1|  heat shock protein 90                            88.2    8e-17   
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg              88.6    8e-17   
ref|WP_035229120.1|  heat shock protein 90                            88.2    8e-17   
gb|KGD66338.1|  heat shock protein 90                                 88.2    8e-17   
gb|ESJ92762.1|  heat shock protein 90                                 84.3    8e-17   
dbj|BAL42333.1|  Heat shock protein 90                                88.6    8e-17   
gb|EMS56078.1|  Endoplasmin-like protein                              88.6    8e-17   
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                  88.6    8e-17   
ref|WP_025289565.1|  heat shock protein 90                            88.2    8e-17   
ref|WP_015432897.1|  Chaperone protein htpG                           88.2    8e-17   
ref|WP_025011038.1|  MULTISPECIES: heat shock protein 90              88.2    8e-17   
ref|WP_044734784.1|  heat shock protein 90                            88.2    8e-17   
ref|WP_039033858.1|  heat shock protein 90                            88.2    8e-17   
ref|XP_005100278.1|  PREDICTED: mesocentin-like                       89.0    8e-17   
ref|WP_034939265.1|  heat shock protein 90                            88.2    9e-17   
ref|WP_037443129.1|  heat shock protein 90                            88.2    9e-17   
ref|WP_019439248.1|  heat shock protein 90                            88.2    9e-17   
gb|KIE96678.1|  putative heat shock protein 90                        85.5    9e-17   
ref|WP_028099396.1|  heat shock protein 90                            87.8    9e-17   
gb|ETP47333.1|  hypothetical protein, variant                         88.6    9e-17   
ref|XP_008646956.1|  PREDICTED: endoplasmin homolog                   84.7    9e-17   
ref|WP_028357669.1|  heat shock protein 90                            87.8    1e-16   
emb|CCK01490.1|  Chaperone protein HtpG                               83.6    1e-16   
gb|AET97611.1|  heat shock protein 90b                                87.8    1e-16   
gb|ETP47332.1|  hypothetical protein F442_06594                       88.2    1e-16   



>gb|ACX42226.1| heat shock protein 90 [Ipomoea nil]
Length=793

 Score =   296 bits (757),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/147 (99%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR
Sbjct  1    MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  60

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD
Sbjct  61   DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  120

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEPSLLGDAGELQIRIK
Sbjct  121  ALDKLRFLSVTEPSLLGDAGELQIRIK  147



>ref|XP_009767250.1| PREDICTED: heat shock protein 81-1-like [Nicotiana sylvestris]
Length=798

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKL-  273
            MAPV+SRSLTS  +A+VP++PS    S   NRV  L++ FLP+N L+N    SGLKWKL 
Sbjct  1    MAPVVSRSLTSAPMASVPYSPSIVLGSGNTNRVC-LKNGFLPKNNLKNGFLQSGLKWKLQ  59

Query  274  ERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            E+RDS VVVRCEASAVAEKEA ES GETH YQAEVSRLLDLIVHSLYSHKE+FLRELVSN
Sbjct  60   EKRDSRVVVRCEASAVAEKEASESPGETHEYQAEVSRLLDLIVHSLYSHKEVFLRELVSN  119

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL +TEPSLLGD+GEL+IRIK
Sbjct  120  ASDALDKLRFLSLTEPSLLGDSGELEIRIK  149



>ref|XP_006348634.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=797

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 125/149 (84%), Gaps = 3/149 (2%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSLTS  +A+VP++PSF   S   NRV  L+S FLPRN ++N    SGL+WK +
Sbjct  1    MAPVVSRSLTSSPMASVPYSPSFVLGSGSTNRVC-LKSTFLPRNNIKNGFLQSGLRWKQD  59

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +RD  VVVRCEASAVAEKEA E+ GETH YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  60   KRDVGVVVRCEASAVAEKEASETSGETHEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  119

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL +TEPSLLGD+ EL+IRIK
Sbjct  120  SDALDKLRFLSLTEPSLLGDSSELEIRIK  148



>ref|XP_004239010.1| PREDICTED: heat shock protein 81-1 [Solanum lycopersicum]
Length=787

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 125/149 (84%), Gaps = 3/149 (2%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSLTS  +A+VP++PSF   S   NRV  L++ FLPRN ++N    SGL+WK +
Sbjct  1    MAPVVSRSLTSSPMASVPYSPSFVLGSGSTNRVC-LKTTFLPRNNIKNGFLQSGLRWKQD  59

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +RD  VVVRCEASAVAEKEA E+ GETH YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  60   KRDVGVVVRCEASAVAEKEASETSGETHEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  119

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL +TEPSLLGD+ EL+IRIK
Sbjct  120  SDALDKLRFLSLTEPSLLGDSSELEIRIK  148



>ref|XP_009627613.1| PREDICTED: heat shock protein 81-1-like [Nicotiana tomentosiformis]
Length=798

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKL-  273
            MAPV+SRSLTS  +A+VP++PS    S   NRV  L++AFLP+N ++N    SGLKWKL 
Sbjct  1    MAPVVSRSLTSASMASVPYSPSIVLGSGNINRVC-LKNAFLPKNNIKNGFLQSGLKWKLQ  59

Query  274  ERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            E+RDS VVVRCEASAVAEKEA ES GET  YQAEVSRLLDLIVHSLYSHKE+FLRELVSN
Sbjct  60   EKRDSRVVVRCEASAVAEKEASESPGETREYQAEVSRLLDLIVHSLYSHKEVFLRELVSN  119

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL +TEPSLLGD+GEL+IRIK
Sbjct  120  ASDALDKLRFLSLTEPSLLGDSGELEIRIK  149



>emb|CDP00492.1| unnamed protein product [Coffea canephora]
Length=799

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 5/152 (3%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPS-FPQKSAGGNRVAALRSAFLPRNGLRNRL-SSSGLKWK  270
            MAPV+SRS+TS  VA++P+  + F       +RV  L SAFLPRNGLRN L  SSGLKWK
Sbjct  1    MAPVLSRSVTSASVASLPYQKAPFSSVETKNSRVGVLGSAFLPRNGLRNSLLKSSGLKWK  60

Query  271  LERRDSSVVVRCEA-SAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
            LERR+S VVV+CE  +AVAEKEAPE  GE H YQAEVSRLLDLIVHSLYSHKE+FLRELV
Sbjct  61   LERRESRVVVKCEGGAAVAEKEAPEVSGEIHDYQAEVSRLLDLIVHSLYSHKEVFLRELV  120

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SNASDALDKLRFL VTEP LLGDAG+L+IRIK
Sbjct  121  SNASDALDKLRFLSVTEPGLLGDAGDLEIRIK  152



>ref|XP_009627181.1| PREDICTED: heat shock protein 90-1-like [Nicotiana tomentosiformis]
Length=791

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 124/150 (83%), Gaps = 4/150 (3%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SRSLTS  ++++P+T SF  +S   NR    RS FL +NGL+NR    GLK K+E
Sbjct  1    MAPALSRSLTSASMSSLPYTASFSLRSGSANRFC-FRSFFLQKNGLKNRFCEYGLKTKME  59

Query  277  RRDSSVVVRCEA-SAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            + D+ VVVRCEA +AVAEKEAPES GETH YQAEVSRL+DLIVHSLYSHKE+FLRELVSN
Sbjct  60   KIDNRVVVRCEAGAAVAEKEAPESSGETHEYQAEVSRLMDLIVHSLYSHKEVFLRELVSN  119

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL +TEPSLLGDAGEL+IRIK
Sbjct  120  ASDALDKLRFLSLTEPSLLGDAGELEIRIK  149



>ref|XP_009776793.1| PREDICTED: heat shock protein 90-1-like [Nicotiana sylvestris]
Length=786

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 123/150 (82%), Gaps = 8/150 (5%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSLTS  ++++P+T SF  +S   NR    +S FLP+N    R    GLK KLE
Sbjct  1    MAPVLSRSLTSASMSSLPYTASFSLRSGSANRFC-FKSVFLPKN----RFCEYGLKTKLE  55

Query  277  RRDSSVVVRCEA-SAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            +RD+ VVVRCEA +AVAEKEAPES GETH YQAEVSRL+DLIVHSLYSHKE+FLRELVSN
Sbjct  56   KRDNRVVVRCEAATAVAEKEAPESSGETHEYQAEVSRLMDLIVHSLYSHKEVFLRELVSN  115

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL +TEPSLLGDAGEL+IRIK
Sbjct  116  ASDALDKLRFLSLTEPSLLGDAGELEIRIK  145



>ref|XP_011101956.1| PREDICTED: heat shock protein 90-1-like [Sesamum indicum]
 ref|XP_011101957.1| PREDICTED: heat shock protein 90-1-like [Sesamum indicum]
Length=798

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSL S  VAAVP+T SF  +++G +    LRSAFLPRNGL++    SGL+WKLE
Sbjct  1    MAPVLSRSLASASVAAVPYTGSFCVRNSGKSNRGLLRSAFLPRNGLKSSFQRSGLEWKLE  60

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            RR S VVVRCEA+AVAEKEAPE  GET+ YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  61   RRQSGVVVRCEAAAVAEKEAPEGAGETYEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  120

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEP+LLGDAGEL+IRIK
Sbjct  121  SDALDKLRFLSVTEPALLGDAGELEIRIK  149



>gb|EYU28898.1| hypothetical protein MIMGU_mgv1a001578mg [Erythranthe guttata]
Length=791

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAV--PFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSL S A    P+T SF  K+ G +    LRSAFLPRNGL+N  S SGL+WKLE
Sbjct  1    MAPVLSRSLASAAVAAVPYTASFSIKNTGKSSRGFLRSAFLPRNGLKNSFSRSGLEWKLE  60

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            RR SSVVVRCEA+AVAEKEAP+++GET+ YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  61   RRQSSVVVRCEAAAVAEKEAPQADGETYEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  120

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEP+LLGDAGEL IRIK
Sbjct  121  SDALDKLRFLSVTEPALLGDAGELAIRIK  149



>ref|XP_002267463.2| PREDICTED: heat shock protein 90-1 [Vitis vinifera]
Length=792

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 117/148 (79%), Gaps = 6/148 (4%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNR-VAALRSAFLPRNGLRNRLSSSGLKWKLER  279
            MAPV+SRSL   A  P T SFP  +   NR V  LR+ F+P NGLR   S SGLKWKLE+
Sbjct  1    MAPVLSRSL---ATAPLT-SFPLNNINNNRRVLNLRNTFVPLNGLRKGFSCSGLKWKLEK  56

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R S V VRCEA  VAEKEAP++ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNAS
Sbjct  57   RGSRVGVRCEA-GVAEKEAPDTPGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNAS  115

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEPSLLGDAGEL+IRIK
Sbjct  116  DALDKLRFLSVTEPSLLGDAGELEIRIK  143



>ref|XP_007045726.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY01558.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=789

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 118/149 (79%), Gaps = 10/149 (7%)
 Frame = +1

Query  103  MAPVMSRSLT--SVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSL   S+ ++P T          N+  ALRSAFLPRNGL    S +GL+WKL 
Sbjct  1    MAPVLSRSLATPSLVSLPLT--------NPNKAFALRSAFLPRNGLHKAFSCTGLRWKLG  52

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R++ + VRCEASAVAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  53   KRNNQIAVRCEASAVAEKEAEETSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  112

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLG++GEL+IRIK
Sbjct  113  SDALDKLRFLSVTEPSLLGESGELEIRIK  141



>ref|XP_007045727.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY01559.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=764

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 118/149 (79%), Gaps = 10/149 (7%)
 Frame = +1

Query  103  MAPVMSRSLT--SVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSL   S+ ++P T          N+  ALRSAFLPRNGL    S +GL+WKL 
Sbjct  1    MAPVLSRSLATPSLVSLPLT--------NPNKAFALRSAFLPRNGLHKAFSCTGLRWKLG  52

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R++ + VRCEASAVAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  53   KRNNQIAVRCEASAVAEKEAEETSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  112

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLG++GEL+IRIK
Sbjct  113  SDALDKLRFLSVTEPSLLGESGELEIRIK  141



>emb|CAN62743.1| hypothetical protein VITISV_033107 [Vitis vinifera]
Length=1168

 Score =   197 bits (502),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 117/148 (79%), Gaps = 6/148 (4%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNR-VAALRSAFLPRNGLRNRLSSSGLKWKLER  279
            MAPV+SRSL   A  P T SFP  +   NR V  LR+ F+P NGLR   S SGLKWKLE+
Sbjct  1    MAPVLSRSL---ATAPLT-SFPLNNINNNRRVLNLRNTFVPLNGLRKGFSCSGLKWKLEK  56

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R S V VRCEA  VAEKEAP++ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNAS
Sbjct  57   RGSRVGVRCEA-GVAEKEAPDTPGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNAS  115

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEPSLLGDAGEL+IRIK
Sbjct  116  DALDKLRFLSVTEPSLLGDAGELEIRIK  143



>ref|XP_002535115.1| heat shock protein, putative [Ricinus communis]
 gb|EEF27267.1| heat shock protein, putative, partial [Ricinus communis]
Length=220

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 117/156 (75%), Gaps = 15/156 (10%)
 Frame = +1

Query  103  MAPVMSRSLTSVA------AVPFTPSFPQKSAGGNRVAALRSAFLPR---NGLRNRLSSS  255
            MAPV+SRSL++ +      + PF+   P      NR   L S FLP+   NGLR   S S
Sbjct  1    MAPVLSRSLSTASLLYLPSSTPFSLKHPS-----NRSFNLGSPFLPQINNNGLRKGFSCS  55

Query  256  GLKWKLERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFL  435
            GLKWKL++R++   VRCEA AVAEKEA ++ GE   YQAEVSRLLDLIVHSLYSHKE+FL
Sbjct  56   GLKWKLDKRNNRFAVRCEA-AVAEKEASDTSGEKFEYQAEVSRLLDLIVHSLYSHKEVFL  114

Query  436  RELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            RELVSNASDALDKLRFL VTEPSLLGDAG+L+IRI+
Sbjct  115  RELVSNASDALDKLRFLSVTEPSLLGDAGDLEIRIR  150



>gb|KJB30529.1| hypothetical protein B456_005G148100 [Gossypium raimondii]
Length=743

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 116/149 (78%), Gaps = 10/149 (7%)
 Frame = +1

Query  103  MAPVMSRSLT--SVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSL   S+A++P T          N+   LR+AFLP N L    S S L+WKLE
Sbjct  1    MAPVLSRSLATPSLASLPLT--------NPNKAFNLRTAFLPPNALNKAFSCSRLRWKLE  52

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R++ + VRCEASAVAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  53   KRNNRIAVRCEASAVAEKEAEETSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  112

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGD+GEL+IRIK
Sbjct  113  SDALDKLRFLSVTEPSLLGDSGELEIRIK  141



>gb|KJB30532.1| hypothetical protein B456_005G148100 [Gossypium raimondii]
Length=698

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 116/149 (78%), Gaps = 10/149 (7%)
 Frame = +1

Query  103  MAPVMSRSLT--SVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSL   S+A++P T          N+   LR+AFLP N L    S S L+WKLE
Sbjct  1    MAPVLSRSLATPSLASLPLT--------NPNKAFNLRTAFLPPNALNKAFSCSRLRWKLE  52

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R++ + VRCEASAVAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  53   KRNNRIAVRCEASAVAEKEAEETSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  112

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGD+GEL+IRIK
Sbjct  113  SDALDKLRFLSVTEPSLLGDSGELEIRIK  141



>gb|KJB30528.1| hypothetical protein B456_005G148100 [Gossypium raimondii]
Length=790

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 116/149 (78%), Gaps = 10/149 (7%)
 Frame = +1

Query  103  MAPVMSRSLT--SVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSL   S+A++P T          N+   LR+AFLP N L    S S L+WKLE
Sbjct  1    MAPVLSRSLATPSLASLPLT--------NPNKAFNLRTAFLPPNALNKAFSCSRLRWKLE  52

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R++ + VRCEASAVAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  53   KRNNRIAVRCEASAVAEKEAEETSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  112

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGD+GEL+IRIK
Sbjct  113  SDALDKLRFLSVTEPSLLGDSGELEIRIK  141



>gb|KJB30530.1| hypothetical protein B456_005G148100 [Gossypium raimondii]
Length=746

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 116/149 (78%), Gaps = 10/149 (7%)
 Frame = +1

Query  103  MAPVMSRSLT--SVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSL   S+A++P T          N+   LR+AFLP N L    S S L+WKLE
Sbjct  1    MAPVLSRSLATPSLASLPLT--------NPNKAFNLRTAFLPPNALNKAFSCSRLRWKLE  52

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R++ + VRCEASAVAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  53   KRNNRIAVRCEASAVAEKEAEETSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  112

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGD+GEL+IRIK
Sbjct  113  SDALDKLRFLSVTEPSLLGDSGELEIRIK  141



>gb|KJB30531.1| hypothetical protein B456_005G148100 [Gossypium raimondii]
Length=832

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 116/149 (78%), Gaps = 10/149 (7%)
 Frame = +1

Query  103  MAPVMSRSLT--SVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SRSL   S+A++P T          N+   LR+AFLP N L    S S L+WKLE
Sbjct  1    MAPVLSRSLATPSLASLPLT--------NPNKAFNLRTAFLPPNALNKAFSCSRLRWKLE  52

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R++ + VRCEASAVAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  53   KRNNRIAVRCEASAVAEKEAEETSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  112

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGD+GEL+IRIK
Sbjct  113  SDALDKLRFLSVTEPSLLGDSGELEIRIK  141



>gb|KHG10495.1| Heat shock cognate 90 kDa [Gossypium arboreum]
Length=790

 Score =   192 bits (489),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 114/147 (78%), Gaps = 6/147 (4%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAPV+SRSL + +    T + P      N+   LR+AFLP N L    S S L+WKLE+R
Sbjct  1    MAPVLSRSLATPSLASLTLTNP------NKAFNLRTAFLPPNALNKAFSCSRLRWKLEKR  54

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            ++ + VRCEASAVAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNASD
Sbjct  55   NNRIAVRCEASAVAEKEAEETSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASD  114

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEPSLLGD+GEL+IRIK
Sbjct  115  ALDKLRFLSVTEPSLLGDSGELEIRIK  141



>ref|XP_011021135.1| PREDICTED: heat shock protein 83-like [Populus euphratica]
Length=791

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 118/148 (80%), Gaps = 4/148 (3%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRN-GLRNRLSSSGLKWKLER  279
            MAPV+SRSL + A++   PS  +     N+V  LRS FLP+N GL+   S SGLKWKLE+
Sbjct  1    MAPVLSRSLATSASLISLPSSIRHP--NNKVLNLRSVFLPQNNGLKKEFSCSGLKWKLEK  58

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R+  + VRCEA AVAEKEA ++ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNAS
Sbjct  59   RNDRISVRCEA-AVAEKEATDTSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNAS  117

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEPSLLGDAG+L+IRI+
Sbjct  118  DALDKLRFLSVTEPSLLGDAGDLEIRIR  145



>gb|KDO70251.1| hypothetical protein CISIN_1g0038271mg, partial [Citrus sinensis]
Length=398

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 7/149 (5%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SR+L  TS+ ++P +  F  K +  N+    RSAFLPR+G    L+ +GLKW L+
Sbjct  1    MAPVLSRTLATTSLVSLPTSTPFSFKHSN-NKAFNFRSAFLPRSG---GLTCAGLKWNLQ  56

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R+  V +RC+A AVA+KEAP++ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  57   KRNKRVGIRCDA-AVADKEAPDTSGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  115

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  116  SDALDKLRFLSVTEPSLLGDAGDLEIRIK  144



>gb|KDO70248.1| hypothetical protein CISIN_1g0038271mg, partial [Citrus sinensis]
 gb|KDO70249.1| hypothetical protein CISIN_1g0038271mg, partial [Citrus sinensis]
 gb|KDO70250.1| hypothetical protein CISIN_1g0038271mg, partial [Citrus sinensis]
Length=425

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 7/149 (5%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SR+L  TS+ ++P +  F  K +  N+    RSAFLPR+G    L+ +GLKW L+
Sbjct  1    MAPVLSRTLATTSLVSLPTSTPFSFKHSN-NKAFNFRSAFLPRSG---GLTCAGLKWNLQ  56

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R+  V +RC+A AVA+KEAP++ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  57   KRNKRVGIRCDA-AVADKEAPDTSGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  115

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  116  SDALDKLRFLSVTEPSLLGDAGDLEIRIK  144



>ref|XP_002311417.1| heat shock family protein [Populus trichocarpa]
 gb|EEE88784.1| heat shock family protein [Populus trichocarpa]
Length=791

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 4/148 (3%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRN-GLRNRLSSSGLKWKLER  279
            MAPV+SRSL + A++   PS  +     N+V  LRS FL +N GL+   S SGLKWKLE+
Sbjct  1    MAPVLSRSLATYASLISLPSSIRHP--NNKVLNLRSVFLSQNNGLKKEFSCSGLKWKLEK  58

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R+  + VRCEA AVAEKEA ++ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNAS
Sbjct  59   RNDRISVRCEA-AVAEKEATDTSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNAS  117

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEPSLLGDAG+L+IRI+
Sbjct  118  DALDKLRFLSVTEPSLLGDAGDLEIRIR  145



>ref|XP_004297188.1| PREDICTED: heat shock protein 83 [Fragaria vesca subsp. vesca]
Length=793

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 115/147 (78%), Gaps = 4/147 (3%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAPV+SRSL S A++   PSF  ++   N+   LR+AF+P+NGLR   +  GLKW+LE  
Sbjct  1    MAPVLSRSL-STASLASIPSFSLRNP--NKAFNLRTAFVPQNGLRKGFTCGGLKWRLETN  57

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
               V VRC+A AVA+KE  ++ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNASD
Sbjct  58   KRQVTVRCDA-AVADKEVADAPGEEFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASD  116

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEPSLLGDAGELQIRIK
Sbjct  117  ALDKLRFLSVTEPSLLGDAGELQIRIK  143



>ref|XP_010044352.1| PREDICTED: heat shock protein 90-1 [Eucalyptus grandis]
 gb|KCW86441.1| hypothetical protein EUGRSUZ_B03110 [Eucalyptus grandis]
Length=799

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 112/148 (76%), Gaps = 2/148 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAG-GNRVAALRSAFLPRNGLRNRLSSSGLKWKLER  279
            MAP +SR L          S    S   GN V +LRSAFLP NGLR   S  GLKWKLE+
Sbjct  1    MAPALSRGLAGAPLASLPSSSSSFSLKKGNTVLSLRSAFLPPNGLRTGFSCGGLKWKLEK  60

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R++ V +RCE SAVAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNAS
Sbjct  61   RNNRVSIRCE-SAVAEKEAGETSGEQFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNAS  119

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEP+LLGDAG+L+IRI+
Sbjct  120  DALDKLRFLSVTEPALLGDAGDLEIRIR  147



>ref|XP_008243784.1| PREDICTED: heat shock protein 90-1 [Prunus mume]
Length=797

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 116/153 (76%), Gaps = 13/153 (8%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVP------FTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLK  264
            MAPV+SRSL + +         FT   P+K+       +LRSAF+P+NGLR   S  GLK
Sbjct  1    MAPVLSRSLATASLASLPSSSPFTLRNPRKAL------SLRSAFVPQNGLRKGFSCGGLK  54

Query  265  WKLERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLREL  444
            WKLE ++  + +RC+A AVAEKEA ++ GE   YQAEV+RL+DLIVHSLYSHKE+FLREL
Sbjct  55   WKLESKNRGISIRCDA-AVAEKEATDTPGEKFEYQAEVTRLMDLIVHSLYSHKEVFLREL  113

Query  445  VSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            VSNASDALDKLRFL VTEPSLLGDAGELQIRIK
Sbjct  114  VSNASDALDKLRFLSVTEPSLLGDAGELQIRIK  146



>ref|XP_006484274.1| PREDICTED: heat shock protein 83-like [Citrus sinensis]
Length=793

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 7/149 (5%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SR+L  TS+ ++P +  F  K +  N+    RSAFLPR+G    L+ +GLKW L+
Sbjct  1    MAPVLSRTLATTSLVSLPTSTPFSFKHSN-NKAFNFRSAFLPRSG---GLTCAGLKWNLQ  56

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R+  V +RC+A AVA+KEAP++ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  57   KRNKRVGIRCDA-AVADKEAPDTSGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  115

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  116  SDALDKLRFLSVTEPSLLGDAGDLEIRIK  144



>ref|XP_007225664.1| hypothetical protein PRUPE_ppa001590mg [Prunus persica]
 gb|EMJ26863.1| hypothetical protein PRUPE_ppa001590mg [Prunus persica]
Length=797

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 115/153 (75%), Gaps = 13/153 (8%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVP------FTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLK  264
            MAPV+SRSL + +         FT   P K+       +LRSAF+P+NGLR   S  GLK
Sbjct  1    MAPVLSRSLATASLASLPSSSPFTLRNPSKAL------SLRSAFVPQNGLRKGFSCGGLK  54

Query  265  WKLERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLREL  444
            WKLE ++  + +RC+A AVAEKEA ++ GE   YQAEV+RL+DLIVHSLYSHKE+FLREL
Sbjct  55   WKLESKNRGISIRCDA-AVAEKEATDTPGEKFEYQAEVTRLMDLIVHSLYSHKEVFLREL  113

Query  445  VSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            VSNASDALDKLRFL VTEPSLLGDAGELQIRIK
Sbjct  114  VSNASDALDKLRFLSVTEPSLLGDAGELQIRIK  146



>ref|XP_010091648.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXB44914.1| Endoplasmin-like protein [Morus notabilis]
Length=809

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 116/148 (78%), Gaps = 2/148 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNR-LSSSGLKWKLER  279
            MAPV+SRSL + +      S P  +     + +LRSAF+P NGLR + LS SGL WKL+R
Sbjct  1    MAPVLSRSLATASLASLPSSSPFTARRSPNIFSLRSAFVPPNGLRRKGLSCSGLNWKLQR  60

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R+ +  VRCEA+ VAEKEA ++ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNAS
Sbjct  61   RNGNFAVRCEAT-VAEKEAADASGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNAS  119

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  120  DALDKLRFLSVTEPSLLGDAGQLEIRIK  147



>ref|XP_006437833.1| hypothetical protein CICLE_v10030743mg [Citrus clementina]
 gb|ESR51073.1| hypothetical protein CICLE_v10030743mg [Citrus clementina]
Length=793

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 119/149 (80%), Gaps = 7/149 (5%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+SR+L  TS+ ++P +  F  K +  ++    RSAFLPR+G    L+ +GLKW L+
Sbjct  1    MAPVLSRTLATTSLVSLPTSTPFSFKHSN-HKAFNFRSAFLPRSG---GLTCAGLKWNLQ  56

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +R+  V +RC+A AVA+KEAP++ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  57   KRNKRVGIRCDA-AVADKEAPDTSGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  115

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  116  SDALDKLRFLSVTEPSLLGDAGDLEIRIK  144



>gb|AIT39757.1| heat shock protein 90kDa beta, partial [Chrysanthemum boreale]
Length=804

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 122/154 (79%), Gaps = 13/154 (8%)
 Frame = +1

Query  103  MAPVMSRSLT--SVAAVPFTPSFPQKS---AGGNRVAALRSAFLPRNGLRNR-LSSSGLK  264
            MAPV+SRSLT  S+ ++P++P    KS      NR+  L+S      GL++  L+ SGLK
Sbjct  14   MAPVLSRSLTPSSLQSLPYSPLLSSKSNTSTNTNRLCLLKS------GLKSSGLTCSGLK  67

Query  265  WKLERR-DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRE  441
            WK++RR  +SVVVRCEASAVAEKE  ++ GET+ YQAEVSRL++LIVHSLYSHKEIFLRE
Sbjct  68   WKVDRRVGNSVVVRCEASAVAEKETSDAPGETYEYQAEVSRLMNLIVHSLYSHKEIFLRE  127

Query  442  LVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            LVSNASDALDKLRF  VT+PSLLGDAG+L+IRIK
Sbjct  128  LVSNASDALDKLRFSSVTDPSLLGDAGDLEIRIK  161



>ref|XP_002315997.1| heat shock family protein [Populus trichocarpa]
 gb|EEF02168.1| heat shock family protein [Populus trichocarpa]
Length=793

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRN-GLRNRLSSSGLKWKLER  279
            MAPV+SRSL + A++    S  +     N+V  LRS FLP+N GLR   S SGLKWK E+
Sbjct  1    MAPVLSRSLATSASLISLSSSIRHP--NNKVFNLRSVFLPQNNGLRKGFSCSGLKWKPEK  58

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R   V +RC+A AVAEKE+ ++ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNAS
Sbjct  59   RSDQVSIRCKA-AVAEKESTDTSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNAS  117

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEPSLLGDAG+L+IRI+
Sbjct  118  DALDKLRFLSVTEPSLLGDAGDLEIRIR  145



>ref|XP_011009282.1| PREDICTED: heat shock protein 90-1-like [Populus euphratica]
Length=793

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRN-GLRNRLSSSGLKWKLER  279
            MAPV+SRSL + A++    S  +     N+V  LRS FLP+N GLR   S SGLKWK E+
Sbjct  1    MAPVLSRSLATSASLISLSSSIRHP--NNKVFNLRSVFLPQNNGLRKGFSCSGLKWKPEK  58

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R   V VRC+A AVAEKE+ ++ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNAS
Sbjct  59   RCDQVSVRCKA-AVAEKESTDTSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNAS  117

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEPSLLGDAG+L+IRI+
Sbjct  118  DALDKLRFLSVTEPSLLGDAGDLEIRIR  145



>ref|XP_009355621.1| PREDICTED: heat shock protein 83 [Pyrus x bretschneideri]
Length=794

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAPV+SRS+ + +      S P      +R  +LRSAF+P+NGLR   S  GLKWK+E R
Sbjct  1    MAPVLSRSMATASLASLPSSSPFALRNPSRALSLRSAFVPQNGLRKGFSCGGLKWKVESR  60

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            +  V VRC+A+   ++EA ++ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNASD
Sbjct  61   NRRVSVRCDAAVADKEEATDAPGERFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASD  120

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEP LLGD+GELQIRIK
Sbjct  121  ALDKLRFLSVTEPHLLGDSGELQIRIK  147



>ref|XP_008339741.1| PREDICTED: heat shock protein 83 [Malus domestica]
Length=794

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAPV+SRS+ + +      S P      +R  +LRSAF+P+NGLR   S  GLKWK+E R
Sbjct  1    MAPVLSRSMATASLASLPSSSPFALXNPSRALSLRSAFVPQNGLRKGXSCGGLKWKVESR  60

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            +  V VRC+A+   ++EA ++ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNASD
Sbjct  61   NRRVSVRCDAAVAEKEEATDAPGERFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASD  120

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEP LLGD+GELQIRIK
Sbjct  121  ALDKLRFLSVTEPHLLGDSGELQIRIK  147



>ref|XP_010943343.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=797

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 115/150 (77%), Gaps = 6/150 (4%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGN--RVAALRSAFLPRNGL-RNRLSSSGLKWKL  273
            MAPV+SRSL + + + F   FP      N  R  + RS+F+P + L R    S+GL+WKL
Sbjct  1    MAPVLSRSLGTSSVLAF--GFPSSPLVSNPRRAVSFRSSFVPPSLLPRKGFPSAGLRWKL  58

Query  274  ERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            E+R+S +VVRC+A AVA+KEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSN
Sbjct  59   EKRESRMVVRCDA-AVADKEAEEASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSN  117

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL VTEPSLLGD GEL+I IK
Sbjct  118  ASDALDKLRFLSVTEPSLLGDGGELEIHIK  147



>ref|XP_008788962.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=796

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 117/150 (78%), Gaps = 7/150 (5%)
 Frame = +1

Query  103  MAPVMSRS--LTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGL-RNRLSSSGLKWKL  273
            MAPV+SRS   +SV+A  F PS P  S    R  + RS+ LP++ L R    S+GL+WKL
Sbjct  1    MAPVLSRSPGTSSVSAFGF-PSSPLVS-NPPRAVSFRSSVLPQSLLARKGFPSAGLRWKL  58

Query  274  ERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            E+ DS +VVRCEA AVA+KEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSN
Sbjct  59   EK-DSRMVVRCEA-AVADKEAEEASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSN  116

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL VT+PSLLGD GEL+IRIK
Sbjct  117  ASDALDKLRFLSVTDPSLLGDGGELEIRIK  146



>gb|KHG08899.1| Heat shock 83 [Gossypium arboreum]
Length=792

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 106/150 (71%), Gaps = 11/150 (7%)
 Frame = +1

Query  103  MAPVMSRSLTS---VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKL  273
            MA V +RSL +     ++P T          N+   LR+ FL  N L N  S SGL+WKL
Sbjct  1    MASVPTRSLATPSLATSLPLT--------NPNKAFTLRTPFLTPNALNNAFSCSGLRWKL  52

Query  274  ERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            E+ ++ + V+C  S VAEKE   + GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSN
Sbjct  53   EKTNNLIAVQCVTSTVAEKETQVTSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSN  112

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL VTEPSLLGDAGEL+IRIK
Sbjct  113  ASDALDKLRFLSVTEPSLLGDAGELEIRIK  142



>gb|AFM30925.1| chloroplast heat shock protein 90, partial [Prunus persica]
Length=134

 Score =   159 bits (403),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAPV+SRSL + +      S P      ++  +LRSAF+P+NGLR   S  GLKWKLE +
Sbjct  1    MAPVLSRSLATASLASLPSSSPFTLRNPSKALSLRSAFVPQNGLRKGFSCGGLKWKLESK  60

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            +  + +RC+A AVAEKEA ++ GE   YQAEV+RL+DLIVHSLYSHKE+FLRELVSNASD
Sbjct  61   NRGISIRCDA-AVAEKEATDTPGEKFEYQAEVTRLMDLIVHSLYSHKEVFLRELVSNASD  119

Query  463  ALDKLRFLGVTEPSL  507
            ALDKLRFL VTEPSL
Sbjct  120  ALDKLRFLSVTEPSL  134



>ref|XP_010554255.1| PREDICTED: heat shock protein 90-1 [Tarenaya hassleriana]
Length=786

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 112/151 (74%), Gaps = 9/151 (6%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGG----NRVAALRSAFLPRNGLRNRLSSSGLKWK  270
            M+P +SRSL +    P T S P  SA      +RV+ LR+AF+PR+ LRN +S +GL+  
Sbjct  1    MSPALSRSLYTG---PLT-SLPLASASSLKNRSRVSNLRNAFVPRSVLRNGVSCNGLRLY  56

Query  271  LERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
             E R +   VRC+A AVAEKE  E  GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  57   SENRCNRFAVRCDA-AVAEKETAEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  115

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEPSLLGD GEL+IRIK
Sbjct  116  NASDALDKLRFLSVTEPSLLGDGGELEIRIK  146



>emb|CDX83528.1| BnaC07g22680D [Brassica napus]
Length=783

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 113/152 (74%), Gaps = 15/152 (10%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL  T + +VPFTP      A   R++ LR++FLPR G LR  +S S   W L
Sbjct  1    MAPALSRSLYTTPLTSVPFTP------ANQPRLSHLRTSFLPRGGSLRTGVSCS---WNL  51

Query  274  ERRDSSVVVRCEASAVAEKEAPESEG--ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
            E+R +   V+C+A AVAEKE  + EG  E   YQAEVSRLLDLIVHSLYSHKE+FLRELV
Sbjct  52   EKRCNRFAVKCDA-AVAEKETTDEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELV  110

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SNASDALDKLRFL VTEP+LLGD G+L+IRIK
Sbjct  111  SNASDALDKLRFLSVTEPALLGDGGDLEIRIK  142



>ref|XP_008466112.1| PREDICTED: heat shock protein 83 [Cucumis melo]
Length=783

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 116/147 (79%), Gaps = 7/147 (5%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAP ++R+L+++A      S P  S GG R++ L +AFLPRNG R  +S +GLKWK+E++
Sbjct  1    MAPALARTLSTLA----LSSLPL-SNGGTRLS-LTTAFLPRNGFRKGVSCAGLKWKIEKK  54

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
             + + VRCEA+   ++ A ES GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNASD
Sbjct  55   SNRIAVRCEAAVAEKEAA-ESPGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASD  113

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  114  ALDKLRFLSVTEPSLLGDAGDLEIRIK  140



>ref|XP_006395659.1| hypothetical protein EUTSA_v10003676mg [Eutrema salsugineum]
 gb|ESQ32945.1| hypothetical protein EUTSA_v10003676mg [Eutrema salsugineum]
Length=788

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 114/152 (75%), Gaps = 11/152 (7%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG--LRNRLSSSGLKWK  270
            MAP +SRSL +  + +VPFTP+   ++    R++ LR+AFLPR G  LR  +S S   W 
Sbjct  1    MAPALSRSLYTSPLTSVPFTPASSLRNQ--TRLSPLRTAFLPRGGGGLRAGVSCS---WN  55

Query  271  LERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
            LE+R +   V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELV
Sbjct  56   LEKRCNRFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELV  114

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SNASDALDKLRFL VTEPSL+GD GEL+IRIK
Sbjct  115  SNASDALDKLRFLSVTEPSLIGDGGELEIRIK  146



>emb|CDY04167.1| BnaA09g19450D [Brassica napus]
Length=764

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 112/152 (74%), Gaps = 18/152 (12%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRN--GLRNRLSSSGLKWK  270
            MAP +SRSL  T + ++P TP+         R++ LR+AFLPR   GLR  +S S   W 
Sbjct  1    MAPALSRSLHTTPLTSLPLTPT---------RLSPLRTAFLPRADAGLRTSVSCS---WS  48

Query  271  LERRDSSVVVRCEASAVAEKE-APESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
            LE+R S   V+C+A AVAEKE A E  GE   YQAEVSRLLDLIVHSLYSHKE+FLRELV
Sbjct  49   LEKRCSRFAVKCDA-AVAEKETAEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELV  107

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SNASDALDKLRFL VTEP+LLGD GEL+IRIK
Sbjct  108  SNASDALDKLRFLSVTEPALLGDGGELEIRIK  139



>ref|XP_009152136.1| PREDICTED: heat shock protein 90-1-like [Brassica rapa]
 emb|CDY48069.1| BnaA06g33590D [Brassica napus]
Length=787

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 115/153 (75%), Gaps = 13/153 (8%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTP-SFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWK  270
            MAP +SRSL +  + +VPFTP S P+      R++ LR+AFLPR G LR  +S S   W 
Sbjct  1    MAPALSRSLYTSPLTSVPFTPASSPRNQP---RLSHLRTAFLPRGGGLRTGVSCS---WN  54

Query  271  LERRDSSVVVRCEASAVAEKEAPESEG--ETHGYQAEVSRLLDLIVHSLYSHKEIFLREL  444
            LE+R +   V+C+A AVAEKE  + EG  E   YQAEVSRLLDLIVHSLYSHKE+FLREL
Sbjct  55   LEKRCNRFAVKCDA-AVAEKETTDEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLREL  113

Query  445  VSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            VSNASDALDKLRFL VTEP++LGD G+L+IRIK
Sbjct  114  VSNASDALDKLRFLSVTEPAMLGDGGDLEIRIK  146



>ref|XP_004149483.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 ref|XP_004166053.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
Length=781

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 116/147 (79%), Gaps = 7/147 (5%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAP ++R+L+++A      S P  S GG R++ L +AFLP+NG R  +S +GLKWK+E++
Sbjct  1    MAPALARTLSTLA----LSSLPLPS-GGTRLS-LTTAFLPQNGFRKGVSCAGLKWKIEKK  54

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
             + + VRCEA+   ++ A ES GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNASD
Sbjct  55   SNRIAVRCEAAVAEKEAA-ESPGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASD  113

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  114  ALDKLRFLSVTEPSLLGDAGDLEIRIK  140



>gb|KGN49798.1| hypothetical protein Csa_5G135340 [Cucumis sativus]
Length=783

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 116/147 (79%), Gaps = 7/147 (5%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAP ++R+L+++A      S P  S GG R++ L +AFLP+NG R  +S +GLKWK+E++
Sbjct  1    MAPALARTLSTLA----LSSLPLPS-GGTRLS-LTTAFLPQNGFRKGVSCAGLKWKIEKK  54

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
             + + VRCEA+   ++ A ES GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNASD
Sbjct  55   SNRIAVRCEAAVAEKEAA-ESPGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASD  113

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  114  ALDKLRFLSVTEPSLLGDAGDLEIRIK  140



>gb|KFK33530.1| hypothetical protein AALP_AA5G025000 [Arabis alpina]
Length=788

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 114/151 (75%), Gaps = 13/151 (9%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPR-NGLRNRLSSSGLKWKL  273
            MAP +SRSL +  + +VPFT S   +SA   R++ LR+AFLPR  GLR  +S S   W L
Sbjct  1    MAPALSRSLYTSPLTSVPFTLS--NQSA---RLSNLRTAFLPRVGGLRTGVSCS---WNL  52

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R +   V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  53   EKRCNRFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  111

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEP+LLGD GEL+IRIK
Sbjct  112  NASDALDKLRFLSVTEPALLGDGGELEIRIK  142



>gb|KDP31417.1| hypothetical protein JCGZ_11793 [Jatropha curcas]
Length=798

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 114/150 (76%), Gaps = 5/150 (3%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRS-AFLPRNGLRNRLSSSGLKWKL  273
            MAPV+SRSL +  + ++P +  F  K    N+   LR+ +FL  NGLR   S +GLKWK+
Sbjct  1    MAPVLSRSLATATLVSIPSSTPFSLKQPN-NKSFNLRTRSFLQNNGLRKGFSCAGLKWKV  59

Query  274  ERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            E+R++ + VRCEA+   ++ A  S GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSN
Sbjct  60   EKRNNRIAVRCEAAVAEKEAADVS-GEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSN  118

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  119  ASDALDKLRFLSVTEPSLLGDAGDLEIRIK  148



>ref|XP_010261402.1| PREDICTED: heat shock protein 83-like [Nelumbo nucifera]
Length=793

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAPV+SRSL S +      S        N+V+  R++F+PRN LR+   + GLKWKL+R+
Sbjct  1    MAPVLSRSLASASVASLPSSSSFSVKNHNKVSNFRTSFIPRNALRHGFPACGLKWKLDRK  60

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            ++ + VRCEA+   ++    S  E   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNASD
Sbjct  61   NNRLAVRCEAAVAEKEAEDAS-AEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASD  119

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEPSLL DAGEL+IRIK
Sbjct  120  ALDKLRFLSVTEPSLLSDAGELEIRIK  146



>emb|CDY33122.1| BnaC09g22180D [Brassica napus]
Length=783

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 112/152 (74%), Gaps = 18/152 (12%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPR--NGLRNRLSSSGLKWK  270
            MAP +SRSL  T + ++P TP+         R++ LR+AFLPR   GLR  +S S   W 
Sbjct  1    MAPALSRSLYTTPLTSLPLTPT---------RLSPLRTAFLPRAGGGLRAGVSCS---WN  48

Query  271  LERRDSSVVVRCEASAVAEKE-APESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
            L++R S   V+C+A AVAEKE A E  GE   YQAEVSRLLDLIVHSLYSHKE+FLRELV
Sbjct  49   LQKRCSRFAVKCDA-AVAEKETAEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELV  107

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SNASDALDKLRFL VTEP+LLGD G+L+IRIK
Sbjct  108  SNASDALDKLRFLSVTEPALLGDGGDLEIRIK  139



>gb|EPS65742.1| heat shock protein 90, partial [Genlisea aurea]
Length=222

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +1

Query  259  LKWKLERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLR  438
            ++WK E R S V+VRC A+AVAE EA +S GE + YQAEVSRL+DLIVHSLYSHKE+FLR
Sbjct  10   IRWKQESRQSRVLVRCSAAAVAENEASQSTGEVYEYQAEVSRLMDLIVHSLYSHKEVFLR  69

Query  439  ELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ELVSNASDALDKLRFL VTEPSLLGDAGEL+IRIK
Sbjct  70   ELVSNASDALDKLRFLSVTEPSLLGDAGELEIRIK  104



>ref|XP_006292451.1| hypothetical protein CARUB_v10018672mg [Capsella rubella]
 gb|EOA25349.1| hypothetical protein CARUB_v10018672mg [Capsella rubella]
Length=781

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 111/151 (74%), Gaps = 14/151 (9%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL +  + +VP TP         +R++ LR++FLPR G LR  +S +   W L
Sbjct  1    MAPALSRSLYTSPLTSVPITP------VSSSRLSHLRTSFLPRGGALRTGVSCT---WNL  51

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R +   V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  52   EKRCNRFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  110

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRF+ VTEP+LLGD GEL+IRIK
Sbjct  111  NASDALDKLRFMSVTEPALLGDGGELEIRIK  141



>ref|XP_009394558.1| PREDICTED: heat shock protein 83-like [Musa acuminata subsp. 
malaccensis]
Length=798

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 112/149 (75%), Gaps = 4/149 (3%)
 Frame = +1

Query  103  MAPVMSRSL-TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGL-RNRLSSSGLKWKLE  276
            MAPV+++SL TS  A    PS P +S+   R    R +FLPR  L R+   ++GL+ K++
Sbjct  1    MAPVLTQSLGTSSTAFLHPPSTPLRSSSA-RALGFRPSFLPRPLLSRSSFPAAGLRCKVQ  59

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            RR+  +  RCEA  VAEKEA E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  60   RRERRMGPRCEA-VVAEKEADEASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  118

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VT+ SLLGDAG+L+IRIK
Sbjct  119  SDALDKLRFLSVTDSSLLGDAGDLEIRIK  147



>ref|XP_003518802.1| PREDICTED: heat shock protein 83-like [Glycine max]
Length=794

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 114/153 (75%), Gaps = 14/153 (9%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLP-RNGL-RNRLS-SSGLKWKL  273
            MAPV+SR++ + +     PS P       R + LRSAFLP + GL RN  S ++GL+W  
Sbjct  1    MAPVLSRTMATASLASLPPSSPFA-----RTSLLRSAFLPPQIGLGRNCFSPAAGLRWTQ  55

Query  274  ERRDS---SVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLREL  444
            +RR+     + VRCEA AVAEK+  E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLREL
Sbjct  56   QRREGRRGGLTVRCEA-AVAEKD--EATGEKFEYQAEVSRLLDLIVHSLYSHKEVFLREL  112

Query  445  VSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            VSNASDALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  113  VSNASDALDKLRFLSVTEPSLLGDAGDLEIRIK  145



>ref|XP_010528013.1| PREDICTED: heat shock protein 90-1-like isoform X1 [Tarenaya 
hassleriana]
Length=799

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 110/151 (73%), Gaps = 9/151 (6%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGG----NRVAALRSAFLPRNGLRNRLSSSGLKWK  270
            MAP +SRSL +    P T S P  SA       RV+ LRSAF+PR+ LR  +S +G +  
Sbjct  1    MAPALSRSLYTG---PLT-SLPLTSASSLRNRIRVSNLRSAFVPRSVLRTGVSCNGSRLN  56

Query  271  LERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
              +R + + VRC+A AVAEKE   + GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  57   PGKRCTRLAVRCDA-AVAEKETAGASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  115

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEPSLLGD GEL+IRIK
Sbjct  116  NASDALDKLRFLSVTEPSLLGDGGELEIRIK  146



>ref|XP_010528014.1| PREDICTED: heat shock protein 90-1-like isoform X2 [Tarenaya 
hassleriana]
Length=798

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 110/151 (73%), Gaps = 9/151 (6%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGG----NRVAALRSAFLPRNGLRNRLSSSGLKWK  270
            MAP +SRSL +    P T S P  SA       RV+ LRSAF+PR+ LR  +S +G +  
Sbjct  1    MAPALSRSLYTG---PLT-SLPLTSASSLRNRIRVSNLRSAFVPRSVLRTGVSCNGSRLN  56

Query  271  LERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
              +R + + VRC+A AVAEKE   + GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  57   PGKRCTRLAVRCDA-AVAEKETAGASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  115

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEPSLLGD GEL+IRIK
Sbjct  116  NASDALDKLRFLSVTEPSLLGDGGELEIRIK  146



>ref|XP_007157601.1| hypothetical protein PHAVU_002G083000g [Phaseolus vulgaris]
 gb|ESW29595.1| hypothetical protein PHAVU_002G083000g [Phaseolus vulgaris]
Length=787

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 11/149 (7%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNR--LSSSGLKWKLE  276
            MAPV+SR++ S +           S+  +R + LR+AFLP    R R   S++GL+W  +
Sbjct  1    MAPVLSRTMASASLTS-----LPPSSSFSRASPLRTAFLPPQFGRRRSFFSTAGLRWT-Q  54

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            RR+  + VRCEA AVAEKE  E+ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  55   RRERKLAVRCEA-AVAEKE--ETTGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  111

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  112  SDALDKLRFLSVTEPSLLGDAGDLEIRIK  140



>ref|XP_010681164.1| PREDICTED: heat shock protein 90-1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=792

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAPV+SRS+TS +      S        N+V  L S F P N L        +  K +R+
Sbjct  1    MAPVLSRSMTSASLASLPSSSFTLKNTHNKVLNLSSTFCPHNKLSRNCPKFSISKKNQRK  60

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
             S + VRC+A AVAE+EAPE+ GE   YQAEVSRL+DLIVHSLYSHKE+FLRE+VSNASD
Sbjct  61   PSKLSVRCDA-AVAEQEAPEASGEKFEYQAEVSRLMDLIVHSLYSHKEVFLREIVSNASD  119

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEP+LLG+AGEL IRIK
Sbjct  120  ALDKLRFLSVTEPALLGEAGELVIRIK  146



>ref|XP_010681165.1| PREDICTED: heat shock protein 90-1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=791

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAPV+SRS+TS +      S        N+V  L S F P N L        +  K +R+
Sbjct  1    MAPVLSRSMTSASLASLPSSSFTLKNTHNKVLNLSSTFCPHNKLSRNCPKFSISKKNQRK  60

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
             S + VRC+A AVAE+EAPE+ GE   YQAEVSRL+DLIVHSLYSHKE+FLRE+VSNASD
Sbjct  61   PSKLSVRCDA-AVAEQEAPEASGEKFEYQAEVSRLMDLIVHSLYSHKEVFLREIVSNASD  119

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VTEP+LLG+AGEL IRIK
Sbjct  120  ALDKLRFLSVTEPALLGEAGELVIRIK  146



>emb|CBI27411.3| unnamed protein product [Vitis vinifera]
Length=750

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 102/148 (69%), Gaps = 26/148 (18%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNR-VAALRSAFLPRNGLRNRLSSSGLKWKLER  279
            MAPV+SRSL   A  P T SFP  +   NR V  LR+ F                    +
Sbjct  1    MAPVLSRSL---ATAPLT-SFPLNNINNNRRVLNLRNTF--------------------K  36

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R S V VRCEA  VAEKEAP++ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNAS
Sbjct  37   RGSRVGVRCEA-GVAEKEAPDTPGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNAS  95

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEPSLLGDAGEL+IRIK
Sbjct  96   DALDKLRFLSVTEPSLLGDAGELEIRIK  123



>ref|XP_008807013.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=796

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGL-RNRLSSSGLKWKLER  279
            MA V SRSL + +   F  S P   + G R    RS+F P++ + R    S+GLKWKLE+
Sbjct  1    MASVSSRSLGTCSVSAFGLSSPPLVSNGRRAVPFRSSFSPKSLIPRKGFPSAGLKWKLEK  60

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R+  +VVRCEA+   ++    S GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNAS
Sbjct  61   RECRMVVRCEAAVAEKEAEEAS-GEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNAS  119

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRF  VT+PSLLGD GEL+IRIK
Sbjct  120  DALDKLRFFSVTDPSLLGDGGELEIRIK  147



>ref|XP_010257890.1| PREDICTED: heat shock protein 81-1-like [Nelumbo nucifera]
Length=794

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 109/148 (74%), Gaps = 4/148 (3%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPS-FPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLER  279
            MAPV+SR L + +      S F  K+    +V  LR++F+PRN  R+     GLKWK ER
Sbjct  1    MAPVLSRGLAASSIASLPSSSFSVKNQI--KVLNLRTSFIPRNISRHGFPGCGLKWKFER  58

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            +++ + VRCEA+   ++   +S GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNAS
Sbjct  59   KNNRLAVRCEAAVAEKEAE-DSSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNAS  117

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VTEPSLLGDAGEL+IRIK
Sbjct  118  DALDKLRFLSVTEPSLLGDAGELEIRIK  145



>dbj|BAF01546.1| heat shock like protein [Arabidopsis thaliana]
Length=313

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 110/151 (73%), Gaps = 15/151 (10%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL +  + +VP TP         +R++ LRS+FLP  G LR  +S S   W L
Sbjct  1    MAPALSRSLYTSPLTSVPITPV-------SSRLSHLRSSFLPHGGALRTGVSCS---WNL  50

Query  274  ERRDSSVVVRCEASAVAEKEAPE-SEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R +   V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  51   EKRCNRFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  109

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEPSLLGD G+L+IRIK
Sbjct  110  NASDALDKLRFLSVTEPSLLGDGGDLEIRIK  140



>ref|XP_008389364.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83-like [Malus 
domestica]
 ref|XP_008360076.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83-like [Malus 
domestica]
Length=457

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 102/149 (68%), Gaps = 2/149 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPS--FPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPVMSRSL + +      S  F  ++        LRS FLP+NGL    S  GLKWK+E
Sbjct  1    MAPVMSRSLATASLASLPSSSPFALRNPSRALNLRLRSXFLPQNGLXKAFSCIGLKWKVE  60

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
             R+  V  RC A+   ++EA ++ GE   YQAEVSRL+DLIVHSLYS  E+FLRELVSNA
Sbjct  61   SRNRRVSFRCXAAVAEKEEATDAPGEKFEYQAEVSRLMDLIVHSLYSDXEVFLRELVSNA  120

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SD LDKLRFL VTEPSLLGDA ELQIR K
Sbjct  121  SDVLDKLRFLSVTEPSLLGDAAELQIRJK  149



>ref|XP_002875241.1| hypothetical protein ARALYDRAFT_484305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51500.1| hypothetical protein ARALYDRAFT_484305 [Arabidopsis lyrata subsp. 
lyrata]
Length=780

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 111/151 (74%), Gaps = 15/151 (10%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL  T + +VP TP         +R++ LRS+FLPR G LR  LS S   W L
Sbjct  1    MAPALSRSLYTTPLTSVPITPL-------SSRLSHLRSSFLPRGGALRTDLSCS---WNL  50

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R +   V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  51   EKRCNRFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  109

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEPSLLGD G+L+IRIK
Sbjct  110  NASDALDKLRFLSVTEPSLLGDGGDLEIRIK  140



>ref|XP_010502419.1| PREDICTED: heat shock protein 83-like [Camelina sativa]
Length=782

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 112/151 (74%), Gaps = 12/151 (8%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL  T + +VP TP     S+  +R++ LR++FLPR G LR  +S +   W L
Sbjct  1    MAPALSRSLYTTPLTSVPITPL----SSSSSRLSHLRTSFLPRGGALRTGVSCT---WNL  53

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R     V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  54   EKRCERFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  112

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRF+ VTEP+LLGD GEL+IRIK
Sbjct  113  NASDALDKLRFMSVTEPALLGDGGELEIRIK  143



>ref|XP_010514162.1| PREDICTED: heat shock protein 83-like isoform X2 [Camelina sativa]
Length=783

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 112/151 (74%), Gaps = 12/151 (8%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL  T + +VP TP     S+  +R++ LR++FLPR G LR  +S +   W L
Sbjct  1    MAPALSRSLYTTPLTSVPITPL----SSSSSRLSHLRTSFLPRGGALRTGVSCT---WNL  53

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R     V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  54   EKRCERFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  112

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRF+ VTEP+LLGD GEL+IRIK
Sbjct  113  NASDALDKLRFMSVTEPALLGDGGELEIRIK  143



>ref|XP_010514161.1| PREDICTED: heat shock protein 83-like isoform X1 [Camelina sativa]
Length=783

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 112/151 (74%), Gaps = 12/151 (8%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL  T + +VP TP     S+  +R++ LR++FLPR G LR  +S +   W L
Sbjct  1    MAPALSRSLYTTPLTSVPITPL----SSSSSRLSHLRTSFLPRGGALRTGVSCT---WNL  53

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R     V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  54   EKRCERFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  112

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRF+ VTEP+LLGD GEL+IRIK
Sbjct  113  NASDALDKLRFMSVTEPALLGDGGELEIRIK  143



>ref|XP_010425190.1| PREDICTED: heat shock protein 83-like [Camelina sativa]
Length=783

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 109/151 (72%), Gaps = 12/151 (8%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL +  + +VP TP     S     ++ LR++FLPR G LR  +S S   W L
Sbjct  1    MAPALSRSLYTNPLTSVPITPLSSSSSR----LSHLRTSFLPRGGALRTGVSCS---WNL  53

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R     V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  54   EKRCERFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  112

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRF+ VTEP+LLGD GEL+IRIK
Sbjct  113  NASDALDKLRFMSVTEPALLGDGGELEIRIK  143



>ref|XP_003516650.1| PREDICTED: heat shock protein 90-1-like [Glycine max]
Length=793

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 106/152 (70%), Gaps = 13/152 (9%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSS---GLKWKL  273
            MAPV SR++ + +     PS P       R + LRSAFLP    R+R   S   GL+W  
Sbjct  1    MAPVPSRTVATASLASLLPSSP-----FARASLLRSAFLPPQIGRDRKCFSPAAGLRWTQ  55

Query  274  ER--RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
             R  R   + VRCEA AVAEK+  E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELV
Sbjct  56   RRQGRRDGLAVRCEA-AVAEKD--EATGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELV  112

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SNASDALDKLRFL VTEPSLLGDAG+L+I IK
Sbjct  113  SNASDALDKLRFLSVTEPSLLGDAGDLEIHIK  144



>ref|XP_010927990.1| PREDICTED: heat shock protein 83-like isoform X2 [Elaeis guineensis]
Length=672

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGL-RNRLSSSGLKWKLER  279
            MA  +SRSL + +   F  S     + G R    RS+ LP++ L R     +GL+WKLE+
Sbjct  1    MASRLSRSLGTCSVSAFGLSSSPLVSNGRRAVPSRSSLLPQSLLPRKGFPCAGLRWKLEK  60

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R+S +VVRCEA+   ++    S GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNAS
Sbjct  61   RESRMVVRCEAAVAEKEAEEAS-GEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNAS  119

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VT+PSLLGD GEL+IRIK
Sbjct  120  DALDKLRFLSVTDPSLLGDGGELEIRIK  147



>ref|XP_009418533.1| PREDICTED: heat shock protein 83-like [Musa acuminata subsp. 
malaccensis]
Length=796

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTP-SFPQKSAGGNRVAALRSAFLPRN-GLRNRLSSSGLKWKLE  276
            MAPV+++SL +   V     S P +S    R    R++FLP+  G       SGL  K E
Sbjct  1    MAPVLTQSLGTTFTVSLHRLSIPLRSNSA-RALRFRTSFLPQPLGSGISFPVSGLSCKAE  59

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            RR+  + VRCEA AVAEKE+ E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  60   RRERWMRVRCEA-AVAEKESEEASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  118

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VT+ SLLGDAG+L+IR+K
Sbjct  119  SDALDKLRFLSVTDSSLLGDAGDLEIRVK  147



>ref|XP_010927989.1| PREDICTED: heat shock protein 83-like isoform X1 [Elaeis guineensis]
Length=794

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGL-RNRLSSSGLKWKLER  279
            MA  +SRSL + +   F  S     + G R    RS+ LP++ L R     +GL+WKLE+
Sbjct  1    MASRLSRSLGTCSVSAFGLSSSPLVSNGRRAVPSRSSLLPQSLLPRKGFPCAGLRWKLEK  60

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R+S +VVRCEA+   ++    S GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNAS
Sbjct  61   RESRMVVRCEAAVAEKEAEEAS-GEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNAS  119

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLRFL VT+PSLLGD GEL+IRIK
Sbjct  120  DALDKLRFLSVTDPSLLGDGGELEIRIK  147



>ref|NP_849932.1| chloroplast heat shock protein 90 [Arabidopsis thaliana]
 gb|AEC05779.1| Chaperone protein htpG family protein [Arabidopsis thaliana]
Length=777

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 110/151 (73%), Gaps = 15/151 (10%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL +  + +VP TP         +R++ LRS+FLP  G LR  +S S   W L
Sbjct  1    MAPALSRSLYTSPLTSVPITPV-------SSRLSHLRSSFLPHGGALRTGVSCS---WNL  50

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R +   V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  51   EKRCNRFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  109

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEPSLLGD G+L+IRIK
Sbjct  110  NASDALDKLRFLSVTEPSLLGDGGDLEIRIK  140



>ref|NP_178487.1| chloroplast heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL32008.1|AF436826_1 At2g04030/F3C11.14 [Arabidopsis thaliana]
 gb|AAD32922.1| putative heat shock protein [Arabidopsis thaliana]
 gb|AAK96633.1| At2g04030/F3C11.14 [Arabidopsis thaliana]
 gb|AAN72245.1| At2g04030/F3C11.14 [Arabidopsis thaliana]
 gb|AEC05778.1| Chaperone protein htpG family protein [Arabidopsis thaliana]
Length=780

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 110/151 (73%), Gaps = 15/151 (10%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL +  + +VP TP         +R++ LRS+FLP  G LR  +S S   W L
Sbjct  1    MAPALSRSLYTSPLTSVPITPV-------SSRLSHLRSSFLPHGGALRTGVSCS---WNL  50

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R +   V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  51   EKRCNRFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  109

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEPSLLGD G+L+IRIK
Sbjct  110  NASDALDKLRFLSVTEPSLLGDGGDLEIRIK  140



>gb|AAM19795.1| At2g04030/F3C11.14 [Arabidopsis thaliana]
Length=780

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 110/151 (73%), Gaps = 15/151 (10%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNG-LRNRLSSSGLKWKL  273
            MAP +SRSL +  + +VP TP         +R++ LRS+FLP  G LR  +S S   W L
Sbjct  1    MAPALSRSLYTSPLTSVPITPV-------SSRLSHLRSSFLPHGGALRTGVSCS---WNL  50

Query  274  ERRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            E+R +   V+C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVS
Sbjct  51   EKRCNRFAVKCDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVS  109

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEPSLLGD G+L+IRIK
Sbjct  110  NASDALDKLRFLSVTEPSLLGDGGDLEIRIK  140



>ref|XP_006844092.1| hypothetical protein AMTR_s00006p00252810 [Amborella trichopoda]
 gb|ERN05767.1| hypothetical protein AMTR_s00006p00252810 [Amborella trichopoda]
Length=817

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 104/163 (64%), Gaps = 20/163 (12%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRN----------------GL  234
            MAPV+SR + +       PS        NR   L S+   R                  L
Sbjct  1    MAPVLSRIVGTTTQTRLPPS---SFLSSNRFCGLSSSGSSRREKELKLGAWLGCQSFPKL  57

Query  235  RNRLSSSGLKWKLERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLY  414
            R  + +SGL+WK++R +    VRCEA AVAEKE  E+ GE   YQAEVSRLLDLIVHSLY
Sbjct  58   RAGVPASGLRWKVKRVERRGGVRCEA-AVAEKEREETSGEKFEYQAEVSRLLDLIVHSLY  116

Query  415  SHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SHKE+FLRELVSN SDALDKLRFL VT+PSLLGDAGEL+IRIK
Sbjct  117  SHKEVFLRELVSNGSDALDKLRFLSVTDPSLLGDAGELEIRIK  159



>ref|NP_001146412.1| hypothetical protein [Zea mays]
 gb|ACL53907.1| unknown [Zea mays]
 tpg|DAA61911.1| TPA: hypothetical protein ZEAMMB73_416250 [Zea mays]
Length=464

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 105/151 (70%), Gaps = 14/151 (9%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SR+L  +SVAA+  +PS             LR+A  P+    +   + G++W+  
Sbjct  1    MAPALSRTLGPSSVAALRPSPSCR---------GLLRAALAPQGRGASARCAVGVRWEAA  51

Query  277  RRDSSVVVRCEASAVAEKEAPESE--GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            RR     VRC+A AVAEK A E E  GE + YQAEV+RL+DLIVHSLYSHKE+FLRELVS
Sbjct  52   RRRRMAGVRCDA-AVAEKPAGEEETAGEKYEYQAEVTRLMDLIVHSLYSHKEVFLRELVS  110

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VT+PS+L D GEL+IRIK
Sbjct  111  NASDALDKLRFLSVTDPSVLADGGELEIRIK  141



>gb|KEH17540.1| heat shock protein 81-2 [Medicago truncatula]
Length=791

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE--  276
            MAPV+SRSL + A++   PS     +     + LRSAFLP    RNR SS+GLK K    
Sbjct  1    MAPVLSRSLAATASLTSLPS-SSSFSLSRPSSTLRSAFLPPQPRRNRFSSTGLKCKHHDR  59

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            RR   + VRCEA+   ++EA    GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  60   RRTGRLSVRCEAAVAEKEEA---SGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  116

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEPSLLG++GEL+IRIK
Sbjct  117  SDALDKLRFLSVTEPSLLGESGELEIRIK  145



>gb|KJB80448.1| hypothetical protein B456_013G098300 [Gossypium raimondii]
Length=777

 Score =   145 bits (365),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 77/111 (69%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = +1

Query  217  LPRNGLRNRLSSSGLKWKLERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDL  396
            L  N L N  S S L+WKLE+  + + V+C  S VAEKE   + GE   YQAEVSRLLDL
Sbjct  23   LTPNALNNAFSCSDLRWKLEKTTNLIAVQCVTSTVAEKETQVTFGEKFEYQAEVSRLLDL  82

Query  397  IVHSLYSHKEIFLRELVS--NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            IVHSLYSHKE+FLRELV+  NASDALDKLRFL VTEPSLLGDAGEL+IRIK
Sbjct  83   IVHSLYSHKEVFLRELVNSYNASDALDKLRFLSVTEPSLLGDAGELEIRIK  133



>ref|XP_008651357.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=797

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 105/151 (70%), Gaps = 14/151 (9%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SR+L  +SVAA+  +PS             LR+A  P+    +   + G++W+  
Sbjct  1    MAPALSRTLGPSSVAALRPSPSCR---------GLLRAALAPQGRGASARCAVGVRWEAA  51

Query  277  RRDSSVVVRCEASAVAEKEAPESE--GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            RR     VRC+A AVAEK A E E  GE + YQAEV+RL+DLIVHSLYSHKE+FLRELVS
Sbjct  52   RRRRMAGVRCDA-AVAEKPAGEEETAGEKYEYQAEVTRLMDLIVHSLYSHKEVFLRELVS  110

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VT+PS+L D GEL+IRIK
Sbjct  111  NASDALDKLRFLSVTDPSVLADGGELEIRIK  141



>tpg|DAA61912.1| TPA: hypothetical protein ZEAMMB73_416250 [Zea mays]
Length=758

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 105/151 (70%), Gaps = 14/151 (9%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SR+L  +SVAA+  +PS             LR+A  P+    +   + G++W+  
Sbjct  1    MAPALSRTLGPSSVAALRPSPSCR---------GLLRAALAPQGRGASARCAVGVRWEAA  51

Query  277  RRDSSVVVRCEASAVAEKEAPESE--GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            RR     VRC+A AVAEK A E E  GE + YQAEV+RL+DLIVHSLYSHKE+FLRELVS
Sbjct  52   RRRRMAGVRCDA-AVAEKPAGEEETAGEKYEYQAEVTRLMDLIVHSLYSHKEVFLRELVS  110

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VT+PS+L D GEL+IRIK
Sbjct  111  NASDALDKLRFLSVTDPSVLADGGELEIRIK  141



>ref|XP_004514756.1| PREDICTED: endoplasmin homolog [Cicer arietinum]
Length=792

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 112/151 (74%), Gaps = 11/151 (7%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRN-RLSSSGLKWKLE-  276
            MAPV+SR+  S+A++P +  F    +     +ALRSAFLP    R+ R SS+    K + 
Sbjct  1    MAPVLSRTTASLASLPSSSPFTLSRS----SSALRSAFLPPQFSRSKRFSSAAASLKCKH  56

Query  277  ---RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
               RR+  + VRCEA+AVA+KE  E+ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELV
Sbjct  57   HDRRRNGRLSVRCEAAAVADKE--EATGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELV  114

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRI  540
            SNASDALDKLRFL VTEPSLLG++GEL+IRI
Sbjct  115  SNASDALDKLRFLSVTEPSLLGESGELEIRI  145



>ref|XP_009114127.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 90-1-like 
[Brassica rapa]
Length=771

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 94/149 (63%), Gaps = 25/149 (17%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SRSL  T + ++P TP                    P    +NR+S S  +W   
Sbjct  1    MAPALSRSLYTTPLTSLPLTPX-------------------PSLSSQNRVSPSRRRWP--  39

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
                   V+C+A+   +K A E  GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNA
Sbjct  40   --HPHFAVKCDAAVAEKKTAEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNA  97

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEP+LLGD G+L+IRIK
Sbjct  98   SDALDKLRFLSVTEPALLGDGGDLEIRIK  126



>gb|AIZ68156.1| heat shock protein 83-like protein [Ornithogalum saundersiae]
Length=796

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +1

Query  154  TPSFPQKSAGGNRVAA-LRSAFLPRNGLRNR-LSSSGLKWKLE-RRDSSVVVRCEASAVA  324
             PS P  +A  NR +    ++F+P++  R +    + LKWKL+ R    + VRC+A+   
Sbjct  12   NPSPPLTTAAPNRSSVKFGTSFVPQSIHRRKGFPLASLKWKLDGRMGGKMRVRCDAAVAE  71

Query  325  EKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPS  504
            ++    S GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSNASDALDKLRFL VTEPS
Sbjct  72   KEAEETSGGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPS  131

Query  505  LLGDAGELQIRIK  543
            LLGDAG+L+IRIK
Sbjct  132  LLGDAGDLEIRIK  144



>ref|XP_002444835.1| hypothetical protein SORBIDRAFT_07g028940 [Sorghum bicolor]
 gb|EES14330.1| hypothetical protein SORBIDRAFT_07g028940 [Sorghum bicolor]
Length=788

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 104/151 (69%), Gaps = 14/151 (9%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +S +L  +SVAA+        +   G R  +  ++  PR     R  + GL+W+  
Sbjct  1    MAPALSGTLGASSVAAL--------RPCAGRRAPSAATSVAPRGSGVAR-CARGLRWEAH  51

Query  277  R-RDSSVVVRCEASAVAEKEA-PESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            R R  S+ VRC+A AVAEK A  E+ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVS
Sbjct  52   RSRGRSLRVRCDA-AVAEKPAGEEAAGEQFEYQAEVSRLMDLIVHSLYSHKEVFLRELVS  110

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFLGVT+ SLL D GEL+IRIK
Sbjct  111  NASDALDKLRFLGVTDSSLLADGGELEIRIK  141



>ref|XP_008677634.1| PREDICTED: uncharacterized protein LOC100383793 isoform X1 [Zea 
mays]
Length=787

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 99/150 (66%), Gaps = 12/150 (8%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +S +L  +SVAA+        +   G R  +  S+  PR     R  S GL+W   
Sbjct  1    MAPALSGTLGASSVAAL--------RPCAGRRAPSAASSVAPRGSGVVR-CSRGLRWDAH  51

Query  277  R-RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            R R   + VRC+A+ V +    E+ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSN
Sbjct  52   RSRGRLLRVRCDAAVVEKPAGEEAAGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSN  111

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFLGVT+ SLL D GEL+IRIK
Sbjct  112  ASDALDKLRFLGVTDSSLLADGGELEIRIK  141



>ref|NP_001063456.1| Os09g0474300 [Oryza sativa Japonica Group]
 dbj|BAF25370.1| Os09g0474300 [Oryza sativa Japonica Group]
Length=654

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 104/154 (68%), Gaps = 15/154 (10%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SRSL  +SVAA+  TPS         R   LRSA   +      +++ G++W+  
Sbjct  1    MAPALSRSLGASSVAALRPTPS-------RGRGPTLRSAVAVQGRGAAAVAARGVRWEAG  53

Query  277  RRDSS---VVVRCEASAVAEKEAPESE--GETHGYQAEVSRLLDLIVHSLYSHKEIFLRE  441
            RR      V VRCEA AV EK A E E  GE   YQAEVSRLLDLIVHSLYSHKE+FLRE
Sbjct  54   RRKGKGRMVGVRCEA-AVTEKPAGEEEAAGEQFEYQAEVSRLLDLIVHSLYSHKEVFLRE  112

Query  442  LVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            LVSNASDALDKLRFL VT+ S+L D GEL+IRIK
Sbjct  113  LVSNASDALDKLRFLSVTDSSVLSDGGELEIRIK  146



>gb|AFW65129.1| hypothetical protein ZEAMMB73_326674 [Zea mays]
Length=793

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 99/150 (66%), Gaps = 12/150 (8%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +S +L  +SVAA+        +   G R  +  S+  PR     R  S GL+W   
Sbjct  1    MAPALSGTLGASSVAAL--------RPCAGRRAPSAASSVAPRGSGVVR-CSRGLRWDAH  51

Query  277  R-RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            R R   + VRC+A+ V +    E+ GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSN
Sbjct  52   RSRGRLLRVRCDAAVVEKPAGEEAAGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSN  111

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFLGVT+ SLL D GEL+IRIK
Sbjct  112  ASDALDKLRFLGVTDSSLLADGGELEIRIK  141



>gb|EEC84746.1| hypothetical protein OsI_31743 [Oryza sativa Indica Group]
Length=794

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 104/154 (68%), Gaps = 15/154 (10%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SRSL  +SVAA+  TPS         R   LRSA   +      +++ G++W+  
Sbjct  1    MAPALSRSLGASSVAALRPTPS-------RGRGPTLRSAVAVQGRGAAAVAARGVRWEAG  53

Query  277  RRDSS---VVVRCEASAVAEKEAPESE--GETHGYQAEVSRLLDLIVHSLYSHKEIFLRE  441
            RR      V VRCEA AV EK A E E  GE   YQAEVSRLLDLIVHSLYSHKE+FLRE
Sbjct  54   RRKGKGRMVGVRCEA-AVTEKPAGEEEAAGEQFEYQAEVSRLLDLIVHSLYSHKEVFLRE  112

Query  442  LVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            LVSNASDALDKLRFL VT+ S+L D GEL+IRIK
Sbjct  113  LVSNASDALDKLRFLSVTDSSVLSDGGELEIRIK  146



>ref|XP_004957103.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=784

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 106/150 (71%), Gaps = 17/150 (11%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAPV+ RSL  +SVAA+  +PSF        R+   R+A +P+       ++ G++W+  
Sbjct  1    MAPVLIRSLGASSVAALRPSPSF--------RLLP-RAALVPQG---RAAAARGVRWEAG  48

Query  277  RRDSSVVVRCEASAVAEKEAPE-SEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            RR   V V C+A AVAEK   E + GE   YQAEVSRL+DLIVHSLYSHKE+FLRELVSN
Sbjct  49   RR-RIVRVGCDA-AVAEKPTEEETAGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSN  106

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL VT+PS+L D GEL+IRIK
Sbjct  107  ASDALDKLRFLSVTDPSVLADGGELEIRIK  136



>gb|EEE69897.1| hypothetical protein OsJ_29732 [Oryza sativa Japonica Group]
Length=904

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 104/154 (68%), Gaps = 15/154 (10%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SRSL  +SVAA+  TPS         R   LRSA   +      +++ G++W+  
Sbjct  1    MAPALSRSLGASSVAALRPTPS-------RGRGPTLRSAVAVQGRGAAAVAARGVRWEAG  53

Query  277  RRDSS---VVVRCEASAVAEKEAPESE--GETHGYQAEVSRLLDLIVHSLYSHKEIFLRE  441
            RR      V VRCEA AV EK A E E  GE   YQAEVSRLLDLIVHSLYSHKE+FLRE
Sbjct  54   RRKGKGRMVGVRCEA-AVTEKPAGEEEAAGEQFEYQAEVSRLLDLIVHSLYSHKEVFLRE  112

Query  442  LVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            LVSNASDALDKLRFL VT+ S+L D GEL+IRIK
Sbjct  113  LVSNASDALDKLRFLSVTDSSVLSDGGELEIRIK  146



>emb|CAA72515.1| heat shock protein [Arabidopsis thaliana]
Length=768

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 96/150 (64%), Gaps = 29/150 (19%)
 Frame = +1

Query  103  MAPVMSRSLTS--VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SRSL +  + +VP TP F   S+    V+  R +F      +NR           
Sbjct  1    MAPALSRSLYTSPLTSVPITPLFSSLSSE-KLVSPTRRSF------KNRRF---------  44

Query  277  RRDSSVVVRCEASAVAEKEAPES-EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
                     C+A AVAEKE  E   GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSN
Sbjct  45   ---------CDA-AVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSN  94

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL VTEPSLLGD G+L+IRIK
Sbjct  95   ASDALDKLRFLSVTEPSLLGDGGDLEIRIK  124



>gb|KHN29931.1| Heat shock protein 83 [Glycine soja]
Length=777

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 77/90 (86%), Gaps = 3/90 (3%)
 Frame = +1

Query  274  ERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            E R   + VRCEA AVAEK+  E+ GE   YQAEVSRLLDLIVHSLYSHKE+FLRELVSN
Sbjct  42   EGRRGGLTVRCEA-AVAEKD--EATGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSN  98

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFL VTEPSLLGDAG+L+IRIK
Sbjct  99   ASDALDKLRFLSVTEPSLLGDAGDLEIRIK  128



>ref|XP_004973760.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=788

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 98/150 (65%), Gaps = 12/150 (8%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +S +L  +SVAA+        +     R  +  S+  PR     R    G++W+ E
Sbjct  1    MAPALSGTLGASSVAAL--------RPCAERRAPSAASSVAPRGSGAVRCPR-GVRWEAE  51

Query  277  R-RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSN  453
            R R   V VRC+A+ V +    E+  E   YQAEVSRL+DLIVHSLYSHKE+FLRELVSN
Sbjct  52   RSRGRLVTVRCDAAVVEKPAGEEAAEEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSN  111

Query  454  ASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ASDALDKLRFLGVT+ +LL D GEL+IRIK
Sbjct  112  ASDALDKLRFLGVTDSALLADGGELEIRIK  141



>ref|XP_003574676.1| PREDICTED: heat shock cognate 90 kDa protein-like [Brachypodium 
distachyon]
Length=783

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 100/153 (65%), Gaps = 20/153 (13%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAV-PFTPSFPQKSAGGNRVA-ALRSAFLPRNGLRNRLSSSGLKWK  270
            M P + RSL  +SVAA+ P     P  ++   RV+ A+R A              G++W+
Sbjct  1    MEPALGRSLGASSVAALRPCAARTPGATSVAPRVSGAVRRA-------------KGVRWE  47

Query  271  LERRDSSVV-VRCEASAVAEKEAPESEGETH-GYQAEVSRLLDLIVHSLYSHKEIFLREL  444
              R     + VRC+A AVAEK A E   E    YQAEVSRL+DLIVHSLYSHKE+FLREL
Sbjct  48   AGRSSGRPLRVRCDA-AVAEKPAGEEAAEEQFEYQAEVSRLMDLIVHSLYSHKEVFLREL  106

Query  445  VSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            VSNASDALDKLRFLGVT+ SLL D GEL+IRIK
Sbjct  107  VSNASDALDKLRFLGVTDSSLLADGGELEIRIK  139



>dbj|BAK00031.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=779

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 100/156 (64%), Gaps = 28/156 (18%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALR---SAFLPRNGL----RNRLSSSGL  261
            MAP +SR+L                 G + VAALR   S  LPR  L    R    + G+
Sbjct  1    MAPALSRTL-----------------GPSSVAALRPSPSRGLPRAALAPQGRRPAGARGV  43

Query  262  KWKLERRDSSVVVRCEASAVAEK--EAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFL  435
            +W+   R+  V  RC ASAVAEK     E+ GE   YQAEVSRL+DLIVHSLYSHKE+FL
Sbjct  44   RWEA-GRERLVGARC-ASAVAEKTAGEEEAAGEEFEYQAEVSRLMDLIVHSLYSHKEVFL  101

Query  436  RELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            RELVSNASDALDKLRFL VT+PS+L D G+++IRIK
Sbjct  102  RELVSNASDALDKLRFLSVTDPSVLADGGDMEIRIK  137



>gb|KDP29908.1| hypothetical protein JCGZ_18477 [Jatropha curcas]
Length=805

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 92/145 (63%), Gaps = 14/145 (10%)
 Frame = +1

Query  133  SVAAVPFT-PSFPQKSA--GGNRVAALRSAFLPRNGLRNRL-SSSGLKWK----LERRDS  288
            S AA P + PS    SA  G NR A   S   PRN + N+  SS+ L  K    L  R  
Sbjct  23   SAAAAPLSCPSHLADSAVDGDNR-ARWYSVLTPRNLIPNKAGSSTHLNLKHGLFLGYRYE  81

Query  289  SVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDAL  468
            S     +AS+      P   GE + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDAL
Sbjct  82   STAAESDASSY-----PPPVGEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDAL  136

Query  469  DKLRFLGVTEPSLLGDAGELQIRIK  543
            DKLRFLGVTEP LL DA +L IRI+
Sbjct  137  DKLRFLGVTEPGLLKDAADLDIRIQ  161



>ref|XP_003578283.1| PREDICTED: heat shock cognate 90 kDa protein-like [Brachypodium 
distachyon]
Length=794

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 96/153 (63%), Gaps = 13/153 (8%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLER-  279
            MAP +SR+L + +A    PS  +    G  +       LP+    +R  + G++W L + 
Sbjct  1    MAPALSRTLGASSAAGLRPSPSRGLLPGAHM------LLPQGRGASR-RARGVRWDLGKK  53

Query  280  -RDSSVVVRCEASAVAEKEAPESEGETHG----YQAEVSRLLDLIVHSLYSHKEIFLREL  444
             R   V VRC+A+   +    E E    G    YQAEVSRL+DLIVHSLYSHKE+FLREL
Sbjct  54   GRGRPVGVRCDAAVAEKTAGEEEEEALAGEKFEYQAEVSRLMDLIVHSLYSHKEVFLREL  113

Query  445  VSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            VSNASDALDKLRFL VT+PS+L D  E++IRIK
Sbjct  114  VSNASDALDKLRFLSVTDPSMLSDGAEMEIRIK  146



>gb|EEE68898.1| hypothetical protein OsJ_27736 [Oryza sativa Japonica Group]
Length=786

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 94/149 (63%), Gaps = 12/149 (8%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLER-  279
            MAP +SRSL + +     P   +  A G    A R +   R G        G++W+    
Sbjct  1    MAPSLSRSLGASSVAALRPCAGRVRAPG--AGAARGSGSARCG-------RGVRWEAGSG  51

Query  280  -RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
             R   V VRC+A+   + E   +E E   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  52   SRGRLVRVRCDAAVAEKAEE-TAEEEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  110

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFLGVT+ SLL D GEL+IRIK
Sbjct  111  SDALDKLRFLGVTDSSLLADGGELEIRIK  139



>ref|NP_001062103.1| Os08g0487800 [Oryza sativa Japonica Group]
 dbj|BAD09415.1| putative heat-shock protein [Oryza sativa Japonica Group]
 dbj|BAF24017.1| Os08g0487800 [Oryza sativa Japonica Group]
 gb|EEC83781.1| hypothetical protein OsI_29679 [Oryza sativa Indica Group]
Length=785

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 94/149 (63%), Gaps = 12/149 (8%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLER-  279
            MAP +SRSL + +     P   +  A G    A R +   R G        G++W+    
Sbjct  1    MAPSLSRSLGASSVAALRPCAGRVRAPG--AGAARGSGSARCG-------RGVRWEAGSG  51

Query  280  -RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
             R   V VRC+A+   + E   +E E   YQAEVSRL+DLIVHSLYSHKE+FLRELVSNA
Sbjct  52   SRGRLVRVRCDAAVAEKAEE-TAEEEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNA  110

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFLGVT+ SLL D GEL+IRIK
Sbjct  111  SDALDKLRFLGVTDSSLLADGGELEIRIK  139



>ref|XP_001779894.1| predicted protein [Physcomitrella patens]
 gb|EDQ55309.1| predicted protein [Physcomitrella patens]
Length=836

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 4/82 (5%)
 Frame = +1

Query  298  VRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKL  477
            VRC+A+ VAEKE+P    E + YQAEVSRL+DLIVHSLYSHKE+FLRELVSNASDALDKL
Sbjct  103  VRCDAT-VAEKESP---VEKYEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASDALDKL  158

Query  478  RFLGVTEPSLLGDAGELQIRIK  543
            RFL VTEP+L+     ++IRIK
Sbjct  159  RFLSVTEPTLMEPNPNMEIRIK  180



>emb|CAA82945.1| heat-shock protein [Secale cereale]
Length=781

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 105/152 (69%), Gaps = 19/152 (13%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLE  276
            MAP +SR+L  +SVAA+  +PS       G  +AAL    LP+ G R+  S+ G++W+  
Sbjct  1    MAPALSRTLGPSSVAALRPSPS------RGLPLAAL----LPQ-GKRSS-SARGVRWEA-  47

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHG---YQAEVSRLLDLIVHSLYSHKEIFLRELV  447
             R   V  RC ASAVAEK A E E        YQAEVSRL+DLIVHSLYSHKE+FLRELV
Sbjct  48   GRGRLVGARC-ASAVAEKTAGEEEEAAGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELV  106

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SNASDALDKLRFL VT+ S+L D GEL+IRIK
Sbjct  107  SNASDALDKLRFLSVTDSSVLADGGELEIRIK  138



>ref|XP_009381110.1| PREDICTED: heat shock protein 83 [Musa acuminata subsp. malaccensis]
Length=790

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 73/103 (71%), Gaps = 2/103 (2%)
 Frame = +1

Query  235  RNRLSSSGLKWKLERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLY  414
            +N  S  G+   L  R S +   C  S VA  ++ E   E + YQAEVSRL+DLIVHSLY
Sbjct  56   KNNGSKFGMH--LNSRHSMLACSCLESTVAATDSSEPPSEKYEYQAEVSRLMDLIVHSLY  113

Query  415  SHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            S+KE+FLRELVSNASDALDKLRFL VT+P LL DA +L IRI+
Sbjct  114  SNKEVFLRELVSNASDALDKLRFLSVTKPELLKDAVDLDIRIQ  156



>gb|KJB33205.1| hypothetical protein B456_006G000500 [Gossypium raimondii]
Length=207

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 81/147 (55%), Gaps = 39/147 (27%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MAP++SRSL + + V    S P      N+   +R+ F+P N L   LS S L+ K E  
Sbjct  1    MAPILSRSLVTSSLV----SLPL--INPNKAFNIRNTFVPLNTLNKALSCSRLREKFE--  52

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
                                       YQ E    LDLIVHSLYSHK++FLRELVSNASD
Sbjct  53   ---------------------------YQVE----LDLIVHSLYSHKKVFLRELVSNASD  81

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL V EPSLL D+ EL+I IK
Sbjct  82   ALDKLRFLSVAEPSLLEDSSELEIHIK  108



>gb|EPS70213.1| hypothetical protein M569_04546, partial [Genlisea aurea]
Length=459

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  304  CEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRF  483
            C  S  A  E P  + E   YQAEVSRL+DLIV+SLYS+K++FLREL+SNASDALDKLRF
Sbjct  66   CNMSTAAYSEPPPVDAEKFEYQAEVSRLMDLIVNSLYSNKDVFLRELISNASDALDKLRF  125

Query  484  LGVTEPSLLGDAGELQIRIK  543
            L VTEP LL D+ +L IRI+
Sbjct  126  LSVTEPQLLKDSVDLDIRIQ  145



>ref|XP_002531697.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30688.1| heat shock protein, putative [Ricinus communis]
Length=799

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 4/84 (5%)
 Frame = +1

Query  301  RCEASAVAEKEA---PESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALD  471
            R E++A AE +A   P   GE + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALD
Sbjct  75   RYESTA-AESDASSPPPPVGEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALD  133

Query  472  KLRFLGVTEPSLLGDAGELQIRIK  543
            KLRFLGVTEP LL DA +L IRI+
Sbjct  134  KLRFLGVTEPELLKDAADLDIRIQ  157



>ref|XP_006664594.1| PREDICTED: heat shock protein 83-like [Oryza brachyantha]
Length=780

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +1

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            R  S V  R E+SA A   +     E H YQAEV+RL+DLIVHSLYS+KE+FLRELVSNA
Sbjct  51   REGSLVGRRYESSAAAVDSSDMPPAEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNA  110

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLR+L VT+P LL D  EL IRI+
Sbjct  111  SDALDKLRYLSVTDPDLLKDGPELDIRIQ  139



>ref|XP_004962890.1| PREDICTED: heat shock protein 83-like isoform X2 [Setaria italica]
Length=815

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 29/146 (20%)
 Frame = +1

Query  106  APVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERRD  285
            AP   + L SV A P       K +G + VA+L+   L    L  R           R D
Sbjct  47   APQQQKRLLSVLAAP-------KVSGTSNVASLK---LMDGALIGR-----------RYD  85

Query  286  SSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDA  465
            SS      A+AV   + P +E   H YQAEV+RL+DLIVHSLYS+KE+FLRELVSNASDA
Sbjct  86   SS------AAAVDSTDMPPAE--KHEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDA  137

Query  466  LDKLRFLGVTEPSLLGDAGELQIRIK  543
            LDKLR+L VT+P LL D  EL IRI+
Sbjct  138  LDKLRYLSVTDPELLKDGPELDIRIQ  163



>ref|XP_004962889.1| PREDICTED: heat shock protein 83-like isoform X1 [Setaria italica]
Length=817

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 29/146 (20%)
 Frame = +1

Query  106  APVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERRD  285
            AP   + L SV A P       K +G + VA+L+   L    L  R           R D
Sbjct  47   APQQQKRLLSVLAAP-------KVSGTSNVASLK---LMDGALIGR-----------RYD  85

Query  286  SSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDA  465
            SS      A+AV   + P +E   H YQAEV+RL+DLIVHSLYS+KE+FLRELVSNASDA
Sbjct  86   SS------AAAVDSTDMPPAE--KHEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDA  137

Query  466  LDKLRFLGVTEPSLLGDAGELQIRIK  543
            LDKLR+L VT+P LL D  EL IRI+
Sbjct  138  LDKLRYLSVTDPELLKDGPELDIRIQ  163



>ref|XP_006363008.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=794

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A  +A +S  E   YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  75   RFESTAAA-SDASDSPSEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  133

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FLGVTEP LL DA +L IRI+
Sbjct  134  FLGVTEPELLKDAVDLDIRIQ  154



>ref|XP_003575983.1| PREDICTED: heat shock protein 83 [Brachypodium distachyon]
Length=813

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 85/123 (69%), Gaps = 11/123 (9%)
 Frame = +1

Query  181  GGNRVAALRSAFLPR-NGLRNRLSSSGLKWKLERRDSSVV-VRCEASAVAEKEAPESEGE  354
            GG R+ ++ +A  P+ NG  N +S       L+ R+S+++  R E+SA A   +     E
Sbjct  57   GGKRLLSVLAA--PKLNGAANVVS-------LKVRESALIGRRYESSAAAVDSSDAPPAE  107

Query  355  THGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQI  534
               YQAEV+RL+DLIVHSLYS+KE+FLRELVSNASDALDKLR+L VT+P LL D  EL I
Sbjct  108  KFEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLLKDGPELDI  167

Query  535  RIK  543
            RI+
Sbjct  168  RIQ  170



>ref|XP_008800616.1| PREDICTED: heat shock protein 83 [Phoenix dactylifera]
Length=801

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  LERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            L  R+ ++V     S  A  +  +   E + YQAEVSRL+DLIVHSLYS+KE+FLRELVS
Sbjct  71   LNIRNGTLVSNRYVSTTAAVDTSDPPCEKYEYQAEVSRLMDLIVHSLYSNKEVFLRELVS  130

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLRFL VTEP LL DA +L IRI+
Sbjct  131  NASDALDKLRFLSVTEPELLKDAVDLDIRIQ  161



>ref|XP_010270190.1| PREDICTED: heat shock protein 81-1-like isoform X1 [Nelumbo nucifera]
Length=795

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A  +A +   E + YQAEVSRL+DLIVHSLYS+KE+FLREL+SNASDALDKLR
Sbjct  79   RYESTAAA-SDASDPPVEKYEYQAEVSRLMDLIVHSLYSNKEVFLRELISNASDALDKLR  137

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FL VTEP+LL DA +L IR++
Sbjct  138  FLSVTEPALLKDAVDLDIRVQ  158



>ref|XP_006849050.1| hypothetical protein AMTR_s00028p00187760 [Amborella trichopoda]
 gb|ERN10631.1| hypothetical protein AMTR_s00028p00187760 [Amborella trichopoda]
Length=799

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +1

Query  298  VRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKL  477
            VR EA+ VA  +      E   YQAEVSRL+DLIVHSLYS+KE+FLRELVSNASDALDKL
Sbjct  79   VRYEAT-VAATDTSNPTAEKFEYQAEVSRLMDLIVHSLYSNKEVFLRELVSNASDALDKL  137

Query  478  RFLGVTEPSLLGDAGELQIRIK  543
            RFL VTEP LL DA +L IRI+
Sbjct  138  RFLSVTEPELLRDAVDLDIRIQ  159



>gb|KCW88689.1| hypothetical protein EUGRSUZ_A01044 [Eucalyptus grandis]
Length=752

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A   +P    E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  73   RYESTAAANDASPPPSAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  132

Query  481  FLGVTEPSLLGD-AGELQIRIK  543
            FL VTEP LL D A +L IRI+
Sbjct  133  FLSVTEPQLLKDAAADLDIRIQ  154



>ref|XP_010045864.1| PREDICTED: heat shock protein 83 [Eucalyptus grandis]
 gb|KCW88688.1| hypothetical protein EUGRSUZ_A01044 [Eucalyptus grandis]
Length=794

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A   +P    E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  73   RYESTAAANDASPPPSAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  132

Query  481  FLGVTEPSLLGD-AGELQIRIK  543
            FL VTEP LL D A +L IRI+
Sbjct  133  FLSVTEPQLLKDAAADLDIRIQ  154



>ref|XP_004243554.1| PREDICTED: heat shock protein 83 [Solanum lycopersicum]
Length=794

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A  +  +S  E   YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  75   RFESTAAA-SDTSDSPSEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  133

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FLGVTEP LL DA +L IRI+
Sbjct  134  FLGVTEPELLKDAVDLDIRIQ  154



>gb|EMS64316.1| Heat shock protein 83 [Triticum urartu]
Length=768

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 83/122 (68%), Gaps = 9/122 (7%)
 Frame = +1

Query  181  GGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERRDSSVV-VRCEASAVAEKEAPESEGET  357
            GG R+ ++ +A  P+      LSS      L+ R+S++V  R E+SA A   +     E 
Sbjct  13   GGKRLLSVLAA--PKLNGAESLSS------LKLRESALVGRRYESSAAAVDSSDAPPAEK  64

Query  358  HGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIR  537
              YQAEV+RL+DLIVHSLYS+KE+FLRELVSNASDALDKLR+L VT+P LL D  EL IR
Sbjct  65   FEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLLKDGPELDIR  124

Query  538  IK  543
            I+
Sbjct  125  IQ  126



>gb|EMT31740.1| Heat shock protein 83 [Aegilops tauschii]
Length=792

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 83/122 (68%), Gaps = 9/122 (7%)
 Frame = +1

Query  181  GGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERRDSSVV-VRCEASAVAEKEAPESEGET  357
            GG R+ ++ +A  P+      LSS      L+ R+S++V  R E+SA A   +     E 
Sbjct  58   GGKRLFSVLAA--PKLNGAESLSS------LKLRESALVGRRYESSAAAVDSSDAPPAEK  109

Query  358  HGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIR  537
              YQAEV+RL+DLIVHSLYS+KE+FLRELVSNASDALDKLR+L VT+P LL D  EL IR
Sbjct  110  FEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLLKDGPELDIR  169

Query  538  IK  543
            I+
Sbjct  170  IQ  171



>gb|ACG47228.1| heat shock protein 83 [Zea mays]
Length=524

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E+SA A  ++ +   E H YQAEV+RL+DLIVHSLYS+KE+FLRELVSNASDALDKLR
Sbjct  83   RYESSAAA-VDSTDPPAEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLR  141

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            +L VT+P LL D  +L IRI+
Sbjct  142  YLSVTDPELLKDGPQLDIRIQ  162



>ref|XP_008648551.1| PREDICTED: heat shock protein 83-like isoform X2 [Zea mays]
Length=730

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  LERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            L+  D +++ R   S+ A  ++ +   E H YQAEV+RL+DLIVHSLYS+KE+FLRELVS
Sbjct  7    LKLMDGALIGRRYESSAAAVDSTDQLAEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELVS  66

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLR+L VT+P LL D  +L IRI+
Sbjct  67   NASDALDKLRYLSVTDPELLKDGPQLDIRIQ  97



>ref|XP_008648550.1| PREDICTED: heat shock protein 83-like isoform X1 [Zea mays]
Length=741

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  LERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            L+  D +++ R   S+ A  ++ +   E H YQAEV+RL+DLIVHSLYS+KE+FLRELVS
Sbjct  7    LKLMDGALIGRRYESSAAAVDSTDQLAEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELVS  66

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLR+L VT+P LL D  +L IRI+
Sbjct  67   NASDALDKLRYLSVTDPELLKDGPQLDIRIQ  97



>dbj|BAK01596.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%), Gaps = 7/121 (6%)
 Frame = +1

Query  181  GGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERRDSSVVVRCEASAVAEKEAPESEGETH  360
            GG R+ ++ +A  P+  +   L S  L     R ++ V  R E+SA A   +     E  
Sbjct  59   GGKRLLSVLAA--PKLNVGESLPSLKL-----RENALVGRRYESSAAAVDSSDAPPAEKF  111

Query  361  GYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRI  540
             YQAEV+RL+DLIVHSLYS+KE+FLRELVSNASDALDKLR+L VT+P LL D  EL IRI
Sbjct  112  EYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLLKDGPELDIRI  171

Query  541  K  543
            +
Sbjct  172  Q  172



>ref|XP_002443262.1| hypothetical protein SORBIDRAFT_08g016560 [Sorghum bicolor]
 gb|EES17100.1| hypothetical protein SORBIDRAFT_08g016560 [Sorghum bicolor]
Length=814

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  LERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVS  450
            L+  D +++ R   S+ A  ++ +   E H YQAEV+RL+DLIVHSLYS+KE+FLRELVS
Sbjct  75   LKLMDGALIGRRYESSAAAVDSTDLPAEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELVS  134

Query  451  NASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            NASDALDKLR+L VT+P LL D  +L IRI+
Sbjct  135  NASDALDKLRYLSVTDPELLKDGPQLDIRIQ  165



>gb|ACN33229.1| unknown [Zea mays]
Length=813

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E+SA A  ++ +   E H YQAEV+RL+DLIVHSLYS+KE+FLRELVSNASDALDKLR
Sbjct  83   RYESSAAA-VDSTDPPAEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLR  141

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            +L VT+P LL D  +L IRI+
Sbjct  142  YLSVTDPELLKDGPQLDIRIQ  162



>ref|XP_007049300.1| Heat shock protein 89.1 isoform 2 [Theobroma cacao]
 ref|XP_007049301.1| Heat shock protein 89.1 isoform 2 [Theobroma cacao]
 gb|EOX93457.1| Heat shock protein 89.1 isoform 2 [Theobroma cacao]
 gb|EOX93458.1| Heat shock protein 89.1 isoform 2 [Theobroma cacao]
Length=796

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%), Gaps = 2/83 (2%)
 Frame = +1

Query  301  RCEASAVAEKEA--PESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDK  474
            R E++A A   A  P    E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDK
Sbjct  76   RYESTAAASDSANQPPPPAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDK  135

Query  475  LRFLGVTEPSLLGDAGELQIRIK  543
            LR+L VTEP LL DA +L IRI+
Sbjct  136  LRYLSVTEPQLLKDAVDLNIRIQ  158



>ref|XP_008674382.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83 [Zea mays]
Length=815

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E+SA A  ++ +   E H YQAEV+RL+DLIVHSLYS+KE+FLRELVSNASDALDKLR
Sbjct  83   RYESSAAA-VDSTDPPAEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLR  141

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            +L VT+P LL D  +L IRI+
Sbjct  142  YLSVTDPELLKDGPQLDIRIQ  162



>gb|KDO58428.1| hypothetical protein CISIN_1g003713mg [Citrus sinensis]
Length=753

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEG-ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKL  477
            R E++A  +  +P     E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKL
Sbjct  78   RYESTAAFDASSPPPPPLEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKL  137

Query  478  RFLGVTEPSLLGDAGELQIRIK  543
            R+LGVTEP LL DA +L IRI+
Sbjct  138  RYLGVTEPELLKDAVDLDIRIQ  159



>emb|CDY66279.1| BnaAnng22000D [Brassica napus]
Length=438

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGEL  528
            G       ++SRLLDLIVHSLYSHKE+FLRELVSNASDALDKLRFL VTEP+L GD G+L
Sbjct  2    GPVRSSSTKLSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPALFGDGGDL  61

Query  529  QIRIK  543
            +IRIK
Sbjct  62   EIRIK  66



>ref|XP_008379983.1| PREDICTED: heat shock protein 90-1-like [Malus domestica]
Length=809

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A    P    ET+ YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  75   RYESTAAASDAPP---AETYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  131

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FL VT+P LL   G+L IRI+
Sbjct  132  FLSVTQPELLKGGGDLDIRIQ  152



>gb|KDO58427.1| hypothetical protein CISIN_1g003713mg [Citrus sinensis]
Length=801

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEG-ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKL  477
            R E++A  +  +P     E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKL
Sbjct  78   RYESTAAFDASSPPPPPLEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKL  137

Query  478  RFLGVTEPSLLGDAGELQIRIK  543
            R+LGVTEP LL DA +L IRI+
Sbjct  138  RYLGVTEPELLKDAVDLDIRIQ  159



>ref|XP_002507383.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68641.1| predicted protein [Micromonas sp. RCC299]
Length=782

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 3/84 (4%)
 Frame = +1

Query  292  VVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALD  471
             +VR EA   A +E P S GET+ YQAEV+RLLDLIV+SLYS++++FLRELVSNASDALD
Sbjct  47   TIVRAEA---ATEEKPASGGETYEYQAEVNRLLDLIVNSLYSNRDVFLRELVSNASDALD  103

Query  472  KLRFLGVTEPSLLGDAGELQIRIK  543
            KLRF  V+ P ++   GE++++IK
Sbjct  104  KLRFTSVSNPDVMAANGEMKMQIK  127



>gb|EEC69377.1| hypothetical protein OsI_38512 [Oryza sativa Indica Group]
Length=811

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +1

Query  271  LERRDSSVV-VRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
            L+ R+ S+V  R E+SA A   +     E H YQAEV+RL+DLIVHSLYS+KE+FLRELV
Sbjct  80   LKLREGSLVGRRYESSAAAVDSSDTPPVEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELV  139

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SNASDALDKLR+L VT+P L+ D   L IRI+
Sbjct  140  SNASDALDKLRYLSVTDPDLIKDGAGLDIRIQ  171



>ref|NP_001066882.1| Os12g0514500 [Oryza sativa Japonica Group]
 gb|ABG22029.1| Hsp90 protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF29901.1| Os12g0514500 [Oryza sativa Japonica Group]
Length=811

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +1

Query  271  LERRDSSVV-VRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
            L+ R+ S+V  R E+SA A   +     E H YQAEV+RL+DLIVHSLYS+KE+FLRELV
Sbjct  80   LKLREGSLVGRRYESSAAAVDSSDTPPVEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELV  139

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SNASDALDKLR+L VT+P L+ D   L IRI+
Sbjct  140  SNASDALDKLRYLSVTDPDLIKDGAGLDIRIQ  171



>ref|XP_002270014.3| PREDICTED: heat shock protein 83 isoform X2 [Vitis vinifera]
Length=841

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 83/136 (61%), Gaps = 3/136 (2%)
 Frame = +1

Query  136  VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERRDSSVVVRCEAS  315
             A  P TP+ P   + G   A LR   +  +G  +   +S    +L  R+  ++     S
Sbjct  69   TAPAPITPASPFNDSVGQNDAKLRWYSVLASGRSDAGRNST---QLNLRNGLLLGNRYES  125

Query  316  AVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVT  495
              A  +A +   E   YQAEVSRL+DLIVHSLYS+KE+FLREL+SNASDALDKLRFL VT
Sbjct  126  TAAASDASDPPAEKFEYQAEVSRLMDLIVHSLYSNKEVFLRELISNASDALDKLRFLSVT  185

Query  496  EPSLLGDAGELQIRIK  543
            EP LL D  +L IRI+
Sbjct  186  EPQLLKDGLDLDIRIQ  201



>ref|XP_010657447.1| PREDICTED: heat shock protein 83 isoform X1 [Vitis vinifera]
Length=842

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 83/136 (61%), Gaps = 3/136 (2%)
 Frame = +1

Query  136  VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERRDSSVVVRCEAS  315
             A  P TP+ P   + G   A LR   +  +G  +   +S    +L  R+  ++     S
Sbjct  69   TAPAPITPASPFNDSVGQNDAKLRWYSVLASGRSDAGRNST---QLNLRNGLLLGNRYES  125

Query  316  AVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVT  495
              A  +A +   E   YQAEVSRL+DLIVHSLYS+KE+FLREL+SNASDALDKLRFL VT
Sbjct  126  TAAASDASDPPAEKFEYQAEVSRLMDLIVHSLYSNKEVFLRELISNASDALDKLRFLSVT  185

Query  496  EPSLLGDAGELQIRIK  543
            EP LL D  +L IRI+
Sbjct  186  EPQLLKDGLDLDIRIQ  201



>ref|XP_010943850.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=801

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +1

Query  280  RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNAS  459
            R+S +V     S     +  +   E   YQAEVSRL+DLIVHSLYS+KEIFLREL+SNAS
Sbjct  72   RNSILVSNRHESTATSADTSDPTCEEFEYQAEVSRLMDLIVHSLYSNKEIFLRELISNAS  131

Query  460  DALDKLRFLGVTEPSLLGDAGELQIRIK  543
            DALDKLR+L VTEP LL DA +L IRI+
Sbjct  132  DALDKLRYLSVTEPKLLKDAVDLDIRIQ  159



>ref|XP_010657448.1| PREDICTED: heat shock protein 83 isoform X3 [Vitis vinifera]
Length=839

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  313  SAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGV  492
            S  A  +A +   E   YQAEVSRL+DLIVHSLYS+KE+FLREL+SNASDALDKLRFL V
Sbjct  122  STAAASDASDPPAEKFEYQAEVSRLMDLIVHSLYSNKEVFLRELISNASDALDKLRFLSV  181

Query  493  TEPSLLGDAGELQIRIK  543
            TEP LL D  +L IRI+
Sbjct  182  TEPQLLKDGLDLDIRIQ  198



>ref|XP_010905224.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=807

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = +1

Query  310  ASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLG  489
             +A A+  +P  E     YQAEVSRL+DLIVHSLYS+KE+FLRELVSNASDALDKLRFL 
Sbjct  92   TAAAADPSSPPCE--KFEYQAEVSRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRFLS  149

Query  490  VTEPSLLGDAGELQIRIK  543
            VTEP LL DA +L IRI+
Sbjct  150  VTEPELLKDAVDLDIRIQ  167



>gb|EEE53305.1| hypothetical protein OsJ_36277 [Oryza sativa Japonica Group]
Length=939

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +1

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            R  S V  R E+SA A   +     E H YQAEV+RL+DLIVHSLYS+KE+FLRELVSNA
Sbjct  211  REGSLVGRRYESSAAAVDSSDTPPVEKHEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNA  270

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLR+L VT+P L+ D   L IRI+
Sbjct  271  SDALDKLRYLSVTDPDLIKDGAGLDIRIQ  299



>ref|XP_010270191.1| PREDICTED: heat shock protein 81-1-like isoform X2 [Nelumbo nucifera]
Length=782

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  313  SAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGV  492
            S  A  +A +   E + YQAEVSRL+DLIVHSLYS+KE+FLREL+SNASDALDKLRFL V
Sbjct  69   STAAASDASDPPVEKYEYQAEVSRLMDLIVHSLYSNKEVFLRELISNASDALDKLRFLSV  128

Query  493  TEPSLLGDAGELQIRIK  543
            TEP+LL DA +L IR++
Sbjct  129  TEPALLKDAVDLDIRVQ  145



>ref|WP_044194393.1| heat shock protein 90 [Hyalangium minutum]
 gb|KFE64323.1| Chaperone protein HtpG [Hyalangium minutum]
Length=667

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  340  ESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDA  519
            ES+ ETH +QAE+++LL+L+++SLYSHKEIFLRELVSNASDALDKLRF  +TEP LLGD 
Sbjct  4    ESQRETHSFQAEINQLLNLVINSLYSHKEIFLRELVSNASDALDKLRFRTITEPELLGDQ  63

Query  520  GELQIRI  540
              L+IRI
Sbjct  64   TALEIRI  70



>ref|XP_009798975.1| PREDICTED: heat shock protein 83 [Nicotiana sylvestris]
Length=791

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 4/84 (5%)
 Frame = +1

Query  292  VVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALD  471
            +  R E++A A     +S  E   YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALD
Sbjct  72   LACRYESTAAAS----DSPSEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALD  127

Query  472  KLRFLGVTEPSLLGDAGELQIRIK  543
            KLRFLGVT+P LL D  +L IRI+
Sbjct  128  KLRFLGVTQPELLKDGVDLDIRIQ  151



>ref|XP_006447753.1| hypothetical protein CICLE_v10014316mg [Citrus clementina]
 ref|XP_006469512.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
 gb|ESR60993.1| hypothetical protein CICLE_v10014316mg [Citrus clementina]
Length=801

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR+LGVTEP LL DA +L 
Sbjct  96   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLGVTEPELLKDAVDLD  155

Query  532  IRIK  543
            IRI+
Sbjct  156  IRIQ  159



>ref|XP_010112788.1| Heat shock protein 90 [Morus notabilis]
 gb|EXC34903.1| Heat shock protein 90 [Morus notabilis]
Length=795

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGEL  528
             E++ YQAEVSRLLDLIV+SLYS+KE+FLREL+SNASDALDKLRFL VTEP LL DA +L
Sbjct  92   AESYEYQAEVSRLLDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPELLKDAVDL  151

Query  529  QIRIK  543
             IRI+
Sbjct  152  DIRIQ  156



>ref|XP_003617951.1| Heat-shock protein [Medicago truncatula]
 gb|AET00910.1| heat shock protein 81-2 [Medicago truncatula]
Length=792

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +1

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +RD  +  R E++A           E   YQAEVSRL+DLIV+SLYS+KE+FLREL+SNA
Sbjct  65   KRDLFLGKRYESTAAESNATSSPPAEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNA  124

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEP L+ DA +  IRI+
Sbjct  125  SDALDKLRFLSVTEPDLMKDAIDFDIRIQ  153



>ref|XP_009605137.1| PREDICTED: heat shock protein 83 [Nicotiana tomentosiformis]
Length=791

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 4/81 (5%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A     +S  E   YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  75   RYESTAAAS----DSPSEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  130

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FLGVT+P +L D  +L IRI+
Sbjct  131  FLGVTQPEILKDGVDLDIRIQ  151



>gb|KHN43948.1| Heat shock protein 90 [Glycine soja]
Length=788

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++  AE  +P +E   + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  73   RYESTTAAESSSPPAE--RYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  130

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FL VTE  LL DA +  IRI+
Sbjct  131  FLSVTESGLLKDAVDFDIRIQ  151



>ref|XP_002992602.1| hypothetical protein SELMODRAFT_448838 [Selaginella moellendorffii]
 gb|EFJ06304.1| hypothetical protein SELMODRAFT_448838 [Selaginella moellendorffii]
Length=836

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  YQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            YQAEVSRL+DLIV+SLYSHKE+FLRELVSNASDALDKLRFL VTEPSLL     L+IRIK
Sbjct  98   YQAEVSRLMDLIVNSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLLDPNPNLEIRIK  157



>ref|XP_009127645.1| PREDICTED: uncharacterized protein LOC103852496 [Brassica rapa]
Length=120

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 83/152 (55%), Gaps = 48/152 (32%)
 Frame = +1

Query  103  MAPVMSRSL--TSVAAVPFTPSFPQKSAGGNRVAALRSAFLPR--NGLRNRLSSSGLKWK  270
            MAP +SRSL  T + ++P TP+         R++ LR+AFLPR  +GLR  +S S   W 
Sbjct  1    MAPALSRSLYTTPLTSLPLTPT---------RLSPLRTAFLPRAGSGLRTSVSCS---WN  48

Query  271  LERRDSSVVVRCEASAVAEKE-APESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV  447
            LE+R S   V+C+A AVAEKE A E  GE   YQAE                        
Sbjct  49   LEKRCSRFAVKCDA-AVAEKETAEEVSGEKFEYQAE------------------------  83

Query  448  SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
                  LDKLRFL VTEP+LLGD GEL+IRIK
Sbjct  84   ------LDKLRFLSVTEPALLGDGGELEIRIK  109



>ref|XP_003519663.1| PREDICTED: heat shock protein 83-like [Glycine max]
Length=791

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++  AE  +P +E   + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  73   RYESTTAAESSSPPAE--RYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  130

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FL VTE  LL DA +  IRI+
Sbjct  131  FLSVTESGLLKDAVDFDIRIQ  151



>ref|XP_002968038.1| hypothetical protein SELMODRAFT_88538 [Selaginella moellendorffii]
 gb|EFJ31385.1| hypothetical protein SELMODRAFT_88538 [Selaginella moellendorffii]
Length=751

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  YQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            YQAEVSRL+DLIV+SLYSHKE+FLRELVSNASDALDKLRFL VTEPSLL     L+IRIK
Sbjct  24   YQAEVSRLMDLIVNSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLLDPNPNLEIRIK  83



>ref|XP_008342195.1| PREDICTED: heat shock protein 90-1-like [Malus domestica]
Length=806

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A   +     ET+ YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  74   RYESTAAASCASAAPPAETYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  133

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FL VT+P LL   G+L IRI+
Sbjct  134  FLSVTQPDLLKGGGDLDIRIQ  154



>ref|XP_009365237.1| PREDICTED: heat shock protein 81-1, partial [Pyrus x bretschneideri]
Length=878

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A    P    ET+ YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  144  RYESTAAASDAPP---AETYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  200

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FL VT+P LL   G L I I+
Sbjct  201  FLSVTQPELLKGGGVLDIHIQ  221



>ref|WP_015352209.1| heat shock protein 90 [Myxococcus stipitatus]
 ref|YP_007363639.1| heat shock protein 90 [Myxococcus stipitatus DSM 14675]
 gb|AGC47955.1| heat shock protein 90 [Myxococcus stipitatus DSM 14675]
Length=641

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            ETH +QAE+++LL L+++SLYSHKEIFLRELVSNASDALDKLRF  +TEP LL DA EL+
Sbjct  10   ETHAFQAEINQLLSLVINSLYSHKEIFLRELVSNASDALDKLRFRAITEPELLADAPELE  69

Query  532  IRI  540
            +RI
Sbjct  70   LRI  72



>ref|XP_006660235.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=704

 Score =   100 bits (249),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  VSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            VSRLLDLIVHSLYSHKE+FLRELVSNASDALDKLRFLGVT+ SLL D GEL+IRIK
Sbjct  4    VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLGVTDSSLLADGGELEIRIK  59



>gb|KJB10747.1| hypothetical protein B456_001G220600 [Gossypium raimondii]
Length=718

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 8/149 (5%)
 Frame = +1

Query  106  APVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSS-GLKWKLERR  282
            AP     + + A + F+   P  +   +      SA      +  R SS   LK      
Sbjct  16   APATRYRIAAAAPISFSTPIPVSAVESDNSTRWYSAITGGKCITTRHSSQLNLK-----N  70

Query  283  DSSVVVRCEASAVAEKEA--PESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            D  +  R E++A A      P    E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNA
Sbjct  71   DLFLGSRYESTAAASDSGNPPPPPAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNA  130

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLR+L VT+P L  DA +L IRI+
Sbjct  131  SDALDKLRYLSVTDPQLSKDAVDLDIRIQ  159



>ref|XP_008464175.1| PREDICTED: heat shock protein 81-1 [Cucumis melo]
Length=790

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  295  VVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDK  474
            + R E++A A   +     E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDK
Sbjct  76   LARFESTATASDASATPPVEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDK  135

Query  475  LRFLGVTEPSLLGDAGELQIRIK  543
            LRFL VT+P LL +A +  IRI+
Sbjct  136  LRFLSVTDPGLLKEAIDFDIRIQ  158



>gb|EYU43186.1| hypothetical protein MIMGU_mgv1a001565mg [Erythranthe guttata]
Length=794

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  292  VVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALD  471
            VV R   S  A  +A     E   YQAEVSRL+DLIV+SLYS+K++FLREL+SNASDALD
Sbjct  67   VVGRRYESTAAASDASTPPAEKFEYQAEVSRLMDLIVNSLYSNKDVFLRELISNASDALD  126

Query  472  KLRFLGVTEPSLLGDAGELQIRIK  543
            KLRFL VT+P LL D  +L IRI+
Sbjct  127  KLRFLSVTDPQLLKDTYDLDIRIQ  150



>ref|XP_011048941.1| PREDICTED: heat shock protein 83 isoform X3 [Populus euphratica]
Length=793

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGEL  528
            GE + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLRFL VT+  LL DA +L
Sbjct  90   GEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELLKDAADL  149

Query  529  QIRIK  543
             IRI+
Sbjct  150  DIRIQ  154



>ref|XP_011048939.1| PREDICTED: heat shock protein 83 isoform X2 [Populus euphratica]
Length=794

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGEL  528
            GE + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLRFL VT+  LL DA +L
Sbjct  90   GEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELLKDAADL  149

Query  529  QIRIK  543
             IRI+
Sbjct  150  DIRIQ  154



>ref|XP_011048938.1| PREDICTED: heat shock protein 83 isoform X1 [Populus euphratica]
Length=795

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGEL  528
            GE + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLRFL VT+  LL DA +L
Sbjct  90   GEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELLKDAADL  149

Query  529  QIRIK  543
             IRI+
Sbjct  150  DIRIQ  154



>gb|KJB10746.1| hypothetical protein B456_001G220600 [Gossypium raimondii]
Length=796

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 8/149 (5%)
 Frame = +1

Query  106  APVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSS-GLKWKLERR  282
            AP     + + A + F+   P  +   +      SA      +  R SS   LK      
Sbjct  16   APATRYRIAAAAPISFSTPIPVSAVESDNSTRWYSAITGGKCITTRHSSQLNLK-----N  70

Query  283  DSSVVVRCEASAVAEKEA--PESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            D  +  R E++A A      P    E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNA
Sbjct  71   DLFLGSRYESTAAASDSGNPPPPPAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNA  130

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLR+L VT+P L  DA +L IRI+
Sbjct  131  SDALDKLRYLSVTDPQLSKDAVDLDIRIQ  159



>gb|KJB10745.1| hypothetical protein B456_001G220600 [Gossypium raimondii]
Length=797

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 8/149 (5%)
 Frame = +1

Query  106  APVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSS-GLKWKLERR  282
            AP     + + A + F+   P  +   +      SA      +  R SS   LK      
Sbjct  16   APATRYRIAAAAPISFSTPIPVSAVESDNSTRWYSAITGGKCITTRHSSQLNLK-----N  70

Query  283  DSSVVVRCEASAVAEKEA--PESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            D  +  R E++A A      P    E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNA
Sbjct  71   DLFLGSRYESTAAASDSGNPPPPPAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNA  130

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLR+L VT+P L  DA +L IRI+
Sbjct  131  SDALDKLRYLSVTDPQLSKDAVDLDIRIQ  159



>ref|XP_002321183.2| hypothetical protein POPTR_0014s16280g [Populus trichocarpa]
 gb|EEE99498.2| hypothetical protein POPTR_0014s16280g [Populus trichocarpa]
Length=723

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGEL  528
            GE + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLRFL VT+  LL DA +L
Sbjct  90   GEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELLKDATDL  149

Query  529  QIRIK  543
             IRI+
Sbjct  150  DIRIQ  154



>ref|WP_019674841.1| heat shock protein 90 [Rheinheimera perlucida]
Length=641

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGE  525
            + +THG+QAEV +LL+L++HSLYS+KEIFLRELVSNASDA DKLRFL +++ SL GD GE
Sbjct  11   QKQTHGFQAEVKQLLNLMIHSLYSNKEIFLRELVSNASDAADKLRFLALSDSSLYGDDGE  70

Query  526  LQIRI  540
            L++RI
Sbjct  71   LKVRI  75



>ref|XP_009178256.1| hypothetical protein T265_16367, partial [Opisthorchis viverrini]
 gb|KER17997.1| hypothetical protein T265_16367, partial [Opisthorchis viverrini]
Length=85

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  325  EKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPS  504
            E  A ESEGET  +QAE+++L+ LI+++ YS+KEIFLREL+SNASDALDK+R+  +T+PS
Sbjct  4    EPMATESEGETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYKSLTDPS  63

Query  505  LLGDAGELQIRI  540
            +L    EL I++
Sbjct  64   VLDTGKELCIKL  75



>ref|XP_004293459.1| PREDICTED: heat shock protein 90-1 [Fragaria vesca subsp. vesca]
Length=799

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLRFL VT+P LL   G+L 
Sbjct  95   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDPDLLKGGGDLD  154

Query  532  IRIK  543
            IRI+
Sbjct  155  IRIQ  158



>ref|XP_007142495.1| hypothetical protein PHAVU_008G285400g [Phaseolus vulgaris]
 gb|ESW14489.1| hypothetical protein PHAVU_008G285400g [Phaseolus vulgaris]
Length=796

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +1

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            RRD  +  RCE++A     +     E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNA
Sbjct  69   RRDLFLGRRCESTAAESSASSSPPAERYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNA  128

Query  457  SDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            SDALDKLRFL VTEP LL +A +  IRI+
Sbjct  129  SDALDKLRFLSVTEPGLLKEAVDFDIRIQ  157



>gb|EMS50921.1| Endoplasmin [Triticum urartu]
Length=725

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  YQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            +  +VSRL+DLIVHSLYSHKE+FLRELVSNASDALDKLRFL VT+PS+L D G+++IRIK
Sbjct  17   FSLKVSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDPSVLADGGDMEIRIK  76



>ref|WP_008607439.1| heat shock protein 90 [Alishewanella aestuarii]
 gb|EJI86149.1| heat shock protein 90 [Alishewanella aestuarii B11]
Length=643

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGE  525
            + +THG+QAEV +LL L++HSLYS+KEIFLRELVSNASDA DKLRFL +++ SL GD GE
Sbjct  11   QKQTHGFQAEVKQLLQLMIHSLYSNKEIFLRELVSNASDAADKLRFLALSDSSLYGDDGE  70

Query  526  LQIRI  540
            L++RI
Sbjct  71   LRVRI  75



>ref|WP_008984231.1| heat shock protein 90 [Alishewanella agri]
 gb|EIW89153.1| heat shock protein 90 [Alishewanella agri BL06]
Length=643

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGE  525
            + +THG+QAEV +LL L++HSLYS+KEIFLRELVSNASDA DKLRFL +++ SL GD GE
Sbjct  11   QKQTHGFQAEVKQLLQLMIHSLYSNKEIFLRELVSNASDAADKLRFLALSDSSLYGDDGE  70

Query  526  LQIRI  540
            L++RI
Sbjct  71   LRVRI  75



>ref|WP_008951423.1| heat shock protein 90 [Alishewanella jeotgali]
 gb|EHR39835.1| heat shock protein 90 [Alishewanella jeotgali KCTC 22429]
Length=643

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGE  525
            + +THG+QAEV +LL L++HSLYS+KEIFLRELVSNASDA DKLRFL +++ SL GD GE
Sbjct  11   QKQTHGFQAEVKQLLQLMIHSLYSNKEIFLRELVSNASDAADKLRFLALSDSSLYGDDGE  70

Query  526  LQIRI  540
            L++RI
Sbjct  71   LRVRI  75



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = +1

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            DS VV R E+ ++++K +  S GE   +QAEVSRL+D+I++SLYS+K+IFLREL+SNASD
Sbjct  56   DSDVVRRLESESISKK-SLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD  114

Query  463  ALDKLRFLGVTEPSLL--GDAGELQIRIK  543
            ALDK+RFL +T+  +L  GD  +L+I+IK
Sbjct  115  ALDKIRFLALTDKDVLGEGDTAKLEIQIK  143



>ref|XP_010252714.1| PREDICTED: heat shock protein 90-1-like [Nelumbo nucifera]
Length=790

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  313  SAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGV  492
            S  A   A +   + + YQAEVSRL+DLIV+SLYS+KE+F REL+SNASDALDKLRFL V
Sbjct  83   STAAASVASDPPVQKYEYQAEVSRLMDLIVNSLYSNKEVFFRELISNASDALDKLRFLSV  142

Query  493  TEPSLLGDAGELQIRIK  543
            T+P LL DA +L IR++
Sbjct  143  TDPELLKDAVDLDIRVQ  159



>ref|XP_007214966.1| hypothetical protein PRUPE_ppa001503mg [Prunus persica]
 gb|EMJ16165.1| hypothetical protein PRUPE_ppa001503mg [Prunus persica]
Length=813

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A   + E   E   YQAEV+RL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  75   RFESTAAASDASAEPPAERFEYQAEVNRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  134

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FL VTEP LL   G+L IRI+
Sbjct  135  FLSVTEPDLLKGGGDLDIRIQ  155



>ref|XP_008229890.1| PREDICTED: heat shock protein 90-1 [Prunus mume]
Length=813

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +1

Query  301  RCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
            R E++A A   + E   E   YQAEV+RL+DLIV+SLYS+KE+FLREL+SNASDALDKLR
Sbjct  75   RFESTAAASDASAEPPAERFEYQAEVNRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  134

Query  481  FLGVTEPSLLGDAGELQIRIK  543
            FL VTEP LL   G+L IRI+
Sbjct  135  FLSVTEPDLLKGGGDLDIRIQ  155



>ref|XP_001441660.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK74263.1| unnamed protein product [Paramecium tetraurelia]
Length=523

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  286  SSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDA  465
            S V V  +     +K+  E   ETH +QAE  RL+D++++SLY+ KEIFLREL+SNA+DA
Sbjct  17   SGVQVMTQDLTDEQKKLLEQSQETHEFQAETGRLMDILINSLYTQKEIFLRELISNAADA  76

Query  466  LDKLRFLGVTEPSLLGDAGELQIRIK  543
            LDKLRFL V  P +LGD  EL IRI+
Sbjct  77   LDKLRFLSVRNPEILGDKTELAIRIE  102



>ref|XP_004140007.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN46596.1| hypothetical protein Csa_6G111370 [Cucumis sativus]
Length=791

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +1

Query  241  RLSSSGLKWKLERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSH  420
            +L S+    +L  + +  + R E++A A   +     E + YQAEVSRL+DLIV+SLYS+
Sbjct  58   QLDSAKPSSQLNLKHTFSLARFESTATASDASATPPVEKYEYQAEVSRLMDLIVNSLYSN  117

Query  421  KEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            KE+FLREL+SNASDALDKLRFL VT+  LL +A +  IRI+
Sbjct  118  KEVFLRELISNASDALDKLRFLSVTDSGLLKEAVDFDIRIQ  158



>ref|XP_004169550.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
Length=791

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +1

Query  241  RLSSSGLKWKLERRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSH  420
            +L S+    +L  + +  + R E++A A   +     E + YQAEVSRL+DLIV+SLYS+
Sbjct  58   QLDSAKPSSQLNLKHTFSLARFESTATASDASATPPVEKYEYQAEVSRLMDLIVNSLYSN  117

Query  421  KEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            KE+FLREL+SNASDALDKLRFL VT+  LL +A +  IRI+
Sbjct  118  KEVFLRELISNASDALDKLRFLSVTDSGLLKEAVDFDIRIQ  158



>emb|CDY22132.1| BnaC01g39690D [Brassica napus]
Length=804

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR+L VT+P L  DA +L 
Sbjct  99   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDPDLSKDAADLD  158

Query  532  IRI  540
            IRI
Sbjct  159  IRI  161



>ref|XP_009124159.1| PREDICTED: heat shock protein 90-1-like isoform X1 [Brassica 
rapa]
Length=802

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR+L VT+P L  DA +L 
Sbjct  99   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDPDLSKDAADLD  158

Query  532  IRI  540
            IRI
Sbjct  159  IRI  161



>ref|XP_009124162.1| PREDICTED: heat shock protein 90-1-like isoform X2 [Brassica 
rapa]
Length=799

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR+L VT+P L  DA +L 
Sbjct  96   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDPDLSKDAADLD  155

Query  532  IRI  540
            IRI
Sbjct  156  IRI  158



>ref|WP_043392274.1| heat shock protein 90 [Cystobacter violaceus]
 gb|KFA93368.1| heat shock protein 90 [Cystobacter violaceus Cb vi76]
Length=657

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            ETH +QAE+++LL+L+++SLYSHKEIFLRELVSNASDALDKLRF  VTEP LL  A EL+
Sbjct  8    ETHKFQAEINQLLNLVINSLYSHKEIFLRELVSNASDALDKLRFRSVTEPELLEGASELE  67

Query  532  IRI  540
            IR+
Sbjct  68   IRL  70



>gb|EFA78289.1| heat shock protein Hsp90 family protein [Polysphondylium pallidum 
PN500]
Length=822

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 76/114 (67%), Gaps = 9/114 (8%)
 Frame = +1

Query  223  RNGLRNRLSSSGLKWKLERRDSSVV------VRCEASAVAEKEAPESEGETHGYQAEVSR  384
            R  L+  L   G K  L+  DS VV      ++ E  +VAE++  E + E   +QAEV++
Sbjct  33   RETLKVDLDMKGPKVPLQT-DSEVVQRENEAIKSEGFSVAEQQFIEEQSEKFKFQAEVNK  91

Query  385  LLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLL--GDAGELQIRI  540
            L+++I++SLYS KEIFLREL+SNASDALDK+RFL +T PSLL  GD   L IRI
Sbjct  92   LMNIIINSLYSKKEIFLRELISNASDALDKIRFLALTNPSLLGEGDQANLDIRI  145



>gb|KHN46925.1| Heat shock protein 90 [Glycine soja]
Length=793

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  HGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIR  537
            + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLRFL VTEP LL +A +  IR
Sbjct  97   YEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPGLLKEAVDFDIR  156

Query  538  IK  543
            I+
Sbjct  157  IQ  158



>ref|XP_010684690.1| PREDICTED: heat shock protein 83-like [Beta vulgaris subsp. vulgaris]
Length=766

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +1

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            D   + R   S  A  ++  +  E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASD
Sbjct  62   DFMTMARRYESTAAASDSSGAPVEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASD  121

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VT+P L  D+ +L IRI+
Sbjct  122  ALDKLRFLSVTQPELSKDSVDLDIRIQ  148



>ref|WP_002614951.1| heat shock protein 90 [Stigmatella aurantiaca]
 gb|EAU65744.1| albxxii protein [Stigmatella aurantiaca DW4/3-1]
 gb|ADO74513.1| Chaperone protein HtpG [Stigmatella aurantiaca DW4/3-1]
Length=639

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  340  ESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDA  519
            E+  ETH +QAE+++LL L+++SLYSHKEIFLRELVSNASDALDKLRF  +TEP LLG+ 
Sbjct  4    ETPRETHSFQAEINQLLHLVINSLYSHKEIFLRELVSNASDALDKLRFRAITEPELLGEQ  63

Query  520  GELQIRI  540
              L+I I
Sbjct  64   SALEIHI  70



>ref|XP_010665948.1| PREDICTED: heat shock protein 83 [Beta vulgaris subsp. vulgaris]
Length=787

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +1

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            D   + R   S  A  ++  +  E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASD
Sbjct  62   DFMTMARRYESTAAASDSSGAPVEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASD  121

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDKLRFL VT+P L  D+ +L IRI+
Sbjct  122  ALDKLRFLSVTQPELSKDSVDLDIRIQ  148



>ref|WP_002643356.1| Chaperone protein HtpG [Cystobacter fuscus]
 gb|EPX58852.1| Chaperone protein HtpG [Cystobacter fuscus DSM 2262]
Length=659

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  340  ESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDA  519
            +S+ ETH +QAE+++LL+L+++SLYSHKEIFLRELVSNASDALDKLRF  VTEP LLG  
Sbjct  4    DSQRETHHFQAEINQLLNLVINSLYSHKEIFLRELVSNASDALDKLRFRSVTEPELLGGE  63

Query  520  GELQIRI  540
              L+I I
Sbjct  64   SALEIHI  70



>tpg|DAA46735.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=411

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 87/146 (60%), Gaps = 14/146 (10%)
 Frame = +1

Query  145  VPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKW--KLERR---------DSS  291
            VP + SF QK +   R A    AF  +  +    SS  L    K+E +           S
Sbjct  113  VPLSKSFAQKVSSEARKAVELKAFTKKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDS  172

Query  292  VVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALD  471
             V + EA +++ K    S  E   +QAEVSRL+D+I++SLY++K+IFLREL+SNASDALD
Sbjct  173  KVAQSEAESISRK-TLRSSAEKFEFQAEVSRLMDIIINSLYNNKDIFLRELISNASDALD  231

Query  472  KLRFLGVTEPSLL--GDAGELQIRIK  543
            K+RFL +T+  +L  GD  +L+I+IK
Sbjct  232  KIRFLSLTDKEVLGEGDTAKLEIQIK  257



>ref|XP_003545075.2| PREDICTED: heat shock protein 83-like [Glycine max]
Length=797

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  HGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIR  537
            + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLRFL VTEP LL +A +  IR
Sbjct  97   YEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPGLLKEAVDFDIR  156

Query  538  IK  543
            I+
Sbjct  157  IQ  158



>ref|WP_008221881.1| heat shock protein 90 [Rheinheimera nanhaiensis]
 dbj|GAB59357.1| molecular chaperone HtpG [Rheinheimera nanhaiensis E407-8]
Length=644

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGE  525
            + +THG+QAEV +LL L++HSLYS+KEIFLRELVSNASDA DKLRFL +++ +L GD GE
Sbjct  11   QKQTHGFQAEVKQLLQLMIHSLYSNKEIFLRELVSNASDAADKLRFLALSDGNLYGDDGE  70

Query  526  LQIRI  540
            L++RI
Sbjct  71   LRVRI  75



>ref|XP_011085393.1| PREDICTED: heat shock protein 83 [Sesamum indicum]
Length=796

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 79/134 (59%), Gaps = 6/134 (4%)
 Frame = +1

Query  148  PFTPSFP--QKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERRDSSVVVRCEASAV  321
            P + SFP     AG N       + L   G  N +  + L      ++  VV R   S  
Sbjct  22   PLSSSFPLDHHLAGQNDTTKRWCSVL-TTGTSNGIGDTKL---FNMKNGPVVGRRFESTA  77

Query  322  AEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEP  501
            A  +A     E   YQAEVSRL+DLIV+SLYS+K++FLREL+SNASDALDKLRFL VT+P
Sbjct  78   AASDASSPPAEKFEYQAEVSRLMDLIVNSLYSNKDVFLRELISNASDALDKLRFLSVTDP  137

Query  502  SLLGDAGELQIRIK  543
             LL D  +L IRI+
Sbjct  138  QLLTDGVDLDIRIQ  151



>ref|WP_027669870.1| heat shock protein 90 [Rheinheimera baltica]
Length=644

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  EGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGE  525
            + +THG+QAEV +LL L++HSLYS+KEIFLRELVSNASDA DKLRFL +++ SL GD G+
Sbjct  11   QKQTHGFQAEVKQLLQLMIHSLYSNKEIFLRELVSNASDAADKLRFLALSDGSLYGDDGD  70

Query  526  LQIRI  540
            L++RI
Sbjct  71   LRVRI  75



>ref|XP_010547210.1| PREDICTED: heat shock protein 83-like isoform X2 [Tarenaya hassleriana]
Length=797

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +1

Query  301  RCEASAVAEKEAPESE--GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDK  474
            R E++A A+  + ++    E   YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDK
Sbjct  77   RNESTAAAQDSSSQAPPPAEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDK  136

Query  475  LRFLGVTEPSLLGDAGELQIRI  540
            LR+L V +P LL D+ +L IRI
Sbjct  137  LRYLSVMQPELLKDSVDLDIRI  158



>ref|XP_003617952.1| Heat-shock protein [Medicago truncatula]
Length=797

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = +1

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEV-----SRLLDLIVHSLYSHKEIFLRE  441
            +RD  +  R E++A           E   YQAEV     SRL+DLIV+SLYS+KE+FLRE
Sbjct  65   KRDLFLGKRYESTAAESNATSSPPAEKFEYQAEVLPSFVSRLMDLIVNSLYSNKEVFLRE  124

Query  442  LVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            L+SNASDALDKLRFL VTEP L+ DA +  IRI+
Sbjct  125  LISNASDALDKLRFLSVTEPDLMKDAIDFDIRIQ  158



>ref|XP_010547208.1| PREDICTED: heat shock protein 90-1-like isoform X1 [Tarenaya 
hassleriana]
Length=798

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +1

Query  301  RCEASAVAEKEAPESE--GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDK  474
            R E++A A+  + ++    E   YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDK
Sbjct  77   RNESTAAAQDSSSQAPPPAEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDK  136

Query  475  LRFLGVTEPSLLGDAGELQIRI  540
            LR+L V +P LL D+ +L IRI
Sbjct  137  LRYLSVMQPELLKDSVDLDIRI  158



>emb|CBI28422.3| unnamed protein product [Vitis vinifera]
Length=871

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 82/142 (58%), Gaps = 9/142 (6%)
 Frame = +1

Query  136  VAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERRDSSVVVRCEAS  315
             A  P TP+ P   + G   A LR   +  +G  +   +S    +L  R+  ++     S
Sbjct  93   TAPAPITPASPFNDSVGQNDAKLRWYSVLASGRSDAGRNST---QLNLRNGLLLGNRYES  149

Query  316  AVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV------SNASDALDKL  477
              A  +A +   E   YQAEVSRL+DLIVHSLYS+KE+FLREL+       NASDALDKL
Sbjct  150  TAAASDASDPPAEKFEYQAEVSRLMDLIVHSLYSNKEVFLRELIRHVTSYYNASDALDKL  209

Query  478  RFLGVTEPSLLGDAGELQIRIK  543
            RFL VTEP LL D  +L IRI+
Sbjct  210  RFLSVTEPQLLKDGLDLDIRIQ  231



>tpg|DAA46734.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=377

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 87/146 (60%), Gaps = 14/146 (10%)
 Frame = +1

Query  145  VPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKW--KLERR---------DSS  291
            VP + SF QK +   R A    AF  +  +    SS  L    K+E +           S
Sbjct  113  VPLSKSFAQKVSSEARKAVELKAFTKKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDS  172

Query  292  VVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALD  471
             V + EA +++ K    S  E   +QAEVSRL+D+I++SLY++K+IFLREL+SNASDALD
Sbjct  173  KVAQSEAESISRK-TLRSSAEKFEFQAEVSRLMDIIINSLYNNKDIFLRELISNASDALD  231

Query  472  KLRFLGVTEPSLL--GDAGELQIRIK  543
            K+RFL +T+  +L  GD  +L+I+IK
Sbjct  232  KIRFLSLTDKEVLGEGDTAKLEIQIK  257



>ref|XP_006407799.1| hypothetical protein EUTSA_v10020096mg [Eutrema salsugineum]
 gb|ESQ49252.1| hypothetical protein EUTSA_v10020096mg [Eutrema salsugineum]
Length=799

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  349  GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGEL  528
             E   YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR+L VT P L  DA +L
Sbjct  95   AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPELSKDAADL  154

Query  529  QIRI  540
             IRI
Sbjct  155  DIRI  158



>ref|XP_009147028.1| PREDICTED: heat shock protein 90-1-like [Brassica rapa]
Length=802

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR+L VT P L  D  +L 
Sbjct  98   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPELSKDVADLD  157

Query  532  IRI  540
            IRI
Sbjct  158  IRI  160



>ref|WP_013938260.1| heat shock protein 90 [Myxococcus fulvus]
 gb|ACJ66689.1| HtpG [Myxococcus fulvus HW-1]
 gb|AEI65109.1| heat shock protein 90 [Myxococcus fulvus HW-1]
Length=652

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            ETH +QAE+++LL L+++SLYSHKEIFLRELVSNASDALDKLRF  +TEP LL D   L+
Sbjct  10   ETHAFQAEINQLLSLVINSLYSHKEIFLRELVSNASDALDKLRFRAITEPELLADEPALE  69

Query  532  IRI  540
            +R+
Sbjct  70   LRL  72



>emb|CDY35962.1| BnaA05g29880D [Brassica napus]
Length=803

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E + YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR+L VT P L  D  +L 
Sbjct  98   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPELSKDVADLD  157

Query  532  IRI  540
            IRI
Sbjct  158  IRI  160



>ref|WP_011556000.1| heat shock protein 90 [Myxococcus xanthus]
 sp|Q1CZI7.1|HTPG_MYXXD RecName: Full=Chaperone protein HtpG; AltName: Full=Heat shock 
protein HtpG; AltName: Full=High temperature protein G [Myxococcus 
xanthus DK 1622]
 gb|ABF89090.1| chaperone protein HtpG [Myxococcus xanthus DK 1622]
Length=654

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            ETH +QAE+++LL L+++SLYSHKEIFLRELVSNASDALDKLRF  +TEP LL D   L+
Sbjct  10   ETHAFQAEINQLLSLVINSLYSHKEIFLRELVSNASDALDKLRFRAITEPELLADEPALE  69

Query  532  IRI  540
            +R+
Sbjct  70   LRL  72



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 3/83 (4%)
 Frame = +1

Query  304  CEASAVAEKEAPESEG-ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLR  480
             +A AV  K+    EG E H +QAEVSRL+D+I++SLYS+K+IFLREL+SN SD+LDK+R
Sbjct  31   VDAPAVNHKDKAFKEGAEQHEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIR  90

Query  481  FLGVTEPSLL--GDAGELQIRIK  543
            FL +T+ SLL  GD   L+IRIK
Sbjct  91   FLALTDESLLGVGDDANLEIRIK  113



>tpg|DAA34121.1| TPA_exp: endoplasmic reticulum glucose-regulated protein [Amblyomma 
variegatum]
Length=207

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%), Gaps = 6/95 (6%)
 Frame = +1

Query  277  RRDSSVV------VRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLR  438
            R D  VV      ++ +   VA+ +    + E H +QAEV+R++ LI++SLY +KEIFLR
Sbjct  43   RTDDQVVEREEEAIKLDGLNVAQMKEMREKAEKHAFQAEVTRMMKLIINSLYRNKEIFLR  102

Query  439  ELVSNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
            EL+SNASDALDK+R L +T P +L    EL IR+K
Sbjct  103  ELISNASDALDKIRLLSLTNPDVLNSNPELTIRVK  137



>ref|WP_002635883.1| heat shock protein 90 [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK90153.1| Chaperone protein HtpG [Myxococcus sp. (contaminant ex DSM 436)]
Length=651

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            ETH +QAE+++LL L+++SLYSHKEIFLRELVSNASDALDKLRF  +TEP LL D   L+
Sbjct  10   ETHAFQAEINQLLSLVINSLYSHKEIFLRELVSNASDALDKLRFRAITEPELLADEPALE  69

Query  532  IRI  540
            +R+
Sbjct  70   LRL  72



>ref|XP_005643869.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE19325.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=717

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 6/80 (8%)
 Frame = +1

Query  304  CEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRF  483
            C A+A   KE      ET  YQAEV RL+DLIV+SLYS++E+FLRELVSNASDALDKLRF
Sbjct  4    CAAAATETKE------ETFTYQAEVDRLMDLIVNSLYSNREVFLRELVSNASDALDKLRF  57

Query  484  LGVTEPSLLGDAGELQIRIK  543
            L +T+ S++     ++IRIK
Sbjct  58   LSLTDSSVMAGEDAMEIRIK  77



>ref|WP_031571687.1| heat shock protein 90 [Rheinheimera texasensis]
Length=640

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  343  SEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAG  522
            ++ +THG+QAEV +LL L++HSLYS+KEIFLREL+SNASDA DKLRFL +++ SL G+ G
Sbjct  5    TQKQTHGFQAEVKQLLQLMIHSLYSNKEIFLRELISNASDAADKLRFLALSDSSLYGNDG  64

Query  523  ELQIRI  540
            +L++R+
Sbjct  65   DLRVRV  70



>ref|WP_043419882.1| heat shock protein 90, partial [Streptomyces pluripotens]
 gb|KIE32090.1| heat shock protein 90, partial [Streptomyces pluripotens]
Length=180

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E   +QAEV +LL L++HSLYS+KEIFLRELVSNASDA+DKLRF G+  PSLL   GEL 
Sbjct  6    EKMAFQAEVKQLLHLMIHSLYSNKEIFLRELVSNASDAVDKLRFEGIANPSLLEGGGELG  65

Query  532  IRI  540
            IRI
Sbjct  66   IRI  68



>gb|AAG21337.1|AF273735_1 hypothetical esophageal gland cell secretory protein 8 [Heterodera 
glycines]
Length=157

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 76/136 (56%), Gaps = 12/136 (9%)
 Frame = +1

Query  154  TPSFPQKSAGGNRVAALRSAF------LPRNGLRNRLSSSGLKWKLERRDSSVVVRCEAS  315
            +P+F     G + V A           +P+NG+        ++W+ E       ++ E  
Sbjct  21   SPNFSTADKGVDAVDAXDEIIDDPKVEVPKNGVGKGTDDQTVQWEEE------AIKLEGL  74

Query  316  AVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVT  495
            +VAE +      E H +QAEV+R++ LI++SLY +KEIFLREL+SNASDAL K+R + +T
Sbjct  75   SVAEFKQLRESAEKHQFQAEVNRMVKLIINSLYRNKEIFLRELISNASDALXKIRLISLT  134

Query  496  EPSLLGDAGELQIRIK  543
              + L    EL I+IK
Sbjct  135  NSTALAATEELSIKIK  150



>pdb|3PEH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 
From Plasmodium Falciparum, Pfl1070c In The Presence Of A 
Thienopyrimidine Derivative
 pdb|3PEH|B Chain B, Crystal Structure Of The N-Terminal Domain Of An Hsp90 
From Plasmodium Falciparum, Pfl1070c In The Presence Of A 
Thienopyrimidine Derivative
 pdb|3PEJ|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 
From Plasmodium Falciparum, Pfl1070c In The Presence Of Macbecin
 pdb|3PEJ|B Chain B, Crystal Structure Of The N-Terminal Domain Of An Hsp90 
From Plasmodium Falciparum, Pfl1070c In The Presence Of Macbecin
Length=281

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  331  EAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLL  510
            + P    E+H YQ EV+RL+D+IV+SLY+ KE+FLREL+SNA+DAL+K+RFL +++ S+L
Sbjct  17   QGPTESMESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVL  76

Query  511  GDAGELQIRI  540
            G+  +L+IRI
Sbjct  77   GEEKKLEIRI  86



>emb|CDY28017.1| BnaC05g44190D [Brassica napus]
Length=787

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E   YQAEVSRLLDLIV+SLYS+KE+FLR L+SNASDALDKLR+L VT+P L  DA +L 
Sbjct  98   EKFEYQAEVSRLLDLIVNSLYSNKEVFLRALISNASDALDKLRYLSVTDPELSKDAADLD  157

Query  532  IRI  540
            IRI
Sbjct  158  IRI  160



>dbj|GAM27457.1| hypothetical protein SAMD00019534_106330 [Acytostelium subglobosum 
LB1]
Length=821

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 68/94 (72%), Gaps = 8/94 (9%)
 Frame = +1

Query  283  DSSVV------VRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLREL  444
            DS VV      ++ E  +VAE++  +   E   +QAEV++L+++I++SLYS KEIFLREL
Sbjct  52   DSEVVQRENEAIKSEGYSVAEQKLIQENAEKFTFQAEVNKLMNIIINSLYSKKEIFLREL  111

Query  445  VSNASDALDKLRFLGVTEPSLLGDAGE--LQIRI  540
            +SNASDALDK+RFL +T P+LLGD  +  L IRI
Sbjct  112  ISNASDALDKIRFLALTNPALLGDGDQSKLDIRI  145



>gb|AAT97075.1| tumor rejection antigen-like protein [Lymnaea stagnalis]
Length=141

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  AVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVT  495
            +VA+ +    + E   +QAEV+R++ LI++SLY +KEIFLREL+SNASDALDK+RFL +T
Sbjct  64   SVAQMKELRDKSEKFQFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLT  123

Query  496  EPSLLGDAGELQIRIK  543
            +P+ L    EL I+IK
Sbjct  124  DPNALTATDELTIKIK  139



>ref|XP_008660989.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=209

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 67/89 (75%), Gaps = 4/89 (4%)
 Frame = +1

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            DS V  R EA +++ K    S  E   +QAEVSRL+D+I++SLYS+K+IFLREL+SNASD
Sbjct  22   DSEVAQR-EAESISRK-TLRSSIEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD  79

Query  463  ALDKLRFLGVTEPSLL--GDAGELQIRIK  543
            ALDK+RFL +T+  +L  GD  +L+I+IK
Sbjct  80   ALDKIRFLSLTDKEVLGEGDTAKLEIQIK  108



>ref|XP_001458509.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK91112.1| unnamed protein product [Paramecium tetraurelia]
Length=842

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  286  SSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDA  465
            S V V  +     +K+  E   ETH +QAE  RL+D++++SLY+ KEIFLREL+SNA+DA
Sbjct  17   SGVQVMTQDLTDEQKKLLEQSQETHEFQAETGRLMDILINSLYTQKEIFLRELISNAADA  76

Query  466  LDKLRFLGVTEPSLLGDAGELQIRIK  543
            LDKLRFL V  P +LGD  EL IRI+
Sbjct  77   LDKLRFLSVRNPEILGDKTELAIRIE  102



>gb|KFK38234.1| hypothetical protein AALP_AA3G086500 [Arabis alpina]
Length=801

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  349  GETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGEL  528
             E   YQAEVSRL+DLIV+SLYS+KE+FLREL+SNASDALDKLR+L VT+P L  D+  L
Sbjct  94   AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDPELSKDSPNL  153

Query  529  QIRI  540
             IRI
Sbjct  154  DIRI  157



>ref|XP_001439907.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK72510.1| unnamed protein product [Paramecium tetraurelia]
Length=849

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  286  SSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDA  465
            S V V  +     +K+  E   ETH +QAE  RL+D++++SLY+ KEIFLREL+SNA+DA
Sbjct  17   SGVQVMTQDLTDEQKKLLEQSQETHEFQAETGRLMDILINSLYTQKEIFLRELISNAADA  76

Query  466  LDKLRFLGVTEPSLLGDAGELQIRIK  543
            LDKLRFL V  P +LGD  EL IRI+
Sbjct  77   LDKLRFLSVRNPEILGDKTELAIRIE  102



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +1

Query  289  SVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDAL  468
            S V + EA +++ K +  S  E   +QAEVSRL+D+I+HSLYS+K+IFLREL+SNASDAL
Sbjct  58   SDVAKREAESIS-KRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDAL  116

Query  469  DKLRFLGVTEPSLL--GDAGELQIRIK  543
            DK+RFL +T+  +L  GD   LQI+IK
Sbjct  117  DKIRFLALTDKEVLGEGDDTNLQIQIK  143



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  334  APESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLG  513
            AP+   E   +QAEV+RL+D+++HSLYS+KEIFLREL+SNA+DALDK+RFL +T+   LG
Sbjct  47   APKEGAEKFTFQAEVNRLMDILIHSLYSNKEIFLRELISNAADALDKIRFLSLTDKGQLG  106

Query  514  DAGELQIRIK  543
            +  +L+IR+K
Sbjct  107  ETSDLEIRVK  116



>ref|XP_001432500.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK65103.1| unnamed protein product [Paramecium tetraurelia]
Length=790

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  286  SSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDA  465
            S V V  +     +K+  E   ETH +QAE  RL+D++++SLY+ KEIFLREL+SNA+DA
Sbjct  40   SGVQVMTQDLTEEQKKLLEQSQETHEFQAETGRLMDILINSLYTQKEIFLRELISNAADA  99

Query  466  LDKLRFLGVTEPSLLGDAGELQIRIK  543
            LDK+RFL V  P +LGD  EL IRI+
Sbjct  100  LDKIRFLSVKNPEILGDKTELAIRIE  125



>ref|XP_001899398.1| Endoplasmin precursor [Brugia malayi]
 emb|CDQ00792.1| Protein Bm5584, isoform b [Brugia malayi]
Length=789

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 56/147 (38%), Positives = 86/147 (59%), Gaps = 2/147 (1%)
 Frame = +1

Query  103  MAPVMSRSLTSVAAVPFTPSFPQKSAGGNRVAALRSAFLPRNGLRNRLSSSGLKWKLERR  282
            MA   +  L     V F  +F   +    +V +   A +  N  R + SS   +  ++R 
Sbjct  1    MASNCAARLIVFIGVFFVLAFFPNTGVNAKVESNSEATVKENIGRIKTSSKTDEEVIQRE  60

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            + ++  + +  +VAE +      E H +QAEV+R++ LI++SLY +KEIFLREL+SNASD
Sbjct  61   EEAI--KLDGLSVAEMKELRIRAEKHSFQAEVNRMMKLIINSLYKNKEIFLRELISNASD  118

Query  463  ALDKLRFLGVTEPSLLGDAGELQIRIK  543
            ALDK+R L +T+PS+L    EL +RIK
Sbjct  119  ALDKIRLLSLTDPSVLSATDELSVRIK  145



>ref|WP_014399372.1| heat shock protein 90 [Corallococcus coralloides]
 gb|AFE09096.1| heat shock protein 90 [Corallococcus coralloides DSM 2259]
Length=650

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            ETH +QAE+ +LL L+++SLYSH+EIFLRELVSNASDALDKLRF  +TEP LL D   L+
Sbjct  10   ETHSFQAEIQQLLSLVINSLYSHQEIFLRELVSNASDALDKLRFRSITEPELLKDEPALE  69

Query  532  IRI  540
            +RI
Sbjct  70   LRI  72



>ref|XP_008814600.1| heat shock protein 90kDa beta [Plasmodium inui San Antonio 1]
 gb|EUD69074.1| heat shock protein 90kDa beta [Plasmodium inui San Antonio 1]
Length=814

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 51/119 (43%), Positives = 80/119 (67%), Gaps = 6/119 (5%)
 Frame = +1

Query  193  VAALRSAFLPRNGLRNRLSSSGLKWKLERRDSSVVVRCEASAVAE---KEAPESEGETHG  363
            + AL  +++PRN   N L  S  + K+E   S   ++ +  ++ E    E P S  E H 
Sbjct  13   IGALLPSWVPRN--FNVLCESN-EGKVEDNGSKEEIKKDTDSIPEISDNEKPTSGIEQHQ  69

Query  364  YQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRI  540
            YQ EV+RL+D+IV+SLY+ KE+FLREL+SNA+DAL+K+RF+ +++  +LG+  +L+IRI
Sbjct  70   YQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFMSLSDEKVLGEEKKLEIRI  128



>ref|WP_044528292.1| heat shock protein 90, partial [Herbaspirillum sp. B65]
Length=130

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  343  SEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAG  522
            SE +T G+QAEV +LL L++HSLYS+KEIFLRELVSNASDA DKLRF  +   SL  D  
Sbjct  3    SEKQTMGFQAEVKQLLQLMIHSLYSNKEIFLRELVSNASDAADKLRFEAINNGSLFEDDP  62

Query  523  ELQIRI  540
            EL+I+I
Sbjct  63   ELKIKI  68



>ref|WP_034783035.1| heat shock protein 90, partial [Exiguobacterium mexicanum]
 gb|KGI83576.1| heat shock protein 90, partial [Exiguobacterium mexicanum]
Length=151

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            ET G+Q+EV +LL L++HSLYS+KEIFLREL+SNASDA DKLRF  +++P L  + GEL+
Sbjct  8    ETRGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAADKLRFRALSKPELYENDGELR  67

Query  532  IRI  540
            +RI
Sbjct  68   VRI  70



>dbj|BAD94659.1| HSP90-like protein [Arabidopsis thaliana]
Length=328

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = +1

Query  283  DSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASD  462
            DS VV R   S    K+   S  E   +QAEVSRL+D+I++SLYS+K+IFLREL+SNASD
Sbjct  56   DSDVVHR--ESESMSKKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD  113

Query  463  ALDKLRFLGVTEPSLL--GDAGELQIRIK  543
            ALDK+RFL +T+  +L  GD  +L+I+IK
Sbjct  114  ALDKIRFLALTDKDVLGEGDTAKLEIQIK  142



>ref|WP_035460329.1| heat shock protein 90 [Alcanivorax sp. 97CO-5]
 gb|EUC70451.1| heat shock protein 90 [Alcanivorax sp. 97CO-5]
Length=615

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  SEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAG  522
            +E +THG+QAEVSRLL L++HSLYS++EIFLREL+SNASDA DKLRF  +  P+LL   G
Sbjct  3    AEKQTHGFQAEVSRLLHLMIHSLYSNREIFLRELISNASDACDKLRFEALDNPALLEQGG  62

Query  523  ELQIRIK  543
            E QI ++
Sbjct  63   EPQITLR  69



>emb|CDR16821.1| endoplasmin, putative [Plasmodium chabaudi chabaudi]
Length=806

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  313  SAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGV  492
            S + E E P S  E H YQ+EV+RLLD+I++SLY+ K++F+REL+SNA+DAL+K+RFL +
Sbjct  58   SEIDENEKPTSGIENHQYQSEVTRLLDIIINSLYTQKDVFMRELISNAADALEKIRFLSL  117

Query  493  TEPSLLGDAGELQIRI  540
            ++ S+L D  +L+IRI
Sbjct  118  SDESVLNDEKKLEIRI  133



>ref|XP_007049299.1| Heat shock protein 89.1 isoform 1 [Theobroma cacao]
 gb|EOX93456.1| Heat shock protein 89.1 isoform 1 [Theobroma cacao]
Length=814

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 64/100 (64%), Gaps = 19/100 (19%)
 Frame = +1

Query  301  RCEASAVAEKEA--PESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELV---------  447
            R E++A A   A  P    E + YQAEVSRL+DLIV+SLYS+KE+FLREL+         
Sbjct  76   RYESTAAASDSANQPPPPAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELIRHVLGSHLS  135

Query  448  --------SNASDALDKLRFLGVTEPSLLGDAGELQIRIK  543
                     NASDALDKLR+L VTEP LL DA +L IRI+
Sbjct  136  ILGYIKLPCNASDALDKLRYLSVTEPQLLKDAVDLNIRIQ  175



>ref|XP_005823214.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
 gb|EKX36234.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
Length=839

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = +1

Query  316  AVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVT  495
            +  EK+A E  G+   +QAEV RL+D+I++SLYS KEIFLREL+SNASDALDK+RFL +T
Sbjct  59   SAEEKKALEQGGQKQEFQAEVGRLMDIIINSLYSKKEIFLRELISNASDALDKIRFLSLT  118

Query  496  EPSLL--GDAGELQIRIK  543
            +P +L  GD  +L+IRI+
Sbjct  119  DPKVLGEGDQSKLEIRIE  136



>ref|WP_011588770.1| heat shock protein 90 [Alcanivorax borkumensis]
 sp|Q0VPG1.1|HTPG_ALCBS RecName: Full=Chaperone protein HtpG; AltName: Full=Heat shock 
protein HtpG; AltName: Full=High temperature protein G [Alcanivorax 
borkumensis SK2]
 emb|CAL16937.1| heat shock protein HtpG [Alcanivorax borkumensis SK2]
 dbj|BAP14391.1| heat shock protein 90 [Alcanivorax sp. NBRC 101098]
Length=615

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  SEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAG  522
            +E +THG+QAEVSRLL L++HSLYS++EIFLREL+SNASDA DKLRF  +  P+LL   G
Sbjct  3    AEKQTHGFQAEVSRLLHLMIHSLYSNREIFLRELISNASDACDKLRFEALDNPALLEQGG  62

Query  523  ELQIRIK  543
            E QI ++
Sbjct  63   EPQITLR  69



>ref|WP_006030487.1| heat shock protein 90 [Moritella sp. PE36]
 gb|EDM68606.1| chaperone protein htpG [Moritella sp. PE36]
Length=636

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            ETHG+QAEV +LL L++HSLYS+KEIFLRELVSNA+DA DKLRF  +++ SL GD GEL+
Sbjct  8    ETHGFQAEVKQLLKLMIHSLYSNKEIFLRELVSNAADAADKLRFKALSDNSLYGDDGELR  67

Query  532  IRI  540
            +RI
Sbjct  68   VRI  70



>gb|EPN64930.1| heat shock protein 90, partial [Pseudomonas syringae pv. actinidiae 
ICMP 19096]
Length=147

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  340  ESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDA  519
            E++ ET G+Q EV +LL L++HSLYS+KEIFLREL+SNASDA+DKLRF  ++ P LL   
Sbjct  6    ETQKETLGFQTEVKQLLHLMIHSLYSNKEIFLRELISNASDAVDKLRFEALSTPELLEGG  65

Query  520  GELQIRI  540
             EL+IR+
Sbjct  66   AELKIRV  72



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 3/87 (3%)
 Frame = +1

Query  289  SVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDAL  468
            S VV+ E+ ++  K    S  E   +QAEVSRL+D+I+HSLYS+K+IFLREL+SNASDAL
Sbjct  68   SEVVKRESESMTSKNL-RSNAEKFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDAL  126

Query  469  DKLRFLGVTEPSLL--GDAGELQIRIK  543
            DK+RFL +T+ S+L  GD  +L I IK
Sbjct  127  DKIRFLSLTDSSVLGEGDDAKLDIHIK  153



>ref|WP_027073502.1| heat shock protein 90 [Mannheimia granulomatis]
Length=627

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            ETHG+Q+EV +LL L++HSLYS+KEIFLREL+SNASDA DKLRF  ++EPSL    GEL+
Sbjct  6    ETHGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAADKLRFKALSEPSLYEGDGELR  65

Query  532  IRI  540
            +R+
Sbjct  66   VRV  68



>ref|XP_739675.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 emb|CAH87371.1| hypothetical protein PC302432.00.0 [Plasmodium chabaudi chabaudi]
Length=122

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 60/80 (75%), Gaps = 5/80 (6%)
 Frame = +1

Query  277  RRDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNA  456
            +RD  ++     S + E E P S  E H YQ+EV+RLLD+I++SLY+ K++F+REL+SNA
Sbjct  46   KRDVDMI-----SEIDENEKPTSGIENHQYQSEVTRLLDIIINSLYTQKDVFMRELISNA  100

Query  457  SDALDKLRFLGVTEPSLLGD  516
            +DAL+K+RFL +++ S+L D
Sbjct  101  ADALEKIRFLSLSDESVLND  120



>ref|XP_001350620.1| endoplasmin homolog precursor, putative [Plasmodium falciparum 
3D7]
 gb|AAN36300.1|AE014847_27 endoplasmin homolog precursor, putative [Plasmodium falciparum 
3D7]
 gb|ETW17599.1| hypothetical protein PFFVO_03482 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW30020.1| hypothetical protein PFFCH_02514 [Plasmodium falciparum FCH/4]
 gb|ETW33075.1| hypothetical protein PFTANZ_06206 [Plasmodium falciparum Tanzania 
(2000708)]
 gb|ETW41618.1| hypothetical protein PFNF135_04028 [Plasmodium falciparum NF135/5.C10]
 gb|ETW48200.1| hypothetical protein PFMALIP_03768 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW55901.1| hypothetical protein PFUGPA_01946 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW60253.1| hypothetical protein PFMC_03797 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR68694.1| hypothetical protein PFBG_03925 [Plasmodium falciparum 7G8]
 gb|EUT82491.1| hypothetical protein PFAG_03867 [Plasmodium falciparum Santa 
Lucia]
 gb|EWC87645.1| hypothetical protein PFNF54_03770 [Plasmodium falciparum NF54]
Length=821

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 48/98 (49%), Positives = 71/98 (72%), Gaps = 8/98 (8%)
 Frame = +1

Query  250  SSGLKWKLER-RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKE  426
            SSG K +++R RD+          + E E P    E+H YQ EV+RL+D+IV+SLY+ KE
Sbjct  45   SSGEKKEVKRDRDT-------LEEIEEGEKPTESMESHQYQTEVTRLMDIIVNSLYTQKE  97

Query  427  IFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRI  540
            +FLREL+SNA+DAL+K+RFL +++ S+LG+  +L+IRI
Sbjct  98   VFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRI  135



>gb|EWC75399.1| hypothetical protein C923_03940 [Plasmodium falciparum UGT5.1]
Length=821

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 48/98 (49%), Positives = 71/98 (72%), Gaps = 8/98 (8%)
 Frame = +1

Query  250  SSGLKWKLER-RDSSVVVRCEASAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKE  426
            SSG K +++R RD+          + E E P    E+H YQ EV+RL+D+IV+SLY+ KE
Sbjct  45   SSGEKKEVKRDRDT-------LEEIEEGEKPTESMESHQYQTEVTRLMDIIVNSLYTQKE  97

Query  427  IFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQIRI  540
            +FLREL+SNA+DAL+K+RFL +++ S+LG+  +L+IRI
Sbjct  98   VFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRI  135



>ref|WP_031799180.1| hypothetical protein, partial [Pseudomonas aeruginosa]
Length=101

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  340  ESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDA  519
            E++ ET G+Q EV +LL L++HSLYS+KEIFLREL+SNASDA DKLRF  +  P LL   
Sbjct  4    ETQKETLGFQTEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFEALANPELLEGG  63

Query  520  GELQIRI  540
             EL+IR+
Sbjct  64   AELKIRV  70



>gb|AFD53632.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AFD53633.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AIV41753.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
Length=151

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E++ +QAEVSRL+D+I++SLYS K++FLREL+SN++DAL+K RF  VT+ S LGD  EL+
Sbjct  79   ESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFLGDKTELE  138

Query  532  IRI  540
            IRI
Sbjct  139  IRI  141



>gb|AFD53634.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AFD53635.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AFD53636.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AFD53637.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97560.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97561.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97562.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97563.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97564.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97565.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97566.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97567.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97568.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97569.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97570.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97571.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97572.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97573.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97574.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97575.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97576.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97577.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97578.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97579.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97580.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97581.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97582.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97583.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97584.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97585.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97586.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97587.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97588.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97589.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97590.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97591.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97592.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97593.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97594.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97595.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97596.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97597.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97598.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97599.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97600.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97601.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97602.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97603.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97604.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97605.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97606.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97607.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97608.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97609.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97610.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97611.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97612.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97613.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97614.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97615.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97616.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97617.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97618.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97619.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97620.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97621.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97622.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AGI97623.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
 gb|AHK14393.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
Length=146

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E++ +QAEVSRL+D+I++SLYS K++FLREL+SN++DAL+K RF  VT+ S LGD  EL+
Sbjct  76   ESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFLGDKTELE  135

Query  532  IRI  540
            IRI
Sbjct  136  IRI  138



>ref|XP_676606.1| endoplasmin precursor [Plasmodium berghei strain ANKA]
 emb|CAH93601.1| endoplasmin homolog precursor, putative [Plasmodium berghei]
Length=807

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  313  SAVAEKEAPESEGETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGV  492
            S + E E P S  E H YQ+EV+RLLD+I++SLY+ K++F+REL+SNA+DAL+K+RFL +
Sbjct  56   SEIDENEKPTSGIENHQYQSEVTRLLDIIINSLYTQKDVFMRELISNAADALEKIRFLSL  115

Query  493  TEPSLLGDAGELQIRI  540
            ++ S+L D  +L+IRI
Sbjct  116  SDESILKDEKKLEIRI  131



>gb|AHK14392.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
Length=148

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  352  ETHGYQAEVSRLLDLIVHSLYSHKEIFLRELVSNASDALDKLRFLGVTEPSLLGDAGELQ  531
            E++ +QAEVSRL+D+I++SLYS K++FLREL+SN++DAL+K RF  VT+ S LGD  EL+
Sbjct  77   ESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFLGDKTELE  136

Query  532  IRI  540
            IRI
Sbjct  137  IRI  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490