BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J22

Length=487
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783395.1|  PREDICTED: SKP1-like protein 1A                    259   3e-85   Nicotiana sylvestris
ref|XP_009591491.1|  PREDICTED: SKP1-like protein 1A                    258   9e-85   Nicotiana tomentosiformis
gb|AAT99735.1|  SKP1                                                    257   1e-84   Nicotiana tabacum [American tobacco]
ref|XP_006362720.1|  PREDICTED: SKP1-like protein 1B-like               257   1e-84   Solanum tuberosum [potatoes]
ref|XP_004250723.1|  PREDICTED: SKP1-like protein 1A                    256   3e-84   Solanum lycopersicum
gb|AFB18000.1|  SKP1 protein                                            255   8e-84   Nicotiana tabacum [American tobacco]
gb|ABB77425.1|  Skp1-like protein 3                                     253   6e-83   Petunia integrifolia subsp. inflata
gb|AAX83944.1|  Skp1                                                    252   2e-82   Capsicum annuum
gb|ACA61785.1|  SKP1-like protein 3                                     251   2e-82   Petunia x hybrida [garden petunia]
ref|XP_009620406.1|  PREDICTED: SKP1-like protein 1A                    251   5e-82   Nicotiana tomentosiformis
gb|ABB77426.1|  Skp1-like protein 1                                     251   5e-82   Petunia integrifolia subsp. inflata
ref|XP_009779583.1|  PREDICTED: SKP1-like protein 1A                    250   7e-82   Nicotiana sylvestris
gb|ACA61784.1|  SKP1-like protein 2                                     250   9e-82   Petunia x hybrida [garden petunia]
ref|XP_009624361.1|  PREDICTED: SKP1-like protein 1A isoform X1         249   1e-81   Nicotiana tomentosiformis
ref|XP_009624363.1|  PREDICTED: SKP1-like protein 1A isoform X2         249   2e-81   Nicotiana tomentosiformis
ref|XP_004512164.1|  PREDICTED: SKP1-like protein 1A-like               249   3e-81   
gb|AAO85510.1|  SKP1                                                    248   4e-81   Nicotiana benthamiana
gb|ACA61783.1|  SKP1-like protein 1                                     248   6e-81   Petunia x hybrida [garden petunia]
gb|KHN41877.1|  SKP1-like protein 1A                                    248   9e-81   Glycine soja [wild soybean]
ref|XP_008393845.1|  PREDICTED: SKP1-like protein 1A                    247   2e-80   
gb|ABB77427.1|  Skp1-like protein 2                                     246   2e-80   Petunia integrifolia subsp. inflata
ref|XP_009379340.1|  PREDICTED: SKP1-like protein 1A                    246   3e-80   Pyrus x bretschneideri [bai li]
gb|AII79402.1|  S-phase kinase-associated protein 1-like protein 5      246   3e-80   Malus hupehensis
ref|XP_006360903.1|  PREDICTED: SKP1-like protein 1B-like               246   4e-80   Solanum tuberosum [potatoes]
ref|XP_008337985.1|  PREDICTED: SKP1-like protein 1A                    246   5e-80   Malus domestica [apple tree]
ref|XP_007157884.1|  hypothetical protein PHAVU_002G106100g             245   6e-80   Phaseolus vulgaris [French bean]
ref|NP_001235929.1|  uncharacterized protein LOC100527683               245   1e-79   
ref|XP_003517160.1|  PREDICTED: SKP1-like protein 1A-like               245   1e-79   Glycine max [soybeans]
ref|XP_003612227.1|  SKP1-like protein                                  244   2e-79   Medicago truncatula
emb|CDP14555.1|  unnamed protein product                                244   3e-79   Coffea canephora [robusta coffee]
gb|AII79401.1|  S-phase kinase-associated protein 1-like protein 4      243   3e-79   Malus hupehensis
ref|XP_007202708.1|  hypothetical protein PRUPE_ppa012752mg             242   1e-78   Prunus persica
ref|XP_009363460.1|  PREDICTED: SKP1-like protein 1A                    242   1e-78   
gb|AAD34458.1|  Skp1                                                    242   2e-78   Medicago sativa [alfalfa]
ref|XP_007225985.1|  hypothetical protein PRUPE_ppa012755mg             241   3e-78   Prunus persica
ref|XP_003612225.1|  SKP1-like protein                                  241   3e-78   Medicago truncatula
ref|XP_006422586.1|  hypothetical protein CICLE_v10029465mg             241   4e-78   Citrus clementina [clementine]
ref|XP_006359705.1|  PREDICTED: SKP1-like protein 1B-like               240   6e-78   Solanum tuberosum [potatoes]
ref|XP_009334694.1|  PREDICTED: SKP1-like protein 1B                    240   8e-78   Pyrus x bretschneideri [bai li]
ref|XP_006435227.1|  hypothetical protein CICLE_v10002751mg             240   1e-77   Citrus clementina [clementine]
gb|ACJ86090.1|  unknown                                                 239   1e-77   Medicago truncatula
ref|XP_008357122.1|  PREDICTED: SKP1-like protein 1B                    239   2e-77   Malus domestica [apple tree]
ref|XP_004231049.1|  PREDICTED: SKP1-like protein 1B                    239   2e-77   
ref|XP_004287783.1|  PREDICTED: SKP1-like protein 1A                    239   2e-77   Fragaria vesca subsp. vesca
gb|AFK44762.1|  unknown                                                 239   2e-77   Lotus japonicus
ref|XP_002510576.1|  skp1, putative                                     239   3e-77   Ricinus communis
ref|XP_002510577.1|  skp1, putative                                     239   3e-77   Ricinus communis
ref|XP_007156190.1|  hypothetical protein PHAVU_003G265900g             238   3e-77   Phaseolus vulgaris [French bean]
ref|XP_010266012.1|  PREDICTED: SKP1-like protein 1B                    238   5e-77   Nelumbo nucifera [Indian lotus]
ref|NP_001241052.1|  uncharacterized protein LOC100798104               238   6e-77   Glycine max [soybeans]
gb|AFM75900.1|  GSK1                                                    238   7e-77   Gossypium hirsutum [American cotton]
ref|XP_010033522.1|  PREDICTED: SKP1-like protein 1B                    238   7e-77   Eucalyptus grandis [rose gum]
gb|ACU13236.1|  unknown                                                 237   1e-76   Glycine max [soybeans]
ref|XP_011092967.1|  PREDICTED: SKP1-like protein 1A                    237   2e-76   Sesamum indicum [beniseed]
ref|NP_001235349.1|  uncharacterized protein LOC100306458               236   2e-76   Glycine max [soybeans]
ref|XP_007046627.1|  S phase kinase-associated protein 1                236   3e-76   Theobroma cacao [chocolate]
ref|XP_011088616.1|  PREDICTED: SKP1-like protein 1A                    236   4e-76   Sesamum indicum [beniseed]
ref|XP_010680409.1|  PREDICTED: SKP1-like protein 1B                    236   5e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|ACP20181.1|  SKP1-like protein                                       235   7e-76   Citrus maxima [buntan]
gb|KJB63489.1|  hypothetical protein B456_010G002100                    235   9e-76   Gossypium raimondii
gb|KDP36889.1|  hypothetical protein JCGZ_08180                         235   9e-76   Jatropha curcas
ref|XP_002301954.1|  hypothetical protein POPTR_0002s02020g             235   1e-75   Populus trichocarpa [western balsam poplar]
ref|XP_003621661.1|  SKP1-like protein                                  234   1e-75   Medicago truncatula
ref|XP_004512165.1|  PREDICTED: SKP1-like protein 1A-like               234   1e-75   
gb|ABS17589.1|  SKP1 component-like 1                                   234   2e-75   Humulus lupulus [common hop]
gb|EPS66410.1|  hypothetical protein M569_08366                         234   2e-75   Genlisea aurea
ref|XP_008445323.1|  PREDICTED: SKP1-like protein 1B                    234   2e-75   Cucumis melo [Oriental melon]
ref|XP_004248654.1|  PREDICTED: SKP1-like protein 1B                    234   2e-75   Solanum lycopersicum
gb|KHG24597.1|  SKP1-like protein 1B                                    234   2e-75   Gossypium arboreum [tree cotton]
ref|XP_004248653.2|  PREDICTED: SKP1-like protein 1B                    234   3e-75   
ref|XP_002306950.1|  hypothetical protein POPTR_0005s26450g             234   3e-75   Populus trichocarpa [western balsam poplar]
gb|KEH23694.1|  SCF ubiquitin ligase, SKP1 component                    233   5e-75   Medicago truncatula
ref|XP_007041813.1|  S phase kinase-associated protein 1                233   7e-75   Theobroma cacao [chocolate]
gb|KJB15832.1|  hypothetical protein B456_002G198700                    233   7e-75   Gossypium raimondii
gb|KHG30151.1|  SKP1-like protein 1A                                    233   7e-75   Gossypium arboreum [tree cotton]
gb|EYU17579.1|  hypothetical protein MIMGU_mgv1a015014mg                233   9e-75   Erythranthe guttata [common monkey flower]
ref|XP_004144851.1|  PREDICTED: SKP1-like protein 1B-like               232   1e-74   Cucumis sativus [cucumbers]
gb|KDP23982.1|  hypothetical protein JCGZ_25370                         232   1e-74   Jatropha curcas
ref|XP_004143010.1|  PREDICTED: SKP1-like protein 1B-like               232   1e-74   Cucumis sativus [cucumbers]
gb|ABK96569.1|  unknown                                                 232   2e-74   Populus trichocarpa x Populus deltoides
ref|XP_011003066.1|  PREDICTED: SKP1-like protein 1B                    231   2e-74   Populus euphratica
ref|XP_011043147.1|  PREDICTED: SKP1-like protein 1B                    231   3e-74   Populus euphratica
ref|XP_006425391.1|  hypothetical protein CICLE_v10026642mg             231   4e-74   Citrus clementina [clementine]
ref|XP_008447950.1|  PREDICTED: SKP1-like protein 1B                    230   7e-74   Cucumis melo [Oriental melon]
ref|XP_002279232.1|  PREDICTED: SKP1-like protein 1A isoform X5         230   8e-74   Vitis vinifera
gb|KDO71310.1|  hypothetical protein CISIN_1g030962mg                   230   1e-73   Citrus sinensis [apfelsine]
ref|XP_002270061.1|  PREDICTED: SKP1-like protein 1B                    229   1e-73   Vitis vinifera
gb|ABK92723.1|  unknown                                                 229   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_010536422.1|  PREDICTED: SKP1-like protein 1A                    229   4e-73   Tarenaya hassleriana [spider flower]
ref|XP_010550803.1|  PREDICTED: SKP1-like protein 1B                    228   4e-73   Tarenaya hassleriana [spider flower]
ref|XP_009420815.1|  PREDICTED: SKP1-like protein 1A                    228   5e-73   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA75118.1|  fimbriata-associated protein                           228   5e-73   Antirrhinum majus [garden snapdragon]
ref|XP_002531150.1|  skp1, putative                                     228   6e-73   Ricinus communis
ref|XP_006360901.1|  PREDICTED: SKP1-like protein 1B-like               228   6e-73   
gb|EPS61104.1|  hypothetical protein M569_13700                         227   2e-72   Genlisea aurea
gb|KEH23696.1|  SCF ubiquitin ligase, SKP1 component                    226   2e-72   Medicago truncatula
ref|XP_011083455.1|  PREDICTED: SKP1-like protein 1A                    226   3e-72   Sesamum indicum [beniseed]
dbj|BAB85607.1|  kinetochore protein                                    226   4e-72   Brassica juncea [brown mustard]
ref|XP_006360900.1|  PREDICTED: SKP1-like protein 1B-like isoform X2    225   5e-72   
ref|XP_010095548.1|  SKP1-like protein 1B                               225   6e-72   Morus notabilis
ref|XP_006847969.1|  hypothetical protein AMTR_s00029p00153350          225   7e-72   Amborella trichopoda
gb|KDP29669.1|  hypothetical protein JCGZ_18831                         225   8e-72   Jatropha curcas
ref|XP_010266846.1|  PREDICTED: SKP1-like protein 1B isoform X1         225   8e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010935122.1|  PREDICTED: SKP1-like protein 1A                    224   1e-71   Elaeis guineensis
ref|NP_565123.1|  S-phase kinase-associated protein 1                   224   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291337.1|  PREDICTED: SKP1-like protein 1B                    224   2e-71   Fragaria vesca subsp. vesca
ref|XP_009104691.1|  PREDICTED: SKP1-like protein 1A                    224   2e-71   Brassica rapa
ref|XP_006390250.1|  hypothetical protein EUTSA_v10019260mg             224   3e-71   Eutrema salsugineum [saltwater cress]
gb|KFK42033.1|  hypothetical protein AALP_AA2G203200                    224   3e-71   Arabis alpina [alpine rockcress]
ref|XP_002305525.2|  E3 ubiquitin ligase SCF complex subunit SKP1...    224   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_006360899.1|  PREDICTED: SKP1-like protein 1B-like isoform X1    223   3e-71   Solanum tuberosum [potatoes]
ref|XP_010029647.1|  PREDICTED: SKP1-like protein 1B isoform X1         223   4e-71   Eucalyptus grandis [rose gum]
gb|EMT15375.1|  SKP1-like protein 4                                     223   4e-71   
ref|XP_009128146.1|  PREDICTED: SKP1-like protein 1A                    223   5e-71   Brassica rapa
ref|XP_004287067.1|  PREDICTED: SKP1-like protein 1B                    223   5e-71   Fragaria vesca subsp. vesca
ref|XP_011046673.1|  PREDICTED: SKP1-like protein 1A                    223   5e-71   Populus euphratica
gb|EMT03939.1|  SKP1-like protein 1B                                    223   7e-71   
gb|EMT05501.1|  SKP1-like protein 1B                                    223   8e-71   
ref|XP_010690359.1|  PREDICTED: SKP1-like protein 1B                    223   8e-71   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAB85605.1|  kinetochore protein                                    222   1e-70   Brassica juncea [brown mustard]
emb|CDY13521.1|  BnaC02g23320D                                          222   1e-70   Brassica napus [oilseed rape]
ref|XP_009401439.1|  PREDICTED: SKP1-like protein 1B                    221   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008806601.1|  PREDICTED: SKP1-like protein 1A                    221   2e-70   Phoenix dactylifera
ref|XP_010935123.1|  PREDICTED: SKP1-like protein 1B                    221   3e-70   Elaeis guineensis
ref|NP_568603.1|  SKP1-like protein 1B                                  221   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395355.1|  PREDICTED: SKP1-like protein 1B                    221   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010941330.1|  PREDICTED: SKP1-like protein 1B                    221   4e-70   Elaeis guineensis
ref|XP_002863814.1|  hypothetical protein ARALYDRAFT_917589             221   4e-70   Arabidopsis lyrata subsp. lyrata
gb|AGF33287.1|  SKP1 1A-like protein                                    219   5e-70   Quercus ilex [holly oak]
ref|XP_009395385.1|  PREDICTED: SKP1-like protein 1B                    220   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC63110.1|  UIP2                                                    221   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442189.1|  PREDICTED: SKP1-like protein 1B                    221   6e-70   Camelina sativa [gold-of-pleasure]
emb|CAA75117.1|  fimbriata-associated protein                           219   1e-69   Antirrhinum majus [garden snapdragon]
ref|XP_010494151.1|  PREDICTED: SKP1-like protein 1B                    220   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010266848.1|  PREDICTED: SKP1-like protein 1B isoform X2         219   1e-69   
ref|XP_003621659.1|  SKP1-like protein                                  219   1e-69   Medicago truncatula
ref|XP_010539092.1|  PREDICTED: SKP1-like protein 1B                    219   1e-69   Tarenaya hassleriana [spider flower]
emb|CDX85931.1|  BnaC06g22030D                                          219   1e-69   
ref|XP_008448523.1|  PREDICTED: SKP1-like protein 1B                    219   2e-69   Cucumis melo [Oriental melon]
gb|EMS35771.1|  SKP1-like protein 1B                                    219   2e-69   Triticum urartu
ref|XP_010941328.1|  PREDICTED: SKP1-like protein 1A                    219   3e-69   Elaeis guineensis
gb|EMS59755.1|  SKP1-like protein 4                                     219   3e-69   Triticum urartu
ref|XP_006302938.1|  hypothetical protein CARUB_v10021077mg             218   3e-69   Capsella rubella
dbj|BAE72121.1|  SKP1-like protein                                      219   4e-69   Silene latifolia
gb|EMT03937.1|  SKP1-like protein 1A                                    218   4e-69   
ref|XP_009418685.1|  PREDICTED: SKP1-like protein 1A                    218   5e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414442.1|  PREDICTED: SKP1-like protein 1A                    218   5e-69   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD46569.1|  putative UIP2                                          218   5e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004159727.1|  PREDICTED: SKP1-like protein 1A-like               218   6e-69   
gb|EMT23721.1|  SKP1-like protein 1A                                    218   6e-69   
gb|AGU28415.1|  S phase kinase-associated protein 1                     218   7e-69   Sinapis alba [bai jie]
dbj|BAB85604.1|  kinetochore protein                                    217   7e-69   Brassica juncea [brown mustard]
ref|XP_006281119.1|  hypothetical protein CARUB_v10027150mg             219   8e-69   
ref|XP_008811446.1|  PREDICTED: SKP1-like protein 1A                    217   9e-69   Phoenix dactylifera
gb|EMT33027.1|  SKP1-like protein 1B                                    218   1e-68   
gb|EMT01680.1|  SKP1-like protein 1B                                    217   1e-68   
ref|XP_004248652.1|  PREDICTED: SKP1-like protein 1B                    216   2e-68   Solanum lycopersicum
ref|XP_004146156.1|  PREDICTED: SKP1-like protein 1B-like               216   2e-68   Cucumis sativus [cucumbers]
ref|XP_008806600.1|  PREDICTED: SKP1-like protein 1A                    216   3e-68   Phoenix dactylifera
ref|XP_010471746.1|  PREDICTED: SKP1-like protein 1A                    216   4e-68   Camelina sativa [gold-of-pleasure]
gb|KJB17604.1|  hypothetical protein B456_003G007300                    214   8e-68   Gossypium raimondii
ref|XP_010416502.1|  PREDICTED: SKP1-like protein 1A                    214   1e-67   Camelina sativa [gold-of-pleasure]
dbj|BAB85606.1|  kinetochore protein                                    214   2e-67   Brassica juncea [brown mustard]
ref|XP_002537506.1|  skp1, putative                                     214   2e-67   Ricinus communis
ref|XP_008811458.1|  PREDICTED: SKP1-like protein 1A                    214   2e-67   
ref|XP_007219396.1|  hypothetical protein PRUPE_ppa020403mg             214   2e-67   Prunus persica
gb|AII79406.1|  S-phase kinase-associated protein 1-like protein 6      214   2e-67   Malus hupehensis
ref|XP_003577587.1|  PREDICTED: SKP1-like protein 1A                    214   3e-67   Brachypodium distachyon [annual false brome]
ref|XP_003573486.1|  PREDICTED: SKP1-like protein 1A                    212   9e-67   Brachypodium distachyon [annual false brome]
ref|XP_009355656.1|  PREDICTED: SKP1-like protein 1A                    212   1e-66   Pyrus x bretschneideri [bai li]
gb|AGT16907.1|  SKP1-like protein                                       213   1e-66   Saccharum hybrid cultivar R570
ref|XP_002313704.1|  E3 ubiquitin ligase SCF complex subunit SKP1...    211   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_008232104.1|  PREDICTED: SKP1-like protein 1B                    211   2e-66   Prunus mume [ume]
ref|XP_010061081.1|  PREDICTED: SKP1-like protein 1B isoform X1         211   2e-66   Eucalyptus grandis [rose gum]
ref|XP_007201294.1|  hypothetical protein PRUPE_ppa012728mg             211   2e-66   Prunus persica
ref|XP_003605505.1|  SKP1-like protein                                  211   3e-66   Medicago truncatula
ref|XP_007221090.1|  hypothetical protein PRUPE_ppa017105mg             211   3e-66   Prunus persica
ref|XP_001753554.1|  predicted protein                                  210   4e-66   
ref|XP_011046062.1|  PREDICTED: SKP1-like protein 1B                    210   5e-66   Populus euphratica
ref|XP_004231048.1|  PREDICTED: SKP1-like protein 1A                    210   6e-66   Solanum lycopersicum
ref|XP_010683700.1|  PREDICTED: SKP1-like protein 1B isoform X3         209   7e-66   
dbj|BAE72119.1|  SKP1-like protein                                      210   8e-66   Silene latifolia
gb|ABB69022.1|  SKP1                                                    209   8e-66   Brassica napus [oilseed rape]
ref|XP_004301672.1|  PREDICTED: SKP1-like protein 1A                    209   9e-66   Fragaria vesca subsp. vesca
ref|XP_004299943.1|  PREDICTED: SKP1-like protein 1B                    209   1e-65   Fragaria vesca subsp. vesca
gb|KEH23706.1|  SCF ubiquitin ligase, SKP1 component                    209   1e-65   Medicago truncatula
ref|XP_010113308.1|  SKP1-like protein 1A                               209   1e-65   Morus notabilis
ref|XP_010428644.1|  PREDICTED: SKP1-like protein 1A                    209   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008232108.1|  PREDICTED: SKP1-like protein 1A                    209   2e-65   Prunus mume [ume]
ref|XP_010669692.1|  PREDICTED: SKP1-like protein 1B                    209   2e-65   Beta vulgaris subsp. vulgaris [field beet]
gb|AAT12490.1|  Skp1/Ask1-like protein                                  209   3e-65   Zantedeschia hybrid cultivar
gb|KFK36059.1|  hypothetical protein AALP_AA4G072500                    208   3e-65   Arabis alpina [alpine rockcress]
gb|EMT01771.1|  SKP1-like protein 1B                                    211   3e-65   
emb|CDX73212.1|  BnaC06g36600D                                          208   3e-65   
gb|KEH23692.1|  SCF ubiquitin ligase, SKP1 component                    208   3e-65   Medicago truncatula
ref|XP_008236029.1|  PREDICTED: SKP1-like protein 1A                    208   4e-65   Prunus mume [ume]
ref|XP_007024458.1|  SKP1-like 4                                        207   4e-65   
ref|XP_002976912.1|  hypothetical protein SELMODRAFT_271223             208   4e-65   Selaginella moellendorffii
ref|XP_010683699.1|  PREDICTED: SKP1-like protein 1B isoform X2         207   4e-65   
emb|CDP16774.1|  unnamed protein product                                207   5e-65   Coffea canephora [robusta coffee]
ref|XP_010440828.1|  PREDICTED: SKP1-like protein 1A                    207   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_002887622.1|  hypothetical protein ARALYDRAFT_339769             221   1e-64   
ref|XP_009373027.1|  PREDICTED: SKP1-like protein 1A                    206   2e-64   Pyrus x bretschneideri [bai li]
gb|AEQ39057.1|  putative SKP1-like protein 1                            206   2e-64   Wolffia arrhiza
ref|XP_003605510.1|  SKP1-like protein                                  206   3e-64   Medicago truncatula
ref|XP_009372999.1|  PREDICTED: SKP1-like protein 1A                    206   3e-64   Pyrus x bretschneideri [bai li]
ref|XP_004957494.1|  PREDICTED: SKP1-like protein 1B-like               206   4e-64   Setaria italica
ref|XP_006646753.1|  PREDICTED: SKP1-like protein 1B-like               206   4e-64   Oryza brachyantha
emb|CAB87834.1|  putative kinetochore protein                           204   5e-64   Vicia faba var. minor [tick bean]
ref|NP_564105.1|  SKP1-like protein 4                                   205   6e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006661910.1|  PREDICTED: SKP1-like protein 1B-like               205   9e-64   Oryza brachyantha
ref|XP_006359704.1|  PREDICTED: SKP1-like protein 1B-like               204   9e-64   Solanum tuberosum [potatoes]
ref|XP_008382315.1|  PREDICTED: SKP1-like protein 1A isoform X2         204   1e-63   
ref|XP_002880415.1|  hypothetical protein ARALYDRAFT_481069             204   1e-63   
ref|XP_003628375.1|  SKP1-like protein                                  204   2e-63   Medicago truncatula
ref|XP_008382314.1|  PREDICTED: SKP1-like protein 1A isoform X1         204   2e-63   Malus domestica [apple tree]
ref|XP_009372996.1|  PREDICTED: SKP1-like protein 1A                    204   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_010683698.1|  PREDICTED: SKP1-like protein 1B isoform X1         204   2e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009362142.1|  PREDICTED: SKP1-like protein 1A                    203   4e-63   Pyrus x bretschneideri [bai li]
dbj|BAB85603.1|  kinetochore protein                                    203   4e-63   Brassica juncea [brown mustard]
ref|XP_009413024.1|  PREDICTED: SKP1-like protein 1A                    203   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001753031.1|  predicted protein                                  202   5e-63   
ref|XP_006304273.1|  hypothetical protein CARUB_v10010505mg             202   6e-63   Capsella rubella
ref|XP_009372998.1|  PREDICTED: SKP1-like protein 1A isoform X2         202   7e-63   
emb|CAJ38399.1|  fimbriata-associated protein                           201   8e-63   Plantago major [cart-track plant]
ref|XP_009372997.1|  PREDICTED: SKP1-like protein 1A isoform X1         202   9e-63   Pyrus x bretschneideri [bai li]
ref|XP_010683792.1|  PREDICTED: SKP1-like protein 1B                    202   1e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT15207.1|  SKP1-like protein 1B                                    202   1e-62   
gb|EMS52877.1|  SKP1-like protein 1B                                    202   1e-62   Triticum urartu
emb|CCG34083.1|  SCF ubiquitin ligase                                   201   2e-62   uncultured eukaryote
ref|XP_002462746.1|  hypothetical protein SORBIDRAFT_02g031280          202   2e-62   Sorghum bicolor [broomcorn]
ref|XP_009106248.1|  PREDICTED: SKP1-like protein 1A                    201   2e-62   Brassica rapa
gb|AAX92710.1|  SCF ubiquitin ligase                                    202   2e-62   Picea abies
ref|XP_009376944.1|  PREDICTED: SKP1-like protein 1B                    201   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_010646804.1|  PREDICTED: SKP1-like protein 1A isoform X3         206   2e-62   Vitis vinifera
ref|XP_002867118.1|  hypothetical protein ARALYDRAFT_912943             201   2e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_010646801.1|  PREDICTED: SKP1-like protein 1A isoform X2         206   2e-62   Vitis vinifera
gb|ACR38888.1|  SKP1                                                    201   3e-62   Apopellia endiviifolia (species B)
ref|XP_002890373.1|  hypothetical protein ARALYDRAFT_889462             201   3e-62   Arabidopsis lyrata subsp. lyrata
gb|ABK21374.1|  unknown                                                 200   4e-62   Picea sitchensis
ref|NP_001176525.1|  Os11g0456300                                       201   4e-62   
emb|CDP16773.1|  unnamed protein product                                200   5e-62   Coffea canephora [robusta coffee]
ref|XP_003636464.1|  SKP1-like protein                                  200   5e-62   
ref|XP_009363144.1|  PREDICTED: uncharacterized protein LOC103953139    204   5e-62   Pyrus x bretschneideri [bai li]
emb|CAJ38400.1|  fimbriata-associated protein                           201   7e-62   Plantago major [cart-track plant]
ref|XP_008372868.1|  PREDICTED: SKP1-like protein 1B                    200   7e-62   
gb|ABK25195.1|  unknown                                                 199   8e-62   Picea sitchensis
emb|CAB85491.1|  putative kinetochore protein                           200   9e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008382316.1|  PREDICTED: SKP1-like protein 1A                    198   3e-61   Malus domestica [apple tree]
ref|XP_004289997.1|  PREDICTED: SKP1-like protein 1A                    197   3e-61   Fragaria vesca subsp. vesca
ref|XP_010435879.1|  PREDICTED: SKP1-like protein 11                    197   4e-61   Camelina sativa [gold-of-pleasure]
gb|ACF85177.1|  unknown                                                 198   4e-61   Zea mays [maize]
ref|XP_002450709.1|  hypothetical protein SORBIDRAFT_05g012740          198   4e-61   Sorghum bicolor [broomcorn]
ref|XP_002277864.1|  PREDICTED: uncharacterized protein LOC100257...    206   5e-61   Vitis vinifera
ref|XP_008246274.1|  PREDICTED: SKP1-like protein 1A                    196   5e-61   Prunus mume [ume]
gb|ACG31014.1|  SKP1-like protein 1A                                    198   6e-61   Zea mays [maize]
emb|CAE53885.1|  putative SKP1 protein                                  197   7e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006660908.1|  PREDICTED: SKP1-like protein 1B-like               197   7e-61   Oryza brachyantha
ref|XP_004979241.1|  PREDICTED: SKP1-like protein 1B-like               198   8e-61   Setaria italica
ref|XP_010432410.1|  PREDICTED: SKP1-like protein 11                    196   1e-60   Camelina sativa [gold-of-pleasure]
emb|CDY44209.1|  BnaC05g15660D                                          197   1e-60   Brassica napus [oilseed rape]
emb|CCG34082.1|  SCF ubiquitin ligase                                   196   1e-60   uncultured eukaryote
ref|XP_010441003.1|  PREDICTED: SKP1-like protein 11                    196   1e-60   Camelina sativa [gold-of-pleasure]
gb|ABK28664.1|  unknown                                                 196   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149503.1|  PREDICTED: SKP1-like protein 4                     196   1e-60   Brassica rapa
ref|XP_010029649.1|  PREDICTED: SKP1-like protein 1B                    196   2e-60   Eucalyptus grandis [rose gum]
ref|NP_567959.1|  SKP1-like protein 11                                  196   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450797.1|  PREDICTED: SKP1-like protein 11                    196   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006416426.1|  hypothetical protein EUTSA_v10008964mg             196   2e-60   Eutrema salsugineum [saltwater cress]
gb|EMT01637.1|  SKP1-like protein 1B                                    196   2e-60   
ref|XP_003574990.1|  PREDICTED: SKP1-like protein 1A                    196   2e-60   Brachypodium distachyon [annual false brome]
ref|XP_010029648.1|  PREDICTED: SKP1-like protein 1B isoform X2         195   2e-60   Eucalyptus grandis [rose gum]
ref|XP_006286731.1|  hypothetical protein CARUB_v10002974mg             195   2e-60   Capsella rubella
ref|XP_010327537.1|  PREDICTED: SKP1-like protein 11                    196   3e-60   
gb|KFK35110.1|  hypothetical protein AALP_AA5G237300                    195   4e-60   Arabis alpina [alpine rockcress]
ref|XP_011075000.1|  PREDICTED: SKP1-like protein 1A                    195   4e-60   Sesamum indicum [beniseed]
ref|XP_010441072.1|  PREDICTED: SKP1-like protein 11                    195   4e-60   Camelina sativa [gold-of-pleasure]
emb|CAN73673.1|  hypothetical protein VITISV_031861                     194   5e-60   Vitis vinifera
ref|XP_008382346.1|  PREDICTED: SKP1-like protein 1A                    194   5e-60   
emb|CAN81017.1|  hypothetical protein VITISV_028248                     194   6e-60   
ref|NP_567967.1|  SKP1-like protein 12                                  194   6e-60   
ref|XP_008677157.1|  PREDICTED: uncharacterized protein LOC100280...    197   6e-60   
emb|CDX93699.1|  BnaA06g03490D                                          194   6e-60   
gb|KCW56600.1|  hypothetical protein EUGRSUZ_I02321                     197   6e-60   
ref|XP_009147939.1|  PREDICTED: SKP1-like protein 13                    194   6e-60   
ref|XP_007202707.1|  hypothetical protein PRUPE_ppa012732mg             194   8e-60   
ref|XP_008357536.1|  PREDICTED: SKP1-like protein 1A                    195   1e-59   
emb|CDM86749.1|  unnamed protein product                                194   1e-59   
ref|XP_008347749.1|  PREDICTED: SKP1-like protein 1A                    195   1e-59   
ref|XP_009147940.1|  PREDICTED: SKP1-like protein 1A                    194   1e-59   
ref|XP_003616859.1|  SKP1-like protein                                  193   2e-59   
ref|XP_008232155.1|  PREDICTED: SKP1-like protein 11                    193   2e-59   
emb|CDY40610.1|  BnaC06g02260D                                          193   2e-59   
ref|XP_010437611.1|  PREDICTED: SKP1-like protein 11                    193   2e-59   
ref|XP_006436098.1|  hypothetical protein CICLE_v10033809mg             193   3e-59   
ref|XP_003605511.1|  SKP1                                               192   3e-59   
gb|AAP79890.1|  SKP1/ASK1-like protein                                  193   3e-59   
ref|XP_010029650.1|  PREDICTED: SKP1-like protein 1B                    193   3e-59   
dbj|BAE72118.1|  SKP1-like protein                                      193   3e-59   
ref|XP_010477249.1|  PREDICTED: SKP1-like protein 4                     192   5e-59   
ref|XP_010447075.1|  PREDICTED: SKP1-like protein 11 isoform X1         192   5e-59   
ref|XP_004951176.1|  PREDICTED: SKP1-like protein 1B-like               192   6e-59   
ref|XP_006393304.1|  hypothetical protein EUTSA_v10012168mg             192   7e-59   
dbj|BAJ91150.1|  predicted protein                                      192   7e-59   
ref|XP_011470549.1|  PREDICTED: SKP1-like protein 1A                    191   8e-59   
ref|NP_565604.1|  putative E3 ubiquitin ligase ASK3                     192   1e-58   
emb|CDY40611.1|  BnaC06g02270D                                          191   2e-58   
gb|KDO67761.1|  hypothetical protein CISIN_1g044292mg                   191   2e-58   
ref|XP_003063597.1|  predicted protein                                  191   2e-58   
ref|XP_002453117.1|  hypothetical protein SORBIDRAFT_04g000330          191   2e-58   
ref|XP_010459699.1|  PREDICTED: SKP1-like protein 4                     191   2e-58   
ref|XP_002947872.1|  hypothetical protein VOLCADRAFT_73445              189   6e-58   
emb|CBI37863.3|  unnamed protein product                                188   8e-58   
gb|KEH23709.1|  SCF ubiquitin ligase, SKP1 component                    189   1e-57   
ref|XP_002444405.1|  hypothetical protein SORBIDRAFT_07g021450          189   2e-57   
ref|NP_001131741.1|  SKP1-like protein 1A                               188   2e-57   
ref|XP_002488987.1|  hypothetical protein SORBIDRAFT_0702s002010        191   4e-57   
ref|XP_008242039.1|  PREDICTED: SKP1-like protein 1A                    186   1e-56   
ref|XP_004289877.1|  PREDICTED: SKP1-like protein 4                     186   1e-56   
ref|XP_008245788.1|  PREDICTED: SKP1-like protein 11                    186   2e-56   
emb|CDP16772.1|  unnamed protein product                                186   2e-56   
gb|ADQ00179.1|  E3 ubiquitin ligase                                     186   2e-56   
ref|XP_003605516.1|  SKP1-like protein                                  185   2e-56   
ref|XP_001690964.1|  E3 ubiquitin ligase                                185   2e-56   
emb|CDM80524.1|  unnamed protein product                                186   2e-56   
gb|AAT09201.1|  skp1 protein                                            186   3e-56   
ref|XP_010056210.1|  PREDICTED: SKP1-like protein 1B                    185   3e-56   
gb|EMT17500.1|  hypothetical protein F775_42820                         186   3e-56   
gb|KEH19789.1|  SCF ubiquitin ligase, SKP1 component                    185   4e-56   
ref|XP_010448526.1|  PREDICTED: SKP1-like protein 4                     185   5e-56   
gb|KJB12141.1|  hypothetical protein B456_002G002700                    184   8e-56   
ref|XP_010061082.1|  PREDICTED: SKP1-like protein 1B isoform X2         183   1e-55   
ref|XP_006285109.1|  hypothetical protein CARUB_v10006442mg             183   1e-55   
gb|KIZ07701.1|  SKP1-like protein 1A                                    182   2e-55   
ref|XP_002504623.1|  predicted protein                                  182   3e-55   
dbj|BAE72120.1|  SKP1-like protein                                      184   4e-55   
ref|XP_010438976.1|  PREDICTED: SKP1-like protein 4                     181   1e-54   
ref|XP_011467750.1|  PREDICTED: SKP1-like protein 1B                    181   1e-54   
ref|XP_004306259.1|  PREDICTED: SKP1-like protein 1A                    181   1e-54   
gb|EMT28670.1|  SKP1-like protein 4                                     186   1e-54   
ref|XP_010107659.1|  SKP1-like protein 4                                181   2e-54   
ref|XP_010433736.1|  PREDICTED: SKP1-like protein 4                     181   3e-54   
ref|XP_002279171.1|  PREDICTED: SKP1-like protein 1A isoform X4         180   3e-54   
gb|KJB47681.1|  hypothetical protein B456_008G036400                    180   3e-54   
gb|EMT30556.1|  SKP1-like protein 4                                     181   3e-54   
ref|XP_009627980.1|  PREDICTED: SKP1-like protein 1B                    179   5e-54   
gb|EMT19091.1|  SKP1-like protein 4                                     179   6e-54   
ref|XP_007219120.1|  hypothetical protein PRUPE_ppa015805mg             178   1e-53   
gb|EMT23720.1|  SKP1-like protein 1A                                    177   1e-53   
gb|ACG46345.1|  SKP1-like protein 1A                                    179   1e-53   
emb|CAB87813.1|  putative kinetochore protein                           177   1e-53   
ref|XP_001422389.1|  predicted protein                                  178   2e-53   
ref|XP_002885472.1|  hypothetical protein ARALYDRAFT_898638             178   2e-53   
ref|XP_010028736.1|  PREDICTED: SKP1-like protein 1A                    178   2e-53   
gb|KCW55541.1|  hypothetical protein EUGRSUZ_I01424                     178   3e-53   
ref|XP_008670859.1|  PREDICTED: SKP1-like protein 1A                    179   3e-53   
gb|KFK35210.1|  hypothetical protein AALP_AA5G254700                    177   3e-53   
gb|KJB12140.1|  hypothetical protein B456_002G002600                    177   3e-53   
gb|EMT17797.1|  SKP1-like protein 1B                                    177   4e-53   
emb|CBI37865.3|  unnamed protein product                                176   4e-53   
ref|XP_008670886.1|  PREDICTED: SKP1-like protein 1A                    178   5e-53   
ref|XP_009623472.1|  PREDICTED: SKP1-like protein 1B                    177   5e-53   
tpg|DAA58698.1|  TPA: SKP1-like protein 1A                              177   6e-53   
ref|XP_010447073.1|  PREDICTED: SKP1-like protein 11                    177   6e-53   
gb|EMS57884.1|  SKP1-like protein 4                                     177   6e-53   
ref|XP_008671925.1|  PREDICTED: SKP1-like protein 1A                    177   7e-53   
gb|AAB38862.1|  homologue to SKP1                                       175   8e-53   
ref|XP_008664388.1|  PREDICTED: SKP1-like protein 1B                    177   9e-53   
ref|XP_008669236.1|  PREDICTED: SKP1-like protein 1A                    177   1e-52   
ref|NP_001152275.1|  SKP1-like protein 1A                               176   1e-52   
emb|CCG34078.1|  SCF ubiquitin ligase                                   176   2e-52   
tpg|DAA42254.1|  TPA: SKP1-like protein 1A                              176   2e-52   
ref|XP_003605515.1|  SKP1-like protein                                  175   2e-52   
ref|NP_001152391.1|  SKP1-like protein 1A                               176   3e-52   
gb|ACS69067.1|  pollen specific SKP1-like protein LSK3                  175   3e-52   
tpg|DAA56608.1|  TPA: hypothetical protein ZEAMMB73_397176              177   3e-52   
gb|EYU37960.1|  hypothetical protein MIMGU_mgv1a015408mg                174   4e-52   
gb|AGT15908.1|  SKP1-like protein                                       175   4e-52   
emb|CAA75119.1|  fimbriata-associated protein                           173   5e-52   
ref|XP_005846142.1|  hypothetical protein CHLNCDRAFT_59724              174   6e-52   
gb|EMT27938.1|  SKP1-like protein 1B                                    173   6e-52   
ref|NP_001149673.1|  SKP1-like protein 1A                               174   7e-52   
gb|EMS45381.1|  SKP1-like protein 1B                                    174   8e-52   
emb|CEG00859.1|  E3 ubiquitin ligase, SCF complex, Skp subunit          173   1e-51   
ref|NP_567090.1|  SKP1-like protein 13                                  173   2e-51   
ref|XP_009382729.1|  PREDICTED: SKP1-like protein 1A                    172   2e-51   
ref|XP_009786816.1|  PREDICTED: SKP1-like protein 1A                    172   3e-51   
gb|EMT14444.1|  SKP1-like protein 1B                                    172   3e-51   
emb|CDX77280.1|  BnaC08g03250D                                          172   3e-51   
ref|XP_010028740.1|  PREDICTED: SKP1-like protein 1A                    172   5e-51   
gb|EMT17502.1|  hypothetical protein F775_42821                         174   9e-51   
ref|XP_010413610.1|  PREDICTED: SKP1-like protein 13                    171   1e-50   
ref|XP_002878309.1|  hypothetical protein ARALYDRAFT_907521             170   2e-50   
gb|KJB47682.1|  hypothetical protein B456_008G036500                    170   2e-50   
gb|KCW67979.1|  hypothetical protein EUGRSUZ_F01672                     169   3e-50   
emb|CCG34080.1|  SCF ubiquitin ligase                                   170   3e-50   
dbj|BAC19974.1|  putative Skp1                                          170   3e-50   
emb|CCA95090.1|  putative S phase kinase-associated protein 1           167   3e-50   
ref|XP_002887052.1|  hypothetical protein ARALYDRAFT_894320             170   4e-50   
ref|NP_566694.1|  SKP1-like protein 9                                   169   4e-50   
gb|ABK28567.1|  unknown                                                 169   4e-50   
gb|KFK35211.1|  hypothetical protein AALP_AA5G254800                    169   4e-50   
ref|XP_009107332.1|  PREDICTED: SKP1-like protein 13                    169   5e-50   
ref|XP_006293215.1|  hypothetical protein CARUB_v10019539mg             169   6e-50   
emb|CDY16470.1|  BnaA08g02970D                                          169   7e-50   
ref|XP_007220743.1|  hypothetical protein PRUPE_ppa024856mg             168   9e-50   
ref|NP_566695.1|  SKP1-like protein 10                                  168   9e-50   
ref|XP_005651580.1|  E3 ubiquitin ligase SCF complex, Skp subunit       169   1e-49   
gb|EAZ06800.1|  hypothetical protein OsI_29044                          169   1e-49   
gb|KDO67759.1|  hypothetical protein CISIN_1g040816mg                   167   1e-49   
ref|XP_003578534.1|  PREDICTED: SKP1-like protein 1B                    168   2e-49   
emb|CCG34081.1|  SCF ubiquitin ligase                                   168   2e-49   
emb|CAB87835.1|  putative kinetochore protein                           166   2e-49   
gb|KEH29323.1|  SCF ubiquitin ligase, SKP1 component                    171   2e-49   
ref|XP_006393342.1|  hypothetical protein EUTSA_v10012113mg             167   2e-49   
dbj|GAM28869.1|  hypothetical protein SAMD00019534_120450               167   3e-49   
ref|XP_010425103.1|  PREDICTED: SKP1-like protein 16                    167   3e-49   
ref|XP_010512295.1|  PREDICTED: SKP1-like protein 13                    167   3e-49   
ref|NP_001061672.1|  Os08g0375700                                       167   3e-49   
gb|AAT37114.1|  skp1-like protein                                       167   3e-49   
emb|CDY67544.1|  BnaCnng55410D                                          167   5e-49   
gb|AFK43118.1|  unknown                                                 167   6e-49   
gb|KJB47684.1|  hypothetical protein B456_008G036700                    167   6e-49   
ref|XP_008670860.1|  PREDICTED: SKP1-like protein 1A                    167   7e-49   
emb|CCG34071.1|  SCF ubiquitin ligase                                   166   9e-49   
ref|NP_565296.1|  SKP1-like protein 14                                  166   9e-49   
gb|EAZ06798.1|  hypothetical protein OsI_29042                          166   1e-48   
gb|EMS53773.1|  SKP1-like protein 1B                                    166   1e-48   
ref|XP_004965640.1|  PREDICTED: SKP1-like protein 1B-like               166   2e-48   
ref|XP_002878310.1|  hypothetical protein ARALYDRAFT_907522             165   2e-48   
emb|CCG34079.1|  SCF ubiquitin ligase                                   165   2e-48   
gb|KFK44141.1|  hypothetical protein AALP_AA1G220400                    164   2e-48   
ref|XP_002885471.1|  hypothetical protein ARALYDRAFT_898637             165   2e-48   
gb|KHG09322.1|  SKP1-like protein 11                                    167   3e-48   
emb|CCG34069.1|  SCF ubiquitin ligase                                   165   3e-48   
gb|KFK33484.1|  hypothetical protein AALP_AA5G019200                    165   4e-48   
gb|EYU37961.1|  hypothetical protein MIMGU_mgv1a019768mg                165   4e-48   
gb|KCW53209.1|  hypothetical protein EUGRSUZ_J02478                     163   5e-48   
emb|CCG34073.1|  SCF ubiquitin ligase                                   164   8e-48   
emb|CDX80590.1|  BnaC07g28540D                                          163   1e-47   
ref|XP_007899481.1|  PREDICTED: S-phase kinase-associated protein 1     163   1e-47   
ref|XP_006393339.1|  hypothetical protein EUTSA_v10012355mg             162   1e-47   
ref|XP_006436096.1|  hypothetical protein CICLE_v10033955mg             162   1e-47   
ref|XP_010514084.1|  PREDICTED: SKP1-like protein 14                    163   2e-47   
gb|KCW55544.1|  hypothetical protein EUGRSUZ_I01426                     162   3e-47   
gb|KEH29322.1|  SCF ubiquitin ligase, SKP1 component                    162   3e-47   
emb|CCG34070.1|  SCF ubiquitin ligase                                   162   3e-47   
ref|XP_010028737.1|  PREDICTED: SKP1-like protein 1A                    162   3e-47   
ref|XP_004236226.1|  PREDICTED: SKP1-like protein 1B                    162   3e-47   
ref|XP_006292236.1|  hypothetical protein CARUB_v10018443mg             162   3e-47   
ref|XP_004366994.1|  cytosolic glycoprotein FP21                        162   4e-47   
emb|CCG34074.1|  SCF ubiquitin ligase                                   162   5e-47   
ref|XP_004339218.1|  Sphase kinase-associated protein, putative         161   6e-47   
ref|XP_010539834.1|  PREDICTED: SKP1-like protein 1A                    161   6e-47   
ref|XP_646453.1|  cytosolic glycoprotein FP21                           161   7e-47   
emb|CCG34076.1|  SCF ubiquitin ligase                                   161   7e-47   
gb|KFK33482.1|  hypothetical protein AALP_AA5G019000                    161   8e-47   
ref|XP_010241289.1|  PREDICTED: SKP1-like protein 11                    161   9e-47   
pdb|3L2O|A  Chain A, Structure-Based Mechanism Of Dimerization-De...    160   9e-47   
pdb|1FQV|B  Chain B, Insights Into Scf Ubiquitin Ligases From The...    160   1e-46   
ref|XP_003285579.1|  cytosolic glycoprotein FP21                        160   1e-46   
ref|XP_002875195.1|  hypothetical protein ARALYDRAFT_484224             160   1e-46   
ref|XP_644424.1|  cytosolic glycoprotein FP21                           160   1e-46   
ref|XP_010941329.1|  PREDICTED: SKP1-like protein 1A                    161   2e-46   
emb|CBI37864.3|  unnamed protein product                                160   2e-46   
ref|XP_001653700.1|  AAEL009160-PB                                      160   2e-46   
ref|XP_010502325.1|  PREDICTED: SKP1-like protein 14                    160   2e-46   
ref|XP_010033520.1|  PREDICTED: SKP1-like protein 1A                    158   3e-46   
gb|AAV68611.1|  Skp1                                                    160   3e-46   
ref|XP_010028739.1|  PREDICTED: SKP1-like protein 1A                    160   3e-46   
ref|XP_010514085.1|  PREDICTED: SKP1-like protein 14                    159   5e-46   
gb|ACO11039.1|  S-phase kinase-associated protein 1                     159   5e-46   
ref|XP_006347117.1|  PREDICTED: SKP1-like protein 1A-like               159   6e-46   
ref|XP_005694913.1|  PREDICTED: S-phase kinase-associated protein...    159   6e-46   
gb|EFA82657.1|  cytosolic glycoprotein FP21                             159   6e-46   
ref|XP_006395735.1|  hypothetical protein EUTSA_v10005053mg             159   7e-46   
emb|CCG34072.1|  SCF ubiquitin ligase                                   159   7e-46   
gb|KCW55546.1|  hypothetical protein EUGRSUZ_I01426                     158   8e-46   
ref|XP_004006162.1|  PREDICTED: S-phase kinase-associated protein...    158   1e-45   
tpg|DAA42753.1|  TPA: hypothetical protein ZEAMMB73_293473              166   2e-45   
pdb|1P22|B  Chain B, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin ...    157   2e-45   
dbj|BAD26413.1|  putative SKP1                                          158   2e-45   
gb|EAZ08393.1|  hypothetical protein OsI_30653                          157   2e-45   
ref|XP_010506934.1|  PREDICTED: SKP1-like protein 16                    157   2e-45   
gb|ACO11307.1|  S-phase kinase-associated protein 1                     157   2e-45   
ref|XP_005089404.1|  PREDICTED: S-phase kinase-associated protein...    157   2e-45   
ref|XP_006344424.1|  PREDICTED: SKP1-like protein 1B-like               157   2e-45   
emb|CDW53975.1|  SKP1 component                                         157   3e-45   
ref|XP_002765750.1|  glycoprotein FP21 precursor, putative              157   3e-45   
ref|NP_001168727.1|  uncharacterized protein LOC100382519               166   3e-45   
ref|XP_010510863.1|  PREDICTED: SKP1-like protein 14                    157   3e-45   
dbj|BAC19969.1|  putative kinetochore protein                           157   3e-45   
gb|EMT30811.1|  SKP1-like protein 10                                    158   3e-45   
ref|XP_005686366.1|  PREDICTED: S-phase kinase-associated protein...    157   3e-45   
ref|XP_006648624.1|  PREDICTED: SKP1-like protein 4-like                157   3e-45   
gb|KFK33483.1|  hypothetical protein AALP_AA5G019100                    157   3e-45   
gb|KFB39175.1|  AGAP008719-PA-like protein                              157   4e-45   
emb|CDY63159.1|  BnaCnng41550D                                          157   4e-45   
ref|XP_003616611.1|  SKP1-like protein                                  156   5e-45   
gb|ELU10319.1|  hypothetical protein CAPTEDRAFT_176677                  157   5e-45   



>ref|XP_009783395.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
Length=155

 Score =   259 bits (661),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS KMI+LKS+DGETFEV EAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            +RHVD  K++DKA+ED+LKAFD++FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KRHVDATKTEDKASEDELKAFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_009591491.1| PREDICTED: SKP1-like protein 1A [Nicotiana tomentosiformis]
 ref|XP_009782768.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
Length=156

 Score =   258 bits (658),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ KMI+LKS+DGETFEV EAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDP-AKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            +RHVD  AK+DDKA+EDDLK+FDA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVDAVAKTDDKASEDDLKSFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGKTPEEIRKTFNIKNDFTP  141



>gb|AAT99735.1| SKP1 [Nicotiana tabacum]
Length=155

 Score =   257 bits (657),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS KMI+LKS+DGETFEV EAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            +RHVD  K++DKA+ED+LK FD++FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KRHVDATKTEDKASEDELKGFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_006362720.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=155

 Score =   257 bits (657),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS KMI+LKS+DGETFEV EAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            +RHVD +K++DKA+ED+LK FD++FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KRHVDASKTEDKASEDELKTFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_004250723.1| PREDICTED: SKP1-like protein 1A [Solanum lycopersicum]
Length=155

 Score =   256 bits (655),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+S KMI+LKS+DGETFEV EAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MASSKMIVLKSSDGETFEVDEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            +RHVD +K++DKA+ED+LK FDA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KRHVDASKTEDKASEDELKTFDADFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>gb|AFB18000.1| SKP1 protein [Nicotiana tabacum]
Length=155

 Score =   255 bits (652),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS KMI+LKS+DGETFEV EAVALESQTIKHMIEDDCA T IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCAGTSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            +RHVD  K++DKA+ED+LK FD++FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KRHVDATKTEDKASEDELKGFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>gb|ABB77425.1| Skp1-like protein 3 [Petunia integrifolia subsp. inflata]
 gb|ACT35736.1| SKP1-like 2 [Petunia x hybrida]
Length=155

 Score =   253 bits (646),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ KMI+LKS+DGETF+V E+VALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFQVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            +RHV+  KS+DKA+ED+LK+FD++FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KRHVEANKSEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>gb|AAX83944.1| Skp1 [Capsicum annuum]
Length=156

 Score =   252 bits (643),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 135/141 (96%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+PK ILLKS+DGETFEV EAVALESQTIKHMIEDDCA+T IPLPNVTSKIL+KV+EYC
Sbjct  1    MSAPKKILLKSSDGETFEVDEAVALESQTIKHMIEDDCANTSIPLPNVTSKILSKVVEYC  60

Query  243  RRHVDP-AKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            ++HVD  AK++DKA+EDDLK+FD+EFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVDAGAKTEDKASEDDLKSFDSEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGKTPEEIRKTFNIKNDFTP  141



>gb|ACA61785.1| SKP1-like protein 3 [Petunia x hybrida]
Length=155

 Score =   251 bits (642),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ KMI+LKS+DGETF+V E+VALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFQVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            +RHV+  K++DKA+ED+LK+FD++FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KRHVEANKAEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_009620406.1| PREDICTED: SKP1-like protein 1A [Nicotiana tomentosiformis]
Length=153

 Score =   251 bits (640),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 133/138 (96%), Gaps = 1/138 (1%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KMI+LKS+DGETFEV E+VA+ESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC+RHV
Sbjct  2    KMIVLKSSDGETFEVEESVAVESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  255  DPA-KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  431
            D A K++DKA EDDLKAFDA+FVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  121

Query  432  TPEEIRKTFNIKNDFTPE  485
            TPEEIRKTFNIKNDFTP+
Sbjct  122  TPEEIRKTFNIKNDFTPD  139



>gb|ABB77426.1| Skp1-like protein 1 [Petunia integrifolia subsp. inflata]
 gb|ACA61786.1| SKP1-like protein 4 [Petunia x hybrida]
Length=156

 Score =   251 bits (640),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 133/141 (94%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ KMI+LKS+DGETFEV E+VALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFEVEESVALESQTIKHMIEDDCADSSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPA-KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            +RHV+ A K+DDK +E+DLK FDAEFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVEAAAKTDDKVSEEDLKNFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGKTPEEIRKTFNIKNDFTP  141



>ref|XP_009779583.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
 gb|AAC63273.1| SKP1-like protein [Nicotiana clevelandii]
Length=153

 Score =   250 bits (639),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 132/137 (96%), Gaps = 1/137 (1%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KMI+L+S+DGETFEV E+VALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC+RHV
Sbjct  2    KMIVLRSSDGETFEVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  255  DPA-KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  431
            D A K++DKA EDDLKAFDA+FVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  121

Query  432  TPEEIRKTFNIKNDFTP  482
            TPEEIRKTFNIKNDFTP
Sbjct  122  TPEEIRKTFNIKNDFTP  138



>gb|ACA61784.1| SKP1-like protein 2 [Petunia x hybrida]
 gb|ACT35738.1| SKP1-like 1 [Petunia x hybrida]
Length=154

 Score =   250 bits (638),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + KMI+LKS+DGETF+V E+VA+ESQTIKHMIEDDCAD+ IPLPNVTS+ILAKVIEYC+R
Sbjct  2    AEKMIVLKSSDGETFQVEESVAVESQTIKHMIEDDCADSSIPLPNVTSQILAKVIEYCKR  61

Query  249  HVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG  428
            HV+ +KS+DKA EDDLK+FDA+FVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG
Sbjct  62   HVEASKSEDKATEDDLKSFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG  121

Query  429  KTPEEIRKTFNIKNDFTP  482
            KTPEEIRKTFNIKNDFTP
Sbjct  122  KTPEEIRKTFNIKNDFTP  139



>ref|XP_009624361.1| PREDICTED: SKP1-like protein 1A isoform X1 [Nicotiana tomentosiformis]
Length=153

 Score =   249 bits (637),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 133/138 (96%), Gaps = 1/138 (1%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KMI+LKS+DGETFEV E+VA+ESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC+RHV
Sbjct  2    KMIVLKSSDGETFEVEESVAVESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  255  DPA-KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  431
            D A K++DK+ EDDLKAFDA+FVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKSVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  121

Query  432  TPEEIRKTFNIKNDFTPE  485
            TPEEIRKTFNIKNDFTP+
Sbjct  122  TPEEIRKTFNIKNDFTPD  139



>ref|XP_009624363.1| PREDICTED: SKP1-like protein 1A isoform X2 [Nicotiana tomentosiformis]
Length=153

 Score =   249 bits (635),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 1/137 (1%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KMI+LKS+DGETFEV E+VA+ESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC+RHV
Sbjct  2    KMIVLKSSDGETFEVEESVAVESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  255  DPA-KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  431
            D A K++DK+ EDDLKAFDA+FVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKSVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  121

Query  432  TPEEIRKTFNIKNDFTP  482
            TPEEIRKTFNIKNDFTP
Sbjct  122  TPEEIRKTFNIKNDFTP  138



>ref|XP_004512164.1| PREDICTED: SKP1-like protein 1A-like [Cicer arietinum]
Length=155

 Score =   249 bits (635),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+DGE FEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSTKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+ A SDDK  EDDLKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEAASSDDKPTEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>gb|AAO85510.1| SKP1 [Nicotiana benthamiana]
Length=153

 Score =   248 bits (634),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 1/137 (1%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KMI+L+S+DGETFEV E+VALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC+RHV
Sbjct  2    KMIVLRSSDGETFEVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  255  DPA-KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  431
            D A K++DKA EDDLKAFDA+FVKVDQSTLFDLILAANYLNIK LLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKRLLDLTCQTVADMIKGK  121

Query  432  TPEEIRKTFNIKNDFTP  482
            TPEEIRKTFNIKNDFTP
Sbjct  122  TPEEIRKTFNIKNDFTP  138



>gb|ACA61783.1| SKP1-like protein 1 [Petunia x hybrida]
Length=155

 Score =   248 bits (633),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ KMI+LKS+DGETF+V E+VALES T KHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFQVEESVALESXTXKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            +RHV+  KS+DKA+ED+LK+FD++FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KRHVEANKSEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>gb|KHN41877.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   248 bits (632),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+DGE FEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSAKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+ A  +DK +EDDLKA+DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEAANPEDKPSEDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_008393845.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
 gb|ACB87913.1| SKP1-like protein 1 [Malus domestica]
Length=156

 Score =   247 bits (630),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS K I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            RHVD AK D+K +EDDLKA+D EFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIK
Sbjct  63   RHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNI NDFTP
Sbjct  123  GKTPEEIRKTFNINNDFTP  141



>gb|ABB77427.1| Skp1-like protein 2 [Petunia integrifolia subsp. inflata]
Length=154

 Score =   246 bits (629),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + KMI+LKS+DGETF+V E+VA+ESQTIKHMIEDDCAD+ IPLPNVTS+ILAKVIEYC+R
Sbjct  2    AEKMIVLKSSDGETFQVEESVAVESQTIKHMIEDDCADSSIPLPNVTSQILAKVIEYCKR  61

Query  249  HVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG  428
            HV+ +K++DKA EDDLK+FDA+FVKVDQS LFDLILAANYLNIKSLLDLTCQTVADMIKG
Sbjct  62   HVEASKTEDKATEDDLKSFDADFVKVDQSMLFDLILAANYLNIKSLLDLTCQTVADMIKG  121

Query  429  KTPEEIRKTFNIKNDFTP  482
            KTPEEIRKTFNIKNDFTP
Sbjct  122  KTPEEIRKTFNIKNDFTP  139



>ref|XP_009379340.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=156

 Score =   246 bits (628),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS K I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            RHVD AK D+K +EDDLKA+D EFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIK
Sbjct  63   RHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFT  479
            GKTPEEIRKTFNIKNDFT
Sbjct  123  GKTPEEIRKTFNIKNDFT  140



>gb|AII79402.1| S-phase kinase-associated protein 1-like protein 5 [Malus hupehensis]
Length=156

 Score =   246 bits (628),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS K I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            RHVD AK D+K +EDDLKA+D EFVKVDQ+TLFDLILAANYLNIK LLDLTCQTVADMIK
Sbjct  63   RHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            G+TPEEIRKTFNIKNDFTP
Sbjct  123  GRTPEEIRKTFNIKNDFTP  141



>ref|XP_006360903.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=150

 Score =   246 bits (627),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI+L+S+DGETFEV EAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC+RHV+
Sbjct  1    MIVLRSSDGETFEVDEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHVE  60

Query  258  PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  437
              K++DK  E+DLK FDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP
Sbjct  61   VPKTEDKTAEEDLKTFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  120

Query  438  EEIRKTFNIKNDFTP  482
            EEIRKTFNIKNDFTP
Sbjct  121  EEIRKTFNIKNDFTP  135



>ref|XP_008337985.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
Length=156

 Score =   246 bits (627),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS K I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD AK D+K +EDDLKA+D EFVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVADMIK
Sbjct  63   KHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKTLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>ref|XP_007157884.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris]
 gb|AGV54260.1| SKP1-like protein [Phaseolus vulgaris]
 gb|ESW29878.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris]
Length=155

 Score =   245 bits (626),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGE FEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSARKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HVD A  DDK +E+DLKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVDAANPDDKPSEEDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|NP_001235929.1| uncharacterized protein LOC100527683 [Glycine max]
 gb|ACU16825.1| unknown [Glycine max]
Length=155

 Score =   245 bits (625),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+DGE FEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSAKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+ A  +DK +EDDLKA+ AEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEAANPEDKPSEDDLKAWAAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_003517160.1| PREDICTED: SKP1-like protein 1A-like [Glycine max]
 gb|KHN36011.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   245 bits (625),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+DGE FEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSAKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+ A  +DK +EDDLKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEAANPEDKPSEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_003612227.1| SKP1-like protein [Medicago truncatula]
 gb|ABG27020.1| SKP1-like b [Medicago truncatula]
 gb|ACJ84134.1| unknown [Medicago truncatula]
 gb|ACJ85945.1| unknown [Medicago truncatula]
 gb|AES95185.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
 gb|AFK39072.1| unknown [Medicago truncatula]
Length=155

 Score =   244 bits (623),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGETFEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HVD A +++K NED+LK++D+EFVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVADMI
Sbjct  61   KKHVDAAAAEEKPNEDELKSWDSEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDF+P
Sbjct  121  KGKTPEEIRKTFNIKNDFSP  140



>emb|CDP14555.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   244 bits (622),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 133/142 (94%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSSPK+I+LKS+DGETFEV E VALESQTIKHMIED+CADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSSPKIIVLKSSDGETFEVEELVALESQTIKHMIEDNCADTCIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDD--KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+  KS D  K++++DLK+FDA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVEAPKSSDGDKSSDEDLKSFDADFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>gb|AII79401.1| S-phase kinase-associated protein 1-like protein 4 [Malus hupehensis]
Length=156

 Score =   243 bits (621),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS K I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD AK D+K +EDDLKA+D EFVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVADMIK
Sbjct  63   KHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKTLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFT  479
            GKTPEEIRKTFNIKNDFT
Sbjct  123  GKTPEEIRKTFNIKNDFT  140



>ref|XP_007202708.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica]
 gb|EMJ03907.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica]
Length=156

 Score =   242 bits (618),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS K I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD AK D+K +EDDLKA+D +FVKVDQ+TLFDLILAANYLNIK LLDLTCQTVADMIK
Sbjct  63   KHVDAAKPDEKISEDDLKAWDQDFVKVDQATLFDLILAANYLNIKLLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>ref|XP_009363460.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=156

 Score =   242 bits (618),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS K I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD AK D+K +EDDLKA+D EFVKVDQ TLFDLILAANYLNIK+LLDLTCQTVADMIK
Sbjct  63   KHVDAAKPDEKISEDDLKAWDQEFVKVDQVTLFDLILAANYLNIKTLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFT  479
            GKTPEEIRKTFNIKNDFT
Sbjct  123  GKTPEEIRKTFNIKNDFT  140



>gb|AAD34458.1| Skp1 [Medicago sativa]
Length=153

 Score =   242 bits (617),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            + I LKS+DGETFEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC++HV
Sbjct  3    RKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCKKHV  62

Query  255  DPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  434
            D A ++DK NED+LK++D+EFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKGKT
Sbjct  63   DAAAAEDKPNEDELKSWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  122

Query  435  PEEIRKTFNIKNDFTP  482
            PEEIRKTFNIKNDF+P
Sbjct  123  PEEIRKTFNIKNDFSP  138



>ref|XP_007225985.1| hypothetical protein PRUPE_ppa012755mg [Prunus persica]
 ref|XP_008221225.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
 gb|AFJ21662.1| Skp1-like protein 1 [Prunus avium]
 gb|EMJ27184.1| hypothetical protein PRUPE_ppa012755mg [Prunus persica]
Length=156

 Score =   241 bits (616),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 131/141 (93%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGETFEV EAVALESQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALESQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDK-ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            ++HVD AK DD+ +N++DLKA+D +FVK+DQ+TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVDAAKPDDRPSNDEDLKAWDTDFVKIDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGKTPEEIRKTFNIKNDFTP  141



>ref|XP_003612225.1| SKP1-like protein [Medicago truncatula]
 gb|ABG27019.1| SKP1-like a [Medicago truncatula]
 gb|ACJ83981.1| unknown [Medicago truncatula]
 gb|AES95183.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
 gb|AFK47584.1| unknown [Medicago truncatula]
Length=155

 Score =   241 bits (615),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGETFEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+ A +++K +ED++K++D EFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEAAAAEEKPSEDEIKSWDGEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDF+P
Sbjct  121  KGKTPEEIRKTFNIKNDFSP  140



>ref|XP_006422586.1| hypothetical protein CICLE_v10029465mg [Citrus clementina]
 ref|XP_006486726.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR35826.1| hypothetical protein CICLE_v10029465mg [Citrus clementina]
 gb|KDO68088.1| hypothetical protein CISIN_1g031498mg [Citrus sinensis]
Length=158

 Score =   241 bits (614),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 129/144 (90%), Gaps = 3/144 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+DGETFEV E VALESQTIKHM+EDDCADTVIPLPNVTS IL+KVIEYC
Sbjct  1    MSSEKKITLKSSDGETFEVEETVALESQTIKHMVEDDCADTVIPLPNVTSTILSKVIEYC  60

Query  243  RRHVDPA---KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV+     K DDK+ EDDLK +DA+FVKVDQ+TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KKHVEAGSGDKKDDKSTEDDLKTWDADFVKVDQNTLFDLILAANYLNIKGLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTPE  485
            DMIKGKTPEEIRKTFNIKNDF+P+
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFSPD  144



>ref|XP_006359705.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=156

 Score =   240 bits (613),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSSP  ILLKS+DGE FEV EAVALESQTIKH+IEDDCA + IPLPNVTSKILAKVIEY 
Sbjct  1    MSSPTKILLKSSDGEVFEVDEAVALESQTIKHLIEDDCAGSNIPLPNVTSKILAKVIEYS  60

Query  243  RRHVDPA-KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            +RHV+ + K++DKA ED+LK FDAEFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVEASSKTEDKAAEDELKVFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGKTPEEIRKTFNIKNDFTP  141



>ref|XP_009334694.1| PREDICTED: SKP1-like protein 1B [Pyrus x bretschneideri]
Length=156

 Score =   240 bits (612),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 131/141 (93%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGETFEV EAVALESQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALESQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDK-ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            R+HV+ AK +++ A ++DLKA+DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   RKHVEAAKPEERPAVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGKTPEEIRKTFNIKNDFTP  141



>ref|XP_006435227.1| hypothetical protein CICLE_v10002751mg [Citrus clementina]
 ref|XP_006473700.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR48467.1| hypothetical protein CICLE_v10002751mg [Citrus clementina]
Length=158

 Score =   240 bits (612),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 130/143 (91%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ K I LKS+DGE FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTSKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKAN---EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV+ +KSDD+A    +DDLKA+D +FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KKHVEASKSDDRATSGVDDDLKAWDTDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>gb|ACJ86090.1| unknown [Medicago truncatula]
Length=155

 Score =   239 bits (611),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGETFEV EAVALESQTIKHMIEDDCAD+ IPLPNV SKILAKVIEYC
Sbjct  1    MSSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVASKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+ A +++K +ED++K++D EFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEAAAAEEKPSEDEIKSWDGEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDF+P
Sbjct  121  KGKTPEEIRKTFNIKNDFSP  140



>ref|XP_008357122.1| PREDICTED: SKP1-like protein 1B [Malus domestica]
 gb|AII79405.1| S-phase kinase-associated protein 1-like protein 2 [Malus hupehensis]
Length=156

 Score =   239 bits (610),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGETFEV EAVAL SQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANED-DLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            R+HV+ AK +++A+ D DLKA+DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   RKHVEAAKPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGKTPEEIRKTFNIKNDFTP  141



>ref|XP_004231049.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=156

 Score =   239 bits (610),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+P  ILLKS+DGE FEV EAVALESQTIKH+IEDDCA + IPLPNVTSKILAKVIEY 
Sbjct  1    MSTPTKILLKSSDGEVFEVDEAVALESQTIKHLIEDDCAGSNIPLPNVTSKILAKVIEYS  60

Query  243  RRHVDPA-KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            +RHV+ + K++DKA ED+LK FDAEFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVEASSKTEDKAAEDELKVFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGKTPEEIRKTFNIKNDFTP  141



>ref|XP_004287783.1| PREDICTED: SKP1-like protein 1A [Fragaria vesca subsp. vesca]
Length=156

 Score =   239 bits (610),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS K I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSAKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD AK D+K  E++LK +D +FVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVADMIK
Sbjct  63   KHVDAAKPDEKVTEEELKVWDQDFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>gb|AFK44762.1| unknown [Lotus japonicus]
Length=155

 Score =   239 bits (610),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+DGE FEV EAVALES+TIKHM+EDDCAD+ IPLPN TSKILAKVIEYC
Sbjct  1    MSSAKKITLKSSDGEAFEVDEAVALESRTIKHMVEDDCADSGIPLPNATSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+ A  D+K  ED+LKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEAANPDEKPTEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_002510576.1| skp1, putative [Ricinus communis]
 gb|EEF52763.1| skp1, putative [Ricinus communis]
Length=157

 Score =   239 bits (609),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 131/142 (92%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ + I LKS+DGETFEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTSRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+ +KSDD+ +  +D+LK +DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVETSKSDDRPSSVDDELKTWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>ref|XP_002510577.1| skp1, putative [Ricinus communis]
 gb|EEF52764.1| skp1, putative [Ricinus communis]
Length=157

 Score =   239 bits (609),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 131/142 (92%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ K I LKS+DGETFEV E VALESQTIKHMIEDDCAD+ IPLPNVTSKIL+KVIEYC
Sbjct  1    MSAGKKITLKSSDGETFEVEELVALESQTIKHMIEDDCADSGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+  KS+D+ +  +DDLKA+DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVETPKSEDRPSSADDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>ref|XP_007156190.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris]
 gb|ESW28184.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris]
Length=155

 Score =   238 bits (608),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+S K I LKS+DGE FEV E VALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MASTKKITLKSSDGEAFEVDEIVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+   +D+K  ED+LKA+DAEFVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVADMI
Sbjct  61   KKHVEANSADEKPTEDELKAWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_010266012.1| PREDICTED: SKP1-like protein 1B [Nelumbo nucifera]
Length=154

 Score =   238 bits (607),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K + LKS+DGETF+V EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC++
Sbjct  2    SGKKVTLKSSDGETFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKK  61

Query  249  HVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG  428
            HV+  K+DD+  ED+LK +DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKG
Sbjct  62   HVETPKTDDRGAEDELKNWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKG  121

Query  429  KTPEEIRKTFNIKNDFTP  482
            KTPEEIRKTFNIKNDFTP
Sbjct  122  KTPEEIRKTFNIKNDFTP  139



>ref|NP_001241052.1| uncharacterized protein LOC100798104 [Glycine max]
 gb|ACU21125.1| unknown [Glycine max]
 gb|KHN00453.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   238 bits (606),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+S K I LKS+DGE FEV EAVA+ESQTIKHMIED+CAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MASTKKITLKSSDGEAFEVEEAVAVESQTIKHMIEDNCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+   +D+K +ED+LKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEANCADEKPSEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>gb|AFM75900.1| GSK1 [Gossypium hirsutum]
 gb|AFP55363.1| SKP1-like protein [Gossypium hirsutum]
 gb|KHG25005.1| SKP1-like protein 1B [Gossypium arboreum]
 gb|KJB17605.1| hypothetical protein B456_003G007300 [Gossypium raimondii]
Length=156

 Score =   238 bits (606),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS + I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HV+  K+DD++ +D+LK++DA+FVKVDQ+TLFDLILAANYLNIK LLDLTCQTVADMIK
Sbjct  63   KHVEAPKTDDRSADDELKSWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>ref|XP_010033522.1| PREDICTED: SKP1-like protein 1B [Eucalyptus grandis]
 gb|KCW53208.1| hypothetical protein EUGRSUZ_J02478 [Eucalyptus grandis]
Length=155

 Score =   238 bits (606),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I L+S+DGE+FEV EAVA+ESQTIKHMIEDDCAD+ IPLPNVTS+ILAKVIEYC
Sbjct  1    MSSAKKITLRSSDGESFEVDEAVAVESQTIKHMIEDDCADSGIPLPNVTSRILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+ AK DD+  EDDLKA+DAEFVKVDQ+TLFDLILAANYLNIK LLDLTC TVADMI
Sbjct  61   KKHVESAKPDDRTTEDDLKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCLTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPE+IRK+F+IKNDFTP
Sbjct  121  KGKTPEDIRKSFSIKNDFTP  140



>gb|ACU13236.1| unknown [Glycine max]
Length=155

 Score =   237 bits (605),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+S K I LKS+DGE FEV EAVA+ESQTIKHM+ED+CAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MASTKKITLKSSDGEAFEVEEAVAVESQTIKHMVEDNCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+   +D+K +ED+LKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEANCADEKPSEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_011092967.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=169

 Score =   237 bits (605),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 131/157 (83%), Gaps = 15/157 (10%)
 Frame = +3

Query  48   FSAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAK  227
             S+   +S KMI+LKS+DGETFEV EAVA+ESQTIKHMIED+CADT IPLPNVTSKILAK
Sbjct  1    MSSGDAASSKMIVLKSSDGETFEVEEAVAVESQTIKHMIEDNCADTCIPLPNVTSKILAK  60

Query  228  VIEYCRRHVD------------PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYL  371
            VIEYC+RHVD            PA   DK  ++DLKAFD EFVKVDQ TLFDLILAANYL
Sbjct  61   VIEYCKRHVDAAAKANADGALTPA---DKVVDEDLKAFDTEFVKVDQGTLFDLILAANYL  117

Query  372  NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  118  NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  154



>ref|NP_001235349.1| uncharacterized protein LOC100306458 [Glycine max]
 gb|ACU14645.1| unknown [Glycine max]
 gb|KHN35539.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   236 bits (602),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+S K I LKS+DGE FEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MASTKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+   +D+K +ED LKA+D +FV VDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KKHVEANSADEKPSEDVLKAWDVDFVNVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_007046627.1| S phase kinase-associated protein 1 [Theobroma cacao]
 gb|EOX90784.1| S phase kinase-associated protein 1 [Theobroma cacao]
Length=156

 Score =   236 bits (602),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS + I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HV+  K++D+  ED+LK +DA+FVKVDQ+TLFDLILAANYLNIK LLDLTCQTVADMIK
Sbjct  63   KHVEAPKTEDRTAEDELKNWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>ref|XP_011088616.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=166

 Score =   236 bits (602),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 128/146 (88%), Gaps = 7/146 (5%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            ++ KMI+LKS+DGETFEV EAVA ESQTIKHMIED+CADT IPLPNVTSKILAKVIEYC+
Sbjct  6    AAQKMIVLKSSDGETFEVEEAVAPESQTIKHMIEDNCADTSIPLPNVTSKILAKVIEYCK  65

Query  246  RHVDPAKSD-------DKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQ  404
            RHVD A          DK  EDDLKAFDAEFVKVDQ TLFDLILAANYLNIKSLLDLTCQ
Sbjct  66   RHVDAAAKASADATASDKVAEDDLKAFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQ  125

Query  405  TVADMIKGKTPEEIRKTFNIKNDFTP  482
            TVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  126  TVADMIKGKTPEEIRKTFNIKNDFTP  151



>ref|XP_010680409.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=158

 Score =   236 bits (601),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+S + I LKS+DGETFEV E+VALESQTIKHM+EDDCAD VIPLPNVTSKILAKVIEYC
Sbjct  1    MASTRKITLKSSDGETFEVEESVALESQTIKHMVEDDCADNVIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKS---DDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HVD  KS   +D+  +D+LK +DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KKHVDFPKSSENNDRQVDDELKTWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>gb|ACP20181.1| SKP1-like protein [Citrus maxima]
Length=158

 Score =   235 bits (600),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 3/144 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+DGETFEV E VALESQTIKH +EDDCADTVIPLPNVTS IL+KVIEYC
Sbjct  1    MSSEKKITLKSSDGETFEVEETVALESQTIKHTVEDDCADTVIPLPNVTSTILSKVIEYC  60

Query  243  RRHVDPA---KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV+     K DDK+  DDLK +DA+FVKVDQ+TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KKHVEAGSGDKKDDKSTVDDLKTWDADFVKVDQNTLFDLILAANYLNIKGLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTPE  485
            DMIKGKTPEEIRKTFNIKNDF+P+
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFSPD  144



>gb|KJB63489.1| hypothetical protein B456_010G002100 [Gossypium raimondii]
Length=158

 Score =   235 bits (599),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ + I+LKS+DGE FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC+
Sbjct  3    STGRKIILKSSDGENFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  62

Query  246  RHVDPAKSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            +HV+ +KS+D++   +DDLKA+DA+FVKVDQ+TLFDLILAANYLNIK LLDLTCQTVADM
Sbjct  63   KHVEASKSEDRSASLDDDLKAWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM  122

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  123  IKGKTPEEIRKTFNIKNDFTP  143



>gb|KDP36889.1| hypothetical protein JCGZ_08180 [Jatropha curcas]
Length=157

 Score =   235 bits (599),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ + I LKSADGETFEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTGRKITLKSADGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+  KSDD+ +  +++LK +DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVETPKSDDRPSSADEELKTWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>ref|XP_002301954.1| hypothetical protein POPTR_0002s02020g [Populus trichocarpa]
 ref|XP_011034986.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
 gb|ABK94461.1| unknown [Populus trichocarpa]
 gb|EEE81227.1| hypothetical protein POPTR_0002s02020g [Populus trichocarpa]
Length=157

 Score =   235 bits (599),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS +   LKS+DGE FEV EAVALESQTIKHMIE+DCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSSSRKFTLKSSDGEAFEVDEAVALESQTIKHMIEEDCADNAIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+  KSDD+ +  +DDLK++DAEFVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVAD
Sbjct  61   KKHVETPKSDDRPSSADDDLKSWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>ref|XP_003621661.1| SKP1-like protein [Medicago truncatula]
 gb|AES77879.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   234 bits (598),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ K + LKS+D ETFEV EAVALESQTIKHMIEDDC D  IP+PNVT +ILAKVIEYC+
Sbjct  3    STTKKMTLKSSDNETFEVPEAVALESQTIKHMIEDDCTDNGIPVPNVTGQILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD A SD+K +EDDLK +DAEFVKVDQ TLFDLILAANYLNIKSLLDLTCQ+VADMIK
Sbjct  63   KHVDAASSDEKPSEDDLKNWDAEFVKVDQDTLFDLILAANYLNIKSLLDLTCQSVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>ref|XP_004512165.1| PREDICTED: SKP1-like protein 1A-like [Cicer arietinum]
Length=155

 Score =   234 bits (597),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS +   LKS+DGE FEV EAVA+ESQTIKHMIEDDCA   IPLPNVTSKILAKVIEYC
Sbjct  1    MSSTRKFTLKSSDGEAFEVDEAVAVESQTIKHMIEDDCAGNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+ A SDDK  EDDLKA+D++FVKVDQ+TLF+LILAANYLNIK+LLDLTC TVADMI
Sbjct  61   KKHVEAATSDDKPTEDDLKAWDSDFVKVDQATLFELILAANYLNIKNLLDLTCMTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>gb|ABS17589.1| SKP1 component-like 1 [Humulus lupulus]
Length=157

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ + I LKS+DGET EV EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTGRKITLKSSDGETLEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV   K++D+A+  +D+LKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVGAPKAEDRASSVDDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>gb|EPS66410.1| hypothetical protein M569_08366, partial [Genlisea aurea]
Length=168

 Score =   234 bits (598),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 131/153 (86%), Gaps = 9/153 (6%)
 Frame = +3

Query  51   SAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKV  230
            S+   +S K I L+S+DGE FEV EAVA+ESQTIKHMIEDDCAD+VIPLPNV  KIL+KV
Sbjct  1    SSGAENSSKKITLRSSDGEIFEVEEAVAVESQTIKHMIEDDCADSVIPLPNVHGKILSKV  60

Query  231  IEYCRRHVD----PAKSDDKAN-----EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKS  383
            IEYCRRHV+     AKSDDK +     ++DLK+FDAEFVKVDQ TLFDLILAANYLNIKS
Sbjct  61   IEYCRRHVEVGASAAKSDDKVSSALSPDEDLKSFDAEFVKVDQGTLFDLILAANYLNIKS  120

Query  384  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LLDLTCQTVADMIKGKTPEEIRKTFNIKNDF+P
Sbjct  121  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFSP  153



>ref|XP_008445323.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=157

 Score =   234 bits (596),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGE FEV EAVALESQTIKHMIEDDCAD+ IPLPNVTSKIL+KVIEYC
Sbjct  1    MSSGRKITLKSSDGEIFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+  K +D+    +DDLK +D+EFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVESPKPEDRTGSVDDDLKTWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>ref|XP_004248654.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=150

 Score =   234 bits (596),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI+L+ +DGETFEV +AVALESQTIKHMIEDDCADT IPLPN+TSKILA VIEYC+RH++
Sbjct  1    MIVLRCSDGETFEVDKAVALESQTIKHMIEDDCADTSIPLPNITSKILALVIEYCKRHLE  60

Query  258  PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  437
             AK +D+  E+DLK FDAEFVKVDQSTLF+LILAANYLNIKSL+DLTCQTVA+MIKGKTP
Sbjct  61   VAKVEDQTAEEDLKTFDAEFVKVDQSTLFNLILAANYLNIKSLMDLTCQTVAEMIKGKTP  120

Query  438  EEIRKTFNIKNDFTP  482
            EEIRKTFNIKNDFTP
Sbjct  121  EEIRKTFNIKNDFTP  135



>gb|KHG24597.1| SKP1-like protein 1B [Gossypium arboreum]
Length=158

 Score =   234 bits (596),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ + I+LKS+DGE FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC+
Sbjct  3    STGRKIILKSSDGENFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  62

Query  246  RHVDPAKSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            +HV+ +KS+D++   +DDLK +DA+FVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVADM
Sbjct  63   KHVEASKSEDRSASLDDDLKGWDADFVKVDQATLFDLILAANYLNIKALLDLTCQTVADM  122

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  123  IKGKTPEEIRKTFNIKNDFTP  143



>ref|XP_004248653.2| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=160

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI+L+S+DGETFEV +AVALESQTIKHMIED+CADT IPLPN+TSKILA VIEYC+RH++
Sbjct  11   MIVLRSSDGETFEVDKAVALESQTIKHMIEDNCADTSIPLPNITSKILALVIEYCKRHLE  70

Query  258  PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  437
             AK +DK  E+DLK FDAEFVKVDQSTLF+LILA NYLNIKSL+DLTCQTVA+MIKGKTP
Sbjct  71   VAKVEDKIAEEDLKTFDAEFVKVDQSTLFNLILAVNYLNIKSLMDLTCQTVAEMIKGKTP  130

Query  438  EEIRKTFNIKNDFTP  482
            EEIRKTFNIKNDFTP
Sbjct  131  EEIRKTFNIKNDFTP  145



>ref|XP_002306950.1| hypothetical protein POPTR_0005s26450g [Populus trichocarpa]
 gb|ABK95554.1| unknown [Populus trichocarpa]
 gb|EEE93946.1| hypothetical protein POPTR_0005s26450g [Populus trichocarpa]
Length=157

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 129/142 (91%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ +  +LKS+DGE+FEV EAVA+ESQTIKHMIEDDCAD  IPLPNVTSK+LAKVIEYC
Sbjct  1    MSTGRKFILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTSKVLAKVIEYC  60

Query  243  RRHVDPAKSDDKANE--DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+  KSDD+ +   DDLKA+DAEFVKVDQ+TLFDLILAANYLNIK+LLDLTCQ VAD
Sbjct  61   KKHVESPKSDDRPSSAADDLKAWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQRVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>gb|KEH23694.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   233 bits (594),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ K I LKS+D ETFEV EAVALESQTIKHMIEDDC D  IP+PNVT +ILAKVIEYC+
Sbjct  3    STSKKITLKSSDNETFEVPEAVALESQTIKHMIEDDCTDNGIPVPNVTGQILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD   SD+K +EDDLK +DAEFVKVDQ  LFDLILAANYLNIKSLLDLTCQTVADMIK
Sbjct  63   KHVDAESSDEKPSEDDLKNWDAEFVKVDQDKLFDLILAANYLNIKSLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>ref|XP_007041813.1| S phase kinase-associated protein 1 [Theobroma cacao]
 gb|EOX97644.1| S phase kinase-associated protein 1 [Theobroma cacao]
Length=156

 Score =   233 bits (593),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ K I+L+S+DGE FEV EAVA+ESQTIKHMIEDDCAD  IP+PNVTSKILAKV+EYC+
Sbjct  3    STSKKIMLRSSDGEAFEVEEAVAVESQTIKHMIEDDCADNEIPVPNVTSKILAKVLEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD A   +K  EDDLK +DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVA+MIK
Sbjct  63   KHVDAAADKEKIPEDDLKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVAEMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>gb|KJB15832.1| hypothetical protein B456_002G198700 [Gossypium raimondii]
Length=156

 Score =   233 bits (593),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ + I+L+S+DGETFEV EAVA+ESQTIKHMIEDDCAD  IPLPNVTSKIL+KV+EYC+
Sbjct  3    STSRKIMLRSSDGETFEVEEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILSKVLEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD     +K  +D+LKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIK
Sbjct  63   KHVDAVADKEKTPDDELKAWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>gb|KHG30151.1| SKP1-like protein 1A [Gossypium arboreum]
Length=156

 Score =   233 bits (593),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ + I+L+S+DGETFEV EAVA+ESQTIKHMIEDDCAD  IPLPNVTSKIL+KV+EYC+
Sbjct  3    STSRKIMLRSSDGETFEVEEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILSKVLEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD A   +K  +D+LK +DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIK
Sbjct  63   KHVDAAADKEKTPDDELKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>gb|EYU17579.1| hypothetical protein MIMGU_mgv1a015014mg [Erythranthe guttata]
Length=170

 Score =   233 bits (593),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 131/153 (86%), Gaps = 9/153 (6%)
 Frame = +3

Query  51   SAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKV  230
            S+   +  K I L+S+DGE FEV +AVA+ESQTIKHMIEDDCAD VIPLPNVT KIL+KV
Sbjct  3    SSTAENGGKKITLRSSDGEVFEVEDAVAVESQTIKHMIEDDCADNVIPLPNVTGKILSKV  62

Query  231  IEYCRRHVDPA----KSDDK-----ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKS  383
            IEYC+RHVD A    K+DDK     A+++DLK FDA+FVKVDQ+TLFDLILAANYLNIKS
Sbjct  63   IEYCKRHVDAAASATKADDKLASAAASDEDLKVFDADFVKVDQATLFDLILAANYLNIKS  122

Query  384  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  123  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  155



>ref|XP_004144851.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 ref|XP_004163420.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN43257.1| hypothetical protein Csa_7G012950 [Cucumis sativus]
Length=155

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I+L+S+DGETF+V E VA+ESQTIKHMIEDDCADTVIPLPNVTS IL+KVIEYC
Sbjct  1    MSSSKKIVLRSSDGETFDVDEIVAVESQTIKHMIEDDCADTVIPLPNVTSAILSKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            + HV+    D K  +D LK +DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KMHVETDDKDSKVIDDTLKTWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>gb|KDP23982.1| hypothetical protein JCGZ_25370 [Jatropha curcas]
Length=158

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+DGE FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKAN---EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV+  KSDD++N   +D+LK +DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KKHVETPKSDDRSNGSADDELKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTP+EIR+ FNIK+DFTP
Sbjct  121  DMIKGKTPDEIREIFNIKDDFTP  143



>ref|XP_004143010.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 ref|XP_004161077.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN62264.1| hypothetical protein Csa_2G346050 [Cucumis sativus]
Length=157

 Score =   232 bits (591),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 127/142 (89%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGE FEV EAVALESQTIKHMIEDDCAD+ IPLPNV SKIL+KVIEYC
Sbjct  1    MSSGRKITLKSSDGEIFEVDEAVALESQTIKHMIEDDCADSGIPLPNVNSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+  K +D+    +DDLK +D+EFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVESPKPEDRTGSVDDDLKTWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>gb|ABK96569.1| unknown [Populus trichocarpa x Populus deltoides]
Length=158

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I L+S+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSGRKISLRSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKA---NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV+  KS+D+     +D+LK +D EFV+VDQ+TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KKHVETPKSEDRGTNSGDDELKNWDTEFVRVDQATLFDLILAANYLNIKGLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>ref|XP_011003066.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=157

 Score =   231 bits (590),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ +  +LKS+DGE+FEV EAVA+ESQTIKHMIEDDCAD  IPLPNVTSK+LAKVIEYC
Sbjct  1    MSAGRKFILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTSKVLAKVIEYC  60

Query  243  RRHVDPAKSDDKANE--DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+  KSDD+ +   DDLKA+DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQ VAD
Sbjct  61   KKHVESPKSDDRPSSAADDLKAWDAEFVKVDQATLFDLILAANYLNIKHLLDLTCQRVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPE+IRKTFNIKNDFTP
Sbjct  121  MIKGKTPEDIRKTFNIKNDFTP  142



>ref|XP_011043147.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=158

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I L+S+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSGRKISLRSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANE---DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV+  KS+D+      D+LK +DAEFV+VDQ TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KKHVETPKSEDRGTNSGGDELKNWDAEFVRVDQVTLFDLILAANYLNIKDLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>ref|XP_006425391.1| hypothetical protein CICLE_v10026642mg [Citrus clementina]
 ref|XP_006467001.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR38631.1| hypothetical protein CICLE_v10026642mg [Citrus clementina]
Length=168

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 126/153 (82%), Gaps = 13/153 (8%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSSPKMI+LKS DGE+FEV EAVALES TIKHMIEDDCAD  IPLPNVT KILAKV+EYC
Sbjct  1    MSSPKMIVLKSCDGESFEVEEAVALESTTIKHMIEDDCADNGIPLPNVTGKILAKVVEYC  60

Query  243  RRHVD-PAKSDDK------------ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKS  383
            ++HV+ PA  D                E+DLK++D +FVKVDQ+TLFDLILAANYLNIK 
Sbjct  61   KKHVEVPATQDSNNSGANSNGTATNGGEEDLKSWDTDFVKVDQATLFDLILAANYLNIKG  120

Query  384  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  153



>ref|XP_008447950.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=155

 Score =   230 bits (586),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I+L+S+DGETF+V E VA+ESQTIKHMIEDDC DTVIPLPNVTS IL+KV+EYC
Sbjct  1    MSSSKKIVLRSSDGETFDVDEIVAVESQTIKHMIEDDCVDTVIPLPNVTSAILSKVVEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            + HV+    D K  +D LK +DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  61   KMHVETDDKDSKVIDDTLKTWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>ref|XP_002279232.1| PREDICTED: SKP1-like protein 1A isoform X5 [Vitis vinifera]
 emb|CAN73136.1| hypothetical protein VITISV_023042 [Vitis vinifera]
Length=155

 Score =   230 bits (586),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+S K I L+S+DGE F++ E VA+ESQTIKHMIED CAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MASSKTITLRSSDGEAFDLEEVVAVESQTIKHMIEDGCADNAIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV+  K+++ A  D+LKA+DA+FVKVDQ+TLFDLILAANYL+IKSLLDLTCQTVADMI
Sbjct  61   KKHVETPKAEEHAVNDELKAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTPE  485
            KGKTPEEIRKTFNIKNDFTPE
Sbjct  121  KGKTPEEIRKTFNIKNDFTPE  141



>gb|KDO71310.1| hypothetical protein CISIN_1g030962mg [Citrus sinensis]
Length=168

 Score =   230 bits (586),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 125/153 (82%), Gaps = 13/153 (8%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSSPKMI+LKS DGE+FEV EAVALES TIKHMIEDDCAD  IPLPNVT KILAKV+EYC
Sbjct  1    MSSPKMIVLKSCDGESFEVEEAVALESTTIKHMIEDDCADNGIPLPNVTGKILAKVVEYC  60

Query  243  RRHVDPAKSDD-------------KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKS  383
            ++HV+   + D                E+DLK++D +FVKVDQ+TLFDLILAANYLNIK 
Sbjct  61   KKHVEVPTTQDSNTSGANSNGAATNGGEEDLKSWDTDFVKVDQATLFDLILAANYLNIKG  120

Query  384  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  153



>ref|XP_002270061.1| PREDICTED: SKP1-like protein 1B [Vitis vinifera]
 ref|XP_010664854.1| PREDICTED: SKP1-like protein 1B [Vitis vinifera]
 emb|CAN76662.1| hypothetical protein VITISV_040452 [Vitis vinifera]
Length=156

 Score =   229 bits (585),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGE F+V EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSSSRKITLKSSDGEAFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKANEDD-LKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            ++HV+  K ++++  D+ LKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEAPKPEERSGVDEELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGKTPEEIRKTFNIKNDFTP  141



>gb|ABK92723.1| unknown [Populus trichocarpa]
Length=158

 Score =   229 bits (584),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I L+S+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSGRKISLRSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKA---NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV+  K +D+     +D+LK +D EFV+VDQ+TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KKHVETPKPEDRGTNSGDDELKNWDTEFVRVDQATLFDLILAANYLNIKGLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>ref|XP_010536422.1| PREDICTED: SKP1-like protein 1A [Tarenaya hassleriana]
Length=166

 Score =   229 bits (583),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (85%), Gaps = 11/151 (7%)
 Frame = +3

Query  63   MSSP--KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  236
            MSS   + I+LKS+DGE FEV E VALESQTIKHM+EDDCAD  IPLPNVTSK+LAKVIE
Sbjct  1    MSSAVERKIILKSSDGEAFEVDEVVALESQTIKHMVEDDCADNGIPLPNVTSKVLAKVIE  60

Query  237  YCRRHVDPAKSDDK---------ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLL  389
            YC++HVD A +++           ++DDLKA+DAEFVKVDQ+TLFDLILAANYLNIK LL
Sbjct  61   YCKKHVDAAAANNSEDCVGGSAGGDKDDLKAWDAEFVKVDQATLFDLILAANYLNIKGLL  120

Query  390  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            DLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  151



>ref|XP_010550803.1| PREDICTED: SKP1-like protein 1B [Tarenaya hassleriana]
Length=158

 Score =   228 bits (582),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 124/142 (87%), Gaps = 4/142 (3%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S + I LKS+DGETFEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC++
Sbjct  2    SGRKIALKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKK  61

Query  249  HVDPAKSDDKAN----EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            HVD +   + A     +DDLK +DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQTVAD
Sbjct  62   HVDASVKTETATTYSTDDDLKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAD  121

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  MIKGKTPEEIRKTFNIKNDFTP  143



>ref|XP_009420815.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=159

 Score =   228 bits (581),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (87%), Gaps = 6/142 (4%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I L+S+DGE FEV EAVA+ESQTIKHMIEDDCAD  IPLPNVTSKILAKV+EYC++HV
Sbjct  3    KTITLRSSDGEVFEVEEAVAMESQTIKHMIEDDCADNGIPLPNVTSKILAKVVEYCKKHV  62

Query  255  DPA----KSDD--KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            D A     SDD     EDDLK +DA+FVKVDQ+TLFDLILAANYLNIK LLDLTCQTVAD
Sbjct  63   DAAARSSSSDDAPSVTEDDLKTWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAD  122

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  123  MIKGKTPEEIRKTFNIKNDFTP  144



>emb|CAA75118.1| fimbriata-associated protein [Antirrhinum majus]
Length=165

 Score =   228 bits (581),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 7/150 (5%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            +++ ++ K I L+S+DGE FEV EA+AL SQTIKHMIEDDCAD VIPLPNVT KIL+KVI
Sbjct  1    SSSDNASKKITLRSSDGEVFEVDEAIALLSQTIKHMIEDDCADNVIPLPNVTGKILSKVI  60

Query  234  EYCRRHVDP--AKSDDKA-----NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLD  392
            EYC+RHVD   AKS++K       +DDLKAFDA+FVKVDQ+TLFDLILAANYLNIK+LLD
Sbjct  61   EYCKRHVDADAAKSEEKVAAAAAGDDDLKAFDADFVKVDQATLFDLILAANYLNIKTLLD  120

Query  393  LTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  LTCQTVADMIKGKTPEEIRKTFNIKNDFTP  150



>ref|XP_002531150.1| skp1, putative [Ricinus communis]
 gb|EEF31235.1| skp1, putative [Ricinus communis]
Length=161

 Score =   228 bits (581),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 125/145 (86%), Gaps = 7/145 (5%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I LKS+DGE FEV E VALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC++
Sbjct  2    SSKKITLKSSDGEPFEVDEVVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKS-------DDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            HV+  KS       ++   +D+LKA+DAEFVKVDQSTLFDLILAANYLNIK LLDLTCQT
Sbjct  62   HVETPKSSSEDRTINNSNTDDELKAWDAEFVKVDQSTLFDLILAANYLNIKGLLDLTCQT  121

Query  408  VADMIKGKTPEEIRKTFNIKNDFTP  482
            VADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  VADMIKGKTPEEIRKTFNIKNDFTP  146



>ref|XP_006360901.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=149

 Score =   228 bits (580),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI L+S DGETFEV EAVALES+TIKH+IEDDCA+T IPL NVT KILAKVIEYC+RHV+
Sbjct  1    MISLRSFDGETFEVDEAVALESETIKHLIEDDCANTSIPLHNVTGKILAKVIEYCKRHVE  60

Query  258  PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  437
              K++DK  ++DLK FDAEFVKVDQSTLF+L+LAANYLNIKSLLDLTCQTVADMIKGKTP
Sbjct  61   VPKAEDKTAKEDLKTFDAEFVKVDQSTLFNLMLAANYLNIKSLLDLTCQTVADMIKGKTP  120

Query  438  EEIRKTFNIKNDFTP  482
            EEIRKTFNI+NDFTP
Sbjct  121  EEIRKTFNIENDFTP  135



>gb|EPS61104.1| hypothetical protein M569_13700 [Genlisea aurea]
Length=167

 Score =   227 bits (578),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 127/152 (84%), Gaps = 7/152 (5%)
 Frame = +3

Query  48   FSAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAK  227
             S+   +S   I+L+S+DGE FEV E+VALESQTIKH+IED CADT IPLPNVT+KIL+K
Sbjct  1    MSSGDATSESKIVLRSSDGELFEVDESVALESQTIKHLIEDKCADTAIPLPNVTAKILSK  60

Query  228  VIEYCRRHVDPAKS-------DDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSL  386
            VIEYC++H+  A          +KA ED+LKAFDAEFVKVDQ TLFDLILAANYLNIKSL
Sbjct  61   VIEYCKQHISAASKVTDGLTLSEKAVEDELKAFDAEFVKVDQGTLFDLILAANYLNIKSL  120

Query  387  LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LDLTCQTVADMIKGKTPEEIRKTFNI+NDFTP
Sbjct  121  LDLTCQTVADMIKGKTPEEIRKTFNIQNDFTP  152



>gb|KEH23696.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   226 bits (577),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ K I LKS+D ETFEV EAVALESQTIK+MIEDDC D  IP+PNVT +ILAKVIEYC+
Sbjct  3    STTKKITLKSSDNETFEVPEAVALESQTIKYMIEDDCTDNGIPVPNVTGQILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD   SD+K +EDDLK +DAEFVKVDQ+ LF LILAANYLNIKSLLDLTCQTVADMIK
Sbjct  63   KHVDAESSDEKPSEDDLKNWDAEFVKVDQAKLFGLILAANYLNIKSLLDLTCQTVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFT  479
            GKTPEEIRKTFNIKNDFT
Sbjct  123  GKTPEEIRKTFNIKNDFT  140



>ref|XP_011083455.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=170

 Score =   226 bits (577),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 129/153 (84%), Gaps = 9/153 (6%)
 Frame = +3

Query  51   SAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKV  230
            ++A  +S + I L+S+DGE FEV EAVA+ESQTIKHMIEDDCAD VIPLPNVT KIL+KV
Sbjct  3    TSAAENSSRKITLRSSDGEVFEVDEAVAVESQTIKHMIEDDCADNVIPLPNVTGKILSKV  62

Query  231  IEYCRRHVDPAK---------SDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKS  383
            IEYC+RHVD A          +   A +DDLKAFDA+FVKVDQ+TLFDLILAANYLNIK+
Sbjct  63   IEYCKRHVDAAAAASKADDKLASTAATDDDLKAFDADFVKVDQATLFDLILAANYLNIKT  122

Query  384  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  123  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  155



>dbj|BAB85607.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   226 bits (575),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 6/144 (4%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  IPLPNVTSKILAKVIEYC++
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKSDDKA------NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            HVD A S  +A      ++DDLKA+DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIR TFNIKNDFTP
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFTP  145



>ref|XP_006360900.1| PREDICTED: SKP1-like protein 1B-like isoform X2 [Solanum tuberosum]
Length=149

 Score =   225 bits (574),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI+L+S+DGETFEV EAVALES TIKHMIEDDC DT I LPNVTSKIL KVIEYC+RHV+
Sbjct  1    MIVLRSSDGETFEVDEAVALESPTIKHMIEDDCTDTSISLPNVTSKILVKVIEYCKRHVE  60

Query  258  PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  437
              K++DK  E DLK FDAEFVKVDQSTL+DL+LAANYLNI SL+DLTCQTVADMIKGKTP
Sbjct  61   VPKAEDKTAEVDLKTFDAEFVKVDQSTLYDLMLAANYLNINSLIDLTCQTVADMIKGKTP  120

Query  438  EEIRKTFNIKNDFTP  482
            EEIRK  NIKNDFTP
Sbjct  121  EEIRKILNIKNDFTP  135



>ref|XP_010095548.1| SKP1-like protein 1B [Morus notabilis]
 gb|EXB60668.1| SKP1-like protein 1B [Morus notabilis]
Length=157

 Score =   225 bits (574),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 2/142 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGETFEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSSGRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDKANEDD--LKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            ++HV+  KSDD+A+  D  LKA+DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVEAPKSDDRASSADDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  MIKGKTPEEIRKTFNIKNDFTP  142



>ref|XP_006847969.1| hypothetical protein AMTR_s00029p00153350 [Amborella trichopoda]
 gb|ERN09550.1| hypothetical protein AMTR_s00029p00153350 [Amborella trichopoda]
Length=157

 Score =   225 bits (573),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K + LKS+DGE FEV E+VA+ESQTIKHMIEDDCA   IPLPNV+SKILAKVIEYC+ HV
Sbjct  6    KKVTLKSSDGEVFEVEESVAVESQTIKHMIEDDCAGNGIPLPNVSSKILAKVIEYCKYHV  65

Query  255  DPAK-SDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  431
            D  K ++DK  E+++K++DAEFV+VDQ+TLFDLILAANYLNIK+LLDLTCQTVADMIKGK
Sbjct  66   DAQKVTEDKTQEEEIKSWDAEFVRVDQATLFDLILAANYLNIKNLLDLTCQTVADMIKGK  125

Query  432  TPEEIRKTFNIKNDFTP  482
            TPEEIRKTFNIKNDFTP
Sbjct  126  TPEEIRKTFNIKNDFTP  142



>gb|KDP29669.1| hypothetical protein JCGZ_18831 [Jatropha curcas]
Length=159

 Score =   225 bits (573),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 4/144 (3%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ K + LKS+DGETFEV EAVA+ESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKKVTLKSSDGETFEVEEAVAVESQTIKHMIEDDCADTEIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANE----DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            ++HV+ A +D   ++    + L  +DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTV
Sbjct  61   KKHVEAATADKDKDKSSSDEALTTWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTV  120

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  ADMIKGKTPEEIRKTFNIKNDFTP  144



>ref|XP_010266846.1| PREDICTED: SKP1-like protein 1B isoform X1 [Nelumbo nucifera]
 ref|XP_010266847.1| PREDICTED: SKP1-like protein 1B isoform X1 [Nelumbo nucifera]
Length=154

 Score =   225 bits (573),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K + LK +DGETF+V EAVALESQTIKHMIE+DC D  IPLPNVTSKIL KVIEYC++
Sbjct  2    SGKKVTLKGSDGETFDVDEAVALESQTIKHMIEEDCIDNGIPLPNVTSKILCKVIEYCKK  61

Query  249  HVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG  428
            HV+  ++DD+  +++LK +DAEFVKVDQ+TLFDLILAANYL+IKSLLDLTCQTVADMIKG
Sbjct  62   HVETPRTDDRTADEELKNWDAEFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKG  121

Query  429  KTPEEIRKTFNIKNDFTP  482
            KTPEEIRKTFNIKNDFTP
Sbjct  122  KTPEEIRKTFNIKNDFTP  139



>ref|XP_010935122.1| PREDICTED: SKP1-like protein 1A [Elaeis guineensis]
Length=163

 Score =   224 bits (572),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 122/145 (84%), Gaps = 9/145 (6%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I LKS+DGE FEV EAVA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYC+RHV
Sbjct  4    KKITLKSSDGEVFEVEEAVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKRHV  63

Query  255  DPAKSDDKANEDD---------LKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            D A +  ++  DD         LK++DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQT
Sbjct  64   DFAAASSRSTADDTSSKPADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQT  123

Query  408  VADMIKGKTPEEIRKTFNIKNDFTP  482
            VADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  124  VADMIKGKTPEEIRKTFNIKNDFTP  148



>ref|NP_565123.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
 sp|Q39255.1|SKP1A_ARATH RecName: Full=SKP1-like protein 1A; Short=SKP1-like 1; AltName: 
Full=UFO-binding protein 1 [Arabidopsis thaliana]
 pdb|2P1M|A Chain A, Tir1-ask1 Complex Structure
 pdb|2P1N|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1N|D Chain D, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1O|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1P|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1Q|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|3C6N|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3C6O|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein-Substrate 
Interactions In Auxin Perception And Signaling
 pdb|3C6P|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3OGK|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGL|A Chain A, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|C Chain C, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|E Chain E, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|G Chain G, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|I Chain I, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|K Chain K, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|M Chain M, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|O Chain O, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGM|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 gb|AAF26761.1|AC007396_10 T4O12.17 [Arabidopsis thaliana]
 gb|AAB17535.1| homolog to Skp1p, an evolutionarily conserved kinetochore protein 
in budding yeast [Arabidopsis thaliana]
 gb|AAC14444.1| Skp1 homolog [Arabidopsis thaliana]
 gb|AAC63109.1| UIP1 [Arabidopsis thaliana]
 gb|AAL87354.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana]
 gb|AAM45019.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana]
 gb|AEE35780.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
Length=160

 Score =   224 bits (572),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 125/144 (87%), Gaps = 6/144 (4%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC+R
Sbjct  2    SAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKR  61

Query  249  HVDPAKSDDKANE------DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            HV+ A S  +A E      DDLKA+DA+F+K+DQ+TLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIR TFNIKNDFTP
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFTP  145



>ref|XP_004291337.1| PREDICTED: SKP1-like protein 1B [Fragaria vesca subsp. vesca]
Length=159

 Score =   224 bits (571),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPA----KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            ++HVD A         + +++LK +DA+FVKVDQ+TLFDLILAANYLNIK+LLDLTCQTV
Sbjct  61   KKHVDAAPKSDDRSSSSGDEELKNWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTV  120

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  ADMIKGKTPEEIRKTFNIKNDFTP  144



>ref|XP_009104691.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
 dbj|BAB85608.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   224 bits (571),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 6/144 (4%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC++
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKSDDKA------NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            HVD A S  +A      ++DDLKA+DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAASKSEAVDGGGSSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIR TFNIKNDF+P
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFSP  145



>ref|XP_006390250.1| hypothetical protein EUTSA_v10019260mg [Eutrema salsugineum]
 gb|ESQ27536.1| hypothetical protein EUTSA_v10019260mg [Eutrema salsugineum]
Length=159

 Score =   224 bits (570),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 5/143 (3%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC++
Sbjct  2    SSKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKS-----DDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            HVD A S     D  ++++DLKA+D EF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTVA
Sbjct  62   HVDSAASKSEAVDGASSDEDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIR TFNIKNDFTP
Sbjct  122  DMIKGKTPEEIRTTFNIKNDFTP  144



>gb|KFK42033.1| hypothetical protein AALP_AA2G203200 [Arabis alpina]
Length=159

 Score =   224 bits (570),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 5/143 (3%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC++
Sbjct  2    SAKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKS-----DDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            HVD A S     D  ++++DLK +DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTVA
Sbjct  62   HVDAAASKSEAVDGGSSDEDLKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIR TFNIKNDFTP
Sbjct  122  DMIKGKTPEEIRTTFNIKNDFTP  144



>ref|XP_002305525.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
 gb|ABK92824.1| unknown [Populus trichocarpa]
 gb|EEE86036.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
Length=161

 Score =   224 bits (570),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 8/147 (5%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS  K I LKS+DGETF V EAVA+ESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSESKKITLKSSDGETFVVDEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKAN-------EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
            ++HV+ A SD + N       ++ LK++D EFVKVDQ+TLFDLILAANYLNIK LLDLTC
Sbjct  61   KKHVE-AGSDKEKNVTGVTEKDESLKSWDTEFVKVDQNTLFDLILAANYLNIKGLLDLTC  119

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  120  QTVADMIKGKTPEEIRKTFNIKNDFTP  146



>ref|XP_006360899.1| PREDICTED: SKP1-like protein 1B-like isoform X1 [Solanum tuberosum]
Length=150

 Score =   223 bits (568),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI+L+S+DGETFEV EAVALES TIKHMIEDDC DT I LPNVTSKIL KVIEYC+RHV+
Sbjct  1    MIVLRSSDGETFEVDEAVALESPTIKHMIEDDCTDTSISLPNVTSKILVKVIEYCKRHVE  60

Query  258  PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  437
              K++DK  E DLK FDAEFVKVDQSTL+DL+LAANYLNIKSLLDLTCQTVADMIKGKTP
Sbjct  61   VPKAEDKTAEVDLKTFDAEFVKVDQSTLYDLMLAANYLNIKSLLDLTCQTVADMIKGKTP  120

Query  438  EEIRKTFNIKNDFTP  482
            EEI KTF+IK+D TP
Sbjct  121  EEISKTFDIKDDLTP  135



>ref|XP_010029647.1| PREDICTED: SKP1-like protein 1B isoform X1 [Eucalyptus grandis]
Length=155

 Score =   223 bits (568),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M++ + I L+S+DGE+F+V ++VA+ESQTIKHMIED CAD  IPLPNV SKILAKVIEYC
Sbjct  1    MATSRKITLRSSDGESFDVEQSVAVESQTIKHMIEDGCADNAIPLPNVNSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            + HV+ AK +D+ N+++LK +D +FVKVDQ+TLFDLIL+ANYLNIKSLLDLTCQTVADMI
Sbjct  61   KMHVESAKPEDRVNDEELKTWDVDFVKVDQATLFDLILSANYLNIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTF+I+NDFTP
Sbjct  121  KGKTPEEIRKTFSIRNDFTP  140



>gb|EMT15375.1| SKP1-like protein 4 [Aegilops tauschii]
Length=172

 Score =   223 bits (569),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 126/157 (80%), Gaps = 13/157 (8%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            AA     KMILLKS++GE F+V  AVA+ESQTI+HMIEDDCAD  IPLPNV SKILAKVI
Sbjct  2    AAEAGVKKMILLKSSNGEGFQVEAAVAIESQTIRHMIEDDCADNGIPLPNVDSKILAKVI  61

Query  234  EYCRRHV----DPAKSD---------DKANEDDLKAFDAEFVKVDQSTLFDLILAANYLN  374
            EYC++HV    +PA S            A  +DLK+FDAEFVKVDQ+TLFDLILAANYLN
Sbjct  62   EYCKKHVQASPNPADSSAADANSSTSTAAAAEDLKSFDAEFVKVDQATLFDLILAANYLN  121

Query  375  IKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            IK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE
Sbjct  122  IKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  158



>ref|XP_009128146.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
 emb|CDY39073.1| BnaA02g17620D [Brassica napus]
Length=160

 Score =   223 bits (568),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 6/143 (4%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  IPLPNVTSKILAKVIEYC++
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKSDDKA------NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            HVD A S  +A      ++DDLKA+DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  411  ADMIKGKTPEEIRKTFNIKNDFT  479
            ADMIKGKTPEEIR TFNIKNDFT
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFT  144



>ref|XP_004287067.1| PREDICTED: SKP1-like protein 1B [Fragaria vesca subsp. vesca]
Length=159

 Score =   223 bits (568),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 119/142 (84%), Gaps = 3/142 (2%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S  K+I LKS+D ETFEV EAVALESQTIKHM+ED CAD  IPLPNVT  ILA+VIEYC+
Sbjct  3    SEKKLITLKSSDNETFEVDEAVALESQTIKHMVEDGCADNAIPLPNVTGAILARVIEYCK  62

Query  246  RHVDPAKSD---DKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            +HV+    D   DK+ E  LK FDAEFVKVDQ+ LFDLILAANYLNIK LLDLTCQTVAD
Sbjct  63   KHVEEGGKDAEKDKSGESPLKTFDAEFVKVDQNVLFDLILAANYLNIKGLLDLTCQTVAD  122

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  123  MIKGKTPEEIRKTFNIKNDFTP  144



>ref|XP_011046673.1| PREDICTED: SKP1-like protein 1A [Populus euphratica]
Length=161

 Score =   223 bits (568),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 8/147 (5%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS  K I LKS+DGETF V EAVA+ESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSESKKITLKSSDGETFVVDEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKAN-------EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
            ++HV+ A SD + N       ++ LK++D EFVKVDQ+TLFDLILAANYLNIK LLDLTC
Sbjct  61   KKHVE-AGSDKEKNVTGVTEKDESLKSWDTEFVKVDQNTLFDLILAANYLNIKDLLDLTC  119

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  120  QTVADMIKGKTPEEIRKTFNIKNDFTP  146



>gb|EMT03939.1| SKP1-like protein 1B [Aegilops tauschii]
Length=164

 Score =   223 bits (567),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 124/149 (83%), Gaps = 5/149 (3%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            AA     KMI LKS+DGE F+V  AVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVI
Sbjct  2    AAEEGEKKMITLKSSDGEEFQVEVAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVI  61

Query  234  EYCRRHV-DPAKSDD----KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLT  398
            EYC++H   PA S D     A  +DLK+FDAEFVKVDQ+TLFDLILAANYLNIK LLDLT
Sbjct  62   EYCKKHAPKPADSSDFTAAAAPAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGLLDLT  121

Query  399  CQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            CQTVADMIKGKTPEEIRKTFNIKNDFTPE
Sbjct  122  CQTVADMIKGKTPEEIRKTFNIKNDFTPE  150



>gb|EMT05501.1| SKP1-like protein 1B [Aegilops tauschii]
Length=175

 Score =   223 bits (568),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 126/160 (79%), Gaps = 16/160 (10%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            AA     KMI LKS+DGE F+V EA+A+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVI
Sbjct  2    AAEEGEKKMITLKSSDGEEFQVEEAIAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVI  61

Query  234  EYCRRHVD----PAKSDDK------------ANEDDLKAFDAEFVKVDQSTLFDLILAAN  365
            EYC++HV     PA S               A+ +DLK+FDAEF+KVDQ+TLFDLILAAN
Sbjct  62   EYCKKHVQASPKPANSGAAVDASSSTSTAVAASAEDLKSFDAEFIKVDQNTLFDLILAAN  121

Query  366  YLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            YLNIK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE
Sbjct  122  YLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  161



>ref|XP_010690359.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=166

 Score =   223 bits (567),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 9/145 (6%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I LKS+DGE F+V E+VALESQTIKHMIEDDCAD  IPLPNVT KIL+KVIEYC++HV
Sbjct  7    KKITLKSSDGENFDVEESVALESQTIKHMIEDDCADNAIPLPNVTGKILSKVIEYCKKHV  66

Query  255  DPA---------KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            + A          S +   +++LK++DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQT
Sbjct  67   ESAAAKSSTEDRSSSNATADEELKSWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQT  126

Query  408  VADMIKGKTPEEIRKTFNIKNDFTP  482
            VADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  127  VADMIKGKTPEEIRKTFNIKNDFTP  151



>dbj|BAB85605.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   222 bits (566),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 125/144 (87%), Gaps = 6/144 (4%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC++
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKSDDKA------NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            HVD   S  +A      ++DDLKA+DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAVASKSEAVDGGGSSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIR TFNIKNDF+P
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFSP  145



>emb|CDY13521.1| BnaC02g23320D [Brassica napus]
Length=160

 Score =   222 bits (566),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 6/143 (4%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  IPLPNVTSKILAKVIEYC++
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKSDDKA------NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            HVD A S   A      ++DDLKA+DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAASKTDAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  411  ADMIKGKTPEEIRKTFNIKNDFT  479
            ADMIKGKTPEEIR TFNIKNDFT
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFT  144



>ref|XP_009401439.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
 ref|XP_009401447.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=157

 Score =   221 bits (564),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 4/141 (3%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I L+S+DGE FEV  AVA+ESQTIKHMIEDDCA+  IPLPNV +KILAKVIEYCR+HV
Sbjct  3    KKITLRSSDGEVFEVDVAVAMESQTIKHMIEDDCAENGIPLPNVNAKILAKVIEYCRKHV  62

Query  255  DPA--KSDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            D A  KS D A+  +++LK +DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQTVADMI
Sbjct  63   DAAASKSSDDASKVDEELKPWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  122

Query  423  KGKTPEEIRKTFNIKNDFTPE  485
            KGKTPEEIRKTFNIKNDFTPE
Sbjct  123  KGKTPEEIRKTFNIKNDFTPE  143



>ref|XP_008806601.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=163

 Score =   221 bits (564),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 9/147 (6%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + + I LKS+DGE FEV EAVA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYC+R
Sbjct  2    AEQKITLKSSDGEVFEVEEAVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKR  61

Query  249  HVDPAKS------DD---KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
            HVD A +      DD   K  +D+LKA+DAEFVKVDQ+TLFDLILAANYLNIK LLDLTC
Sbjct  62   HVDAAAASSKSTADDTSSKLADDELKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTC  121

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  QTVADMIKGKTPEEIRKTFNIKNDFTP  148



>ref|XP_010935123.1| PREDICTED: SKP1-like protein 1B [Elaeis guineensis]
Length=163

 Score =   221 bits (563),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 121/147 (82%), Gaps = 9/147 (6%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + K I LKS+DGE FEV E VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYC++
Sbjct  2    AEKKITLKSSDGEVFEVEETVAMESQTIKHMIEDDCAGNGIPLPNVTSKILSKVIEYCKK  61

Query  249  HVDPAKSDDKANEDD---------LKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
            HVD A +  K+  DD         LK +DA+FVKVDQ+TLFDLILAANYLNIK LLDLTC
Sbjct  62   HVDAAAASSKSTVDDTSSKIVDEELKTWDADFVKVDQATLFDLILAANYLNIKGLLDLTC  121

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  QTVADMIKGKTPEEIRKTFNIKNDFTP  148



>ref|NP_568603.1| SKP1-like protein 1B [Arabidopsis thaliana]
 sp|Q9FHW7.1|SKP1B_ARATH RecName: Full=SKP1-like protein 1B; AltName: Full=SKP1-like 2; 
AltName: Full=UFO-binding protein 2 [Arabidopsis thaliana]
 gb|AAC14445.1| Skp1 homolog [Arabidopsis thaliana]
 dbj|BAB08452.1| UIP2 [Arabidopsis thaliana]
 gb|AAO44064.1| At5g42190 [Arabidopsis thaliana]
 dbj|BAE99755.1| UIP2 [Arabidopsis thaliana]
 gb|AED94777.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
Length=171

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 125/156 (80%), Gaps = 16/156 (10%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ + I LKS+DGE FE+ EAVALESQTIKHMIEDDC D  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDD----------------KANEDDLKAFDAEFVKVDQSTLFDLILAANYLN  374
            +RHV+ A+  +                 ++++DLK +D+EF+KVDQ TLFDLILAANYLN
Sbjct  61   KRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLN  120

Query  375  IKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            IK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  IKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  156



>ref|XP_009395355.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=160

 Score =   221 bits (562),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 125/144 (87%), Gaps = 8/144 (6%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I LKS+DGE FEV EAVA+ESQTIKHMIEDDCA+  IPLPNVTSKILAKVIEYC++HV
Sbjct  2    KTITLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSKILAKVIEYCKKHV  61

Query  255  DPAKS------DD--KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            D + +      DD  K  +D+LK++DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQTV
Sbjct  62   DASAAASSKSPDDASKLADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  121

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  ADMIKGKTPEEIRKTFNIKNDFTP  145



>ref|XP_010941330.1| PREDICTED: SKP1-like protein 1B [Elaeis guineensis]
Length=164

 Score =   221 bits (562),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 124/148 (84%), Gaps = 10/148 (7%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + K I+LKS+DGE FEV E VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYC++
Sbjct  2    AEKKIILKSSDGEVFEVDEMVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKK  61

Query  249  HVDPAK-------SDD---KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLT  398
            HVD A        +DD   K  E+DLK +DAEFVKVDQ+TLFDLILAANYLNIK LLDLT
Sbjct  62   HVDAAAAAASKSATDDTSSKLGEEDLKTWDAEFVKVDQATLFDLILAANYLNIKGLLDLT  121

Query  399  CQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            CQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  CQTVADMIKGKTPEEIRKTFNIKNDFTP  149



>ref|XP_002863814.1| hypothetical protein ARALYDRAFT_917589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40073.1| hypothetical protein ARALYDRAFT_917589 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score =   221 bits (562),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 124/154 (81%), Gaps = 14/154 (9%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ + I LKS+DGE FE+ EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSD--------------DKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIK  380
            ++HV+ A                   ++++DLK +D+EF+KVDQ TLFDLILAANYLNIK
Sbjct  61   KKHVEAAAKSETTTEAAATTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIK  120

Query  381  SLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
             LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  GLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  154



>gb|AGF33287.1| SKP1 1A-like protein, partial [Quercus ilex]
Length=124

 Score =   219 bits (558),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +3

Query  111  FEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDPAKSDDKANED  290
            FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC++HV+   +D++ +++
Sbjct  1    FEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCKKHVESTSADERTSDE  60

Query  291  DLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKN  470
            DLKA+D EFV+VDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKN
Sbjct  61   DLKAWDTEFVRVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKN  120

Query  471  DFTP  482
            DFTP
Sbjct  121  DFTP  124



>ref|XP_009395385.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=161

 Score =   220 bits (561),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 8/144 (6%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KMI LKS+DGE FEV EAVA+ESQTIKHMIEDDCA+  IPLPNVTSKILAKVIEYCR+HV
Sbjct  3    KMITLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSKILAKVIEYCRKHV  62

Query  255  DPAKSDDKAN--------EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            D + +    +        +D+LK++DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQTV
Sbjct  63   DASAAAASKSSDDSSKLADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  122

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  123  ADMIKGKTPEEIRKTFNIKNDFTP  146



>gb|AAC63110.1| UIP2 [Arabidopsis thaliana]
Length=172

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 125/156 (80%), Gaps = 16/156 (10%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ + I LKS+DGE FE+ EAVALESQTIKHMIEDDC D  IPLPNVTSKIL+KVIEYC
Sbjct  2    MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYC  61

Query  243  RRHVDPAKSDD----------------KANEDDLKAFDAEFVKVDQSTLFDLILAANYLN  374
            +RHV+ A+  +                 ++++DLK +D+EF+KVDQ TLFDLILAANYLN
Sbjct  62   KRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLN  121

Query  375  IKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            IK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  IKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  157



>ref|XP_010442189.1| PREDICTED: SKP1-like protein 1B [Camelina sativa]
Length=170

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 15/155 (10%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ + I LKS+DGE FE+ EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTVRKITLKSSDGENFEIEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDDK---------------ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNI  377
            ++HV+ A +  +               ++++DLK +D+EF+KVDQ TLFDLILAANYLNI
Sbjct  61   KKHVEAAAAKSETAVATAATTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNI  120

Query  378  KSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            K LLDLTCQTVADMIKGKTP+EIRKTFNIKNDFTP
Sbjct  121  KGLLDLTCQTVADMIKGKTPDEIRKTFNIKNDFTP  155



>emb|CAA75117.1| fimbriata-associated protein [Antirrhinum majus]
Length=161

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 7/143 (5%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I L+S+DGE FEV E++ALESQTIKHMIEDDCAD VIPLPNVT KIL+KVIEYC+RHV
Sbjct  4    KKITLRSSDGEVFEVEESLALESQTIKHMIEDDCADNVIPLPNVTGKILSKVIEYCKRHV  63

Query  255  DPAKS-------DDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            D A +           ++D+LKAFDA+FVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  64   DAAAAKADDKLASTGTSDDELKAFDADFVKVDQATLFDLILAANYLNIKTLLDLTCQTVA  123

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  124  DMIKGKTPEEIRKTFNIKNDFTP  146



>ref|XP_010494151.1| PREDICTED: SKP1-like protein 1B [Camelina sativa]
Length=168

 Score =   220 bits (560),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 125/153 (82%), Gaps = 13/153 (8%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ + I LKS+DGE FE+ EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  243  RRHVDPAKSDD-------------KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKS  383
            ++HV+ A   +              ++++DLK +D+EF+KVDQ TLFDLILAANYLNIK 
Sbjct  61   KKHVEAAAKSETAVSTAATTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKG  120

Query  384  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LLDLTCQTVADMIKGKTP+EIRKTFNIKNDFTP
Sbjct  121  LLDLTCQTVADMIKGKTPDEIRKTFNIKNDFTP  153



>ref|XP_010266848.1| PREDICTED: SKP1-like protein 1B isoform X2 [Nelumbo nucifera]
Length=154

 Score =   219 bits (558),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K + LKS+DGETF V +AVALESQTI HMIE+DC D  IPLP VTSKIL+KVIEYC++
Sbjct  2    SGKKVTLKSSDGETFNVDKAVALESQTIMHMIEEDCIDNGIPLPTVTSKILSKVIEYCKK  61

Query  249  HVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG  428
            HV   ++DD+  ++ LK +DAEFVKVDQ+TLFDLILAANYL+IKSLLDLTCQTVADMIKG
Sbjct  62   HVKTTRTDDRTADEKLKNWDAEFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKG  121

Query  429  KTPEEIRKTFNIKNDFTP  482
            KTPEEIRKTFNIKNDFTP
Sbjct  122  KTPEEIRKTFNIKNDFTP  139



>ref|XP_003621659.1| SKP1-like protein [Medicago truncatula]
 gb|AES77877.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ K I LKS+D ETFEV EAVALE QTIKHMI+DDC D  I +PNVT +ILAKVIEYC+
Sbjct  3    STTKKITLKSSDNETFEVPEAVALELQTIKHMIKDDCTDNGILVPNVTGQILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +H+D A SD+K +EDDLK +DAEFVKV Q+TLFDLILAAN LNIKSLLDLTCQ VADMIK
Sbjct  63   KHIDAASSDEKPSEDDLKNWDAEFVKVHQTTLFDLILAANDLNIKSLLDLTCQYVADMIK  122

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  123  GKTPEEIRKTFNIKNDFTP  141



>ref|XP_010539092.1| PREDICTED: SKP1-like protein 1B [Tarenaya hassleriana]
Length=157

 Score =   219 bits (558),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S + I LKS+DGETFEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC++
Sbjct  2    SGRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKK  61

Query  249  HVDPAKSDDKANE---DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            HVD A   + A     D +K +DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQTVADM
Sbjct  62   HVDAAAKSEAAAAAEEDVMKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM  121

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  122  IKGKTPEEIRKTFNIKNDFTP  142



>emb|CDX85931.1| BnaC06g22030D [Brassica napus]
 emb|CDX68112.1| BnaA07g21520D [Brassica napus]
Length=151

 Score =   219 bits (557),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 122/139 (88%), Gaps = 5/139 (4%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC++
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  249  H-VDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            H VD   S D    DDLKA+DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTVADMIK
Sbjct  62   HAVDGGGSSD----DDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIK  117

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIR TFNIKNDF+P
Sbjct  118  GKTPEEIRTTFNIKNDFSP  136



>ref|XP_008448523.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=155

 Score =   219 bits (557),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+DG+ FEV  AVAL+SQTI+HMIED CAD  IPLPNV SKILAKVIEYC
Sbjct  1    MSSSKKITLKSSDGDYFEVDGAVALQSQTIRHMIEDSCADNGIPLPNVNSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            R+HV+ +  D   + DDLK +D +FV VDQ+TLFDLILAANYL+IKSLLDLTCQTVADMI
Sbjct  61   RKHVNASSLDPAPSVDDLKTWDRDFVNVDQATLFDLILAANYLDIKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  121  KGKTPEEIRKTFNIKNDFTP  140



>gb|EMS35771.1| SKP1-like protein 1B [Triticum urartu]
Length=167

 Score =   219 bits (558),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 124/152 (82%), Gaps = 8/152 (5%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            AA     KMI LKS+DGE F+V EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVI
Sbjct  2    AAEEGEKKMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVI  61

Query  234  EYCRRHVDPAKSDDKANE--------DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLL  389
            EYC++HV    +D  ++         +DLK FDAEFVKVDQ+TLFDLILAANYLNIK LL
Sbjct  62   EYCKKHVQADSTDASSSTSTAAAAPAEDLKIFDAEFVKVDQATLFDLILAANYLNIKGLL  121

Query  390  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            DLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE
Sbjct  122  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  153



>ref|XP_010941328.1| PREDICTED: SKP1-like protein 1A [Elaeis guineensis]
Length=163

 Score =   219 bits (557),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 122/144 (85%), Gaps = 10/144 (7%)
 Frame = +3

Query  81   ILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDP  260
            I+LKS+DGE FEV E+VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYC+RHV+ 
Sbjct  5    IILKSSDGEVFEVEESVAMESQTIKHMIEDDCAGNGIPLPNVTSKILSKVIEYCKRHVEA  64

Query  261  A----------KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            +           S  KA +++LKA+D EFV+VDQ+TLFDLILAANYLNIK LLDLTCQTV
Sbjct  65   SAAASKYAAEDSSSSKAADNELKAWDDEFVRVDQATLFDLILAANYLNIKGLLDLTCQTV  124

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  125  ADMIKGKTPEEIRKTFNIKNDFTP  148



>gb|EMS59755.1| SKP1-like protein 4 [Triticum urartu]
Length=164

 Score =   219 bits (557),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 122/149 (82%), Gaps = 5/149 (3%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            AA     KMI LKS+D E F+V EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVI
Sbjct  2    AAEEGEKKMITLKSSDREEFQVAEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVI  61

Query  234  EYCRRHVD-----PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLT  398
            EYC++HV         +   A  +DLK+FDAEFVKVDQ+TLFDLILAANYLNIK LLDLT
Sbjct  62   EYCKKHVQVDAGSSTSTAAAAPAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGLLDLT  121

Query  399  CQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            CQTVADMIKGKTPEEIRKTFNIKNDFTPE
Sbjct  122  CQTVADMIKGKTPEEIRKTFNIKNDFTPE  150



>ref|XP_006302938.1| hypothetical protein CARUB_v10021077mg [Capsella rubella]
 gb|EOA35836.1| hypothetical protein CARUB_v10021077mg [Capsella rubella]
Length=159

 Score =   218 bits (556),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 5/143 (3%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC +  +PLPNVTSKILAKVIEYC++
Sbjct  2    SAKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVENGVPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKSDDKANE-----DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            HV+ A +  +A E     DDLK +DA+F+K+DQ+TLF+LILAANYLNIK+LLDLTCQTVA
Sbjct  62   HVEAAAAKSEAVEGASTDDDLKTWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIR TFNIKNDFTP
Sbjct  122  DMIKGKTPEEIRTTFNIKNDFTP  144



>dbj|BAE72121.1| SKP1-like protein [Silene latifolia]
Length=173

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 124/157 (79%), Gaps = 14/157 (9%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            A +  S K ILLKS+DGE FEV + VALESQTIKHMIEDDCAD  IPLPNVT KIL+KVI
Sbjct  2    AESTESTKKILLKSSDGEDFEVDQIVALESQTIKHMIEDDCADNAIPLPNVTGKILSKVI  61

Query  234  EYCRRHVDPAKSDDKAN--------------EDDLKAFDAEFVKVDQSTLFDLILAANYL  371
            EYC++HV+ A+ +                  +DDLK +D EFVKVDQ+TLFDLILAANYL
Sbjct  62   EYCKKHVEFAEKNKGETTTTTSAAGTGTTPVDDDLKNWDTEFVKVDQNTLFDLILAANYL  121

Query  372  NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  158



>gb|EMT03937.1| SKP1-like protein 1A [Aegilops tauschii]
Length=164

 Score =   218 bits (556),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 120/142 (85%), Gaps = 5/142 (4%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KMI LKS+DGE F+V EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYC++HV
Sbjct  9    KMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  255  DPAKSDDK-----ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
                S        A  +DLK+FDA+FVKVDQ+TLF LILAANYLNIK LLDLTCQTVADM
Sbjct  69   QADASSSTSTAAPAPAEDLKSFDADFVKVDQATLFALILAANYLNIKGLLDLTCQTVADM  128

Query  420  IKGKTPEEIRKTFNIKNDFTPE  485
            IKGKTPEEIRKTFNIKNDFTPE
Sbjct  129  IKGKTPEEIRKTFNIKNDFTPE  150



>ref|XP_009418685.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=161

 Score =   218 bits (555),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 124/144 (86%), Gaps = 8/144 (6%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I+LKS+DGE FEV EAVA+ESQTIKHMIEDDCA+  IPLPNVTS ILAKVIEYCR+HV
Sbjct  3    KTIMLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSAILAKVIEYCRKHV  62

Query  255  DPAKS------DD--KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            + + +      DD  K  +D +K++DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQTV
Sbjct  63   EASAAAASKSSDDGSKPTDDVIKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  122

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  123  ADMIKGKTPEEIRKTFNIKNDFTP  146



>ref|XP_009414442.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=157

 Score =   218 bits (554),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 122/140 (87%), Gaps = 4/140 (3%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I+LKS+DGE FEV  AVA+ESQTI+HMIEDDC +  +PLPNVTSKILAKVIEYCR+HV
Sbjct  3    KKIILKSSDGEEFEVDVAVAMESQTIRHMIEDDCFENGVPLPNVTSKILAKVIEYCRKHV  62

Query  255  DPAKSDD----KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            D A +      K  +++LKA+DA+FVKVDQ+TLFDLILAANYLNIK LLDLTCQTVADMI
Sbjct  63   DAASNSSGDASKVPDEELKAWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  122

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGKTPEEIRKTFNIKNDFTP
Sbjct  123  KGKTPEEIRKTFNIKNDFTP  142



>dbj|BAD46569.1| putative UIP2 [Oryza sativa Japonica Group]
 dbj|BAH01115.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84966.1| hypothetical protein OsI_32208 [Oryza sativa Indica Group]
 gb|EEE70133.1| hypothetical protein OsJ_30167 [Oryza sativa Japonica Group]
Length=175

 Score =   218 bits (556),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 123/159 (77%), Gaps = 16/159 (10%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            AA   +  MI L+S +G+ FEV EAVA+ESQTI+HMIED CADT IPLPNV++KIL+KVI
Sbjct  2    AAEAETKAMITLRSCEGQVFEVAEAVAMESQTIRHMIEDKCADTGIPLPNVSAKILSKVI  61

Query  234  EYCRRHVDPAKSD----------------DKANEDDLKAFDAEFVKVDQSTLFDLILAAN  365
            EYC +HV+                     +KA ED+LK FDAEFVKVDQSTLFDLILAAN
Sbjct  62   EYCSKHVEARGGAAAAADGDAPAPAAVEANKAVEDELKTFDAEFVKVDQSTLFDLILAAN  121

Query  366  YLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            YLNIK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  YLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  160



>ref|XP_004159727.1| PREDICTED: SKP1-like protein 1A-like [Cucumis sativus]
Length=155

 Score =   218 bits (554),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS   I+LKS+DG+ F+V +AVAL+SQTI+HMIED+CA   IPLPNV SKILAKVI+YC
Sbjct  1    MSSSNKIILKSSDGDYFQVDDAVALQSQTIRHMIEDNCAHNGIPLPNVNSKILAKVIQYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            R+HVD + +D   +EDDLK +D +FV VDQ+TLFDLILAANYL++KSLLDLTCQTVADMI
Sbjct  61   RKHVDASSADPLPSEDDLKTWDRDFVNVDQATLFDLILAANYLDVKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGK PEEIRKTFNIKNDFTP
Sbjct  121  KGKKPEEIRKTFNIKNDFTP  140



>gb|EMT23721.1| SKP1-like protein 1A [Aegilops tauschii]
Length=164

 Score =   218 bits (554),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 123/149 (83%), Gaps = 5/149 (3%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            AA     KMI LKS+DGE F+V EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+K+I
Sbjct  2    AAEEGEKKMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKII  61

Query  234  EYCRRHVDPAKSDDKANE-----DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLT  398
            EYC++HV    S   +       +DLK++DA+FVKVDQ+TLFDLILAANYLNIK LLDLT
Sbjct  62   EYCKKHVQADASSSTSTTAAAPAEDLKSYDADFVKVDQATLFDLILAANYLNIKGLLDLT  121

Query  399  CQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            CQTVADMIKGKTPEEIRKTFNIKNDFTPE
Sbjct  122  CQTVADMIKGKTPEEIRKTFNIKNDFTPE  150



>gb|AGU28415.1| S phase kinase-associated protein 1 [Sinapis alba]
Length=158

 Score =   218 bits (554),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 6/143 (4%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  IPLPNVTSKILAKVIEYC++
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKSDDKA------NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            HVD A S  +A      ++DDLKA+DAEF+K+DQ+TLF LILAANYLNIK+LLDLTC  V
Sbjct  62   HVDAAASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFALILAANYLNIKNLLDLTCGGV  121

Query  411  ADMIKGKTPEEIRKTFNIKNDFT  479
            ADMIKGKTPEEIR TFNIKNDFT
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFT  144



>dbj|BAB85604.1| kinetochore protein [Brassica juncea]
Length=145

 Score =   217 bits (552),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 123/141 (87%), Gaps = 6/141 (4%)
 Frame = +3

Query  81   ILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDP  260
            ++LKS+DGE+FEV EAVALESQTI HM+EDD  D  IPLPNVTSKILAKVIEYC++HVD 
Sbjct  1    MVLKSSDGESFEVDEAVALESQTIAHMVEDDGVDNGIPLPNVTSKILAKVIEYCKKHVDA  60

Query  261  AKSDDKA------NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            A S  +A      ++DDLKA+DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTVADMI
Sbjct  61   AASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTPE  485
            KGKTPEEIR TFNIKNDFT E
Sbjct  121  KGKTPEEIRTTFNIKNDFTAE  141



>ref|XP_006281119.1| hypothetical protein CARUB_v10027150mg [Capsella rubella]
 gb|EOA14017.1| hypothetical protein CARUB_v10027150mg [Capsella rubella]
Length=204

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 124/155 (80%), Gaps = 15/155 (10%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ + I LKS+DGE FE+ EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  35   MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  94

Query  243  RRHVDPAKSDDKAN---------------EDDLKAFDAEFVKVDQSTLFDLILAANYLNI  377
            ++HV+ A   + A                ++DLK +D+EF+KVDQ TLFDLILAANYLNI
Sbjct  95   KKHVEAAAKSETAVSAASTTTTAAASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNI  154

Query  378  KSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            K LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  155  KGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  189



>ref|XP_008811446.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=162

 Score =   217 bits (553),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 121/143 (85%), Gaps = 9/143 (6%)
 Frame = +3

Query  81   ILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDP  260
            I+LKS+DGE FEV E VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYC+RHV+ 
Sbjct  5    IILKSSDGEVFEVEETVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKRHVEA  64

Query  261  AKSDD---------KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            + +           K  +D+LKA+DAEFV+VDQ+TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  65   SAAASKAAAEDSSSKLADDELKAWDAEFVRVDQATLFDLILAANYLNIKGLLDLTCQTVA  124

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  125  DMIKGKTPEEIRKTFNIKNDFTP  147



>gb|EMT33027.1| SKP1-like protein 1B [Aegilops tauschii]
Length=175

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 124/160 (78%), Gaps = 16/160 (10%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            AA     KMI LKS+DGE F++ EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVI
Sbjct  2    AAEEGEKKMITLKSSDGEEFQIEEAVAMESQTIRHMIEDDCADDGIPLPNVDSKILSKVI  61

Query  234  EYCRRHVDPA----------------KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAAN  365
            EYC++HV  +                 +   A  +DLK+FDAEFVKVDQ+TLFDLILAAN
Sbjct  62   EYCKKHVQASPKPADSGAAADASSFTSTAAAAPAEDLKSFDAEFVKVDQATLFDLILAAN  121

Query  366  YLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            YLNIK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE
Sbjct  122  YLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  161



>gb|EMT01680.1| SKP1-like protein 1B [Aegilops tauschii]
Length=172

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 124/157 (79%), Gaps = 13/157 (8%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            A      KMI LKS+DGE F+V EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVI
Sbjct  2    ATEEGEKKMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVI  61

Query  234  EYCRRHVDP----AKSDDKANE---------DDLKAFDAEFVKVDQSTLFDLILAANYLN  374
            EYC++HV      A S D ++          +DLK+FDAEFVKVDQ+TLFDLILA NYLN
Sbjct  62   EYCKKHVQASPKLADSTDASSSISTAAAAPAEDLKSFDAEFVKVDQATLFDLILATNYLN  121

Query  375  IKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            IK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE
Sbjct  122  IKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  158



>ref|XP_004248652.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327406.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327407.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327408.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327409.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=150

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI+L+S +GE+FEV E VALES+TIKHMIEDDCA+  IP+PNVT KILAKVI+YC+RHV+
Sbjct  1    MIILRSFNGESFEVDETVALESETIKHMIEDDCANNTIPVPNVTGKILAKVIKYCKRHVE  60

Query  258  PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  437
             +K++D   ++DLK FDAEFVKVDQSTLF+LILAANYL IKSL+DLTCQT+ADMIKGKTP
Sbjct  61   VSKAEDNTAKEDLKTFDAEFVKVDQSTLFNLILAANYLKIKSLIDLTCQTLADMIKGKTP  120

Query  438  EEIRKTFNIKNDFTP  482
            EEIR   NIKNDFTP
Sbjct  121  EEIRNLLNIKNDFTP  135



>ref|XP_004146156.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN55643.1| hypothetical protein Csa_3G002630 [Cucumis sativus]
Length=155

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS   I LKS+DG+ F+V +AVAL+SQTI+HMIED+CA   IPLPNV SKILAKVI+YC
Sbjct  1    MSSSNKITLKSSDGDYFQVDDAVALQSQTIRHMIEDNCAHNGIPLPNVNSKILAKVIQYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            R+HVD + +D   +EDDLK +D +FV VDQ+TLFDLILAANYL++KSLLDLTCQTVADMI
Sbjct  61   RKHVDASSADPLPSEDDLKTWDRDFVNVDQATLFDLILAANYLDVKSLLDLTCQTVADMI  120

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KGK PEEIRKTFNIKNDFTP
Sbjct  121  KGKKPEEIRKTFNIKNDFTP  140



>ref|XP_008806600.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=164

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 120/144 (83%), Gaps = 10/144 (7%)
 Frame = +3

Query  81   ILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDP  260
            I LKS+DGE FEV E VA+ESQTIKH+IEDDCA   IPLPNVTSKILAKVIEYC++HVD 
Sbjct  6    ITLKSSDGEVFEVEETVAMESQTIKHLIEDDCATNGIPLPNVTSKILAKVIEYCKKHVDA  65

Query  261  AK----------SDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            A           +  K  +D+LKA+DAEFVKVDQ+TLFDLILAANYLNIK LLDLTCQTV
Sbjct  66   AAAASSKSTADDTSSKLADDELKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  125

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIRKTFNI+NDFTP
Sbjct  126  ADMIKGKTPEEIRKTFNIRNDFTP  149



>ref|XP_010471746.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 7/147 (5%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ K I+LKS+DGE+FEV E+VA ESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC
Sbjct  1    MSTTKKIVLKSSDGESFEVDESVARESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYC  60

Query  243  RRHV-------DPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
            ++HV       D A+    + +++LK +DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTC
Sbjct  61   KKHVEVTASKTDAAEGAASSADEELKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTC  120

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIR TFNIKNDFTP
Sbjct  121  QTVADMIKGKTPEEIRTTFNIKNDFTP  147



>gb|KJB17604.1| hypothetical protein B456_003G007300 [Gossypium raimondii]
Length=148

 Score =   214 bits (546),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 8/139 (6%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS + I LKS+DGE+FEV EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC+
Sbjct  3    SSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HV+  K+DD++ +D+LK++DA+FVKVDQ+TLFDLIL         LLDLTCQTVADMIK
Sbjct  63   KHVEAPKTDDRSADDELKSWDADFVKVDQATLFDLILG--------LLDLTCQTVADMIK  114

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  115  GKTPEEIRKTFNIKNDFTP  133



>ref|XP_010416502.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 123/147 (84%), Gaps = 7/147 (5%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ K I+LKS+DGE+FEV E VALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC
Sbjct  1    MSTTKKIVLKSSDGESFEVDELVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKA-------NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
            ++HV+   S   A        +++LK +DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTC
Sbjct  61   KKHVEVTASKTDAVDGAASSADEELKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTC  120

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIR TFNIKNDFTP
Sbjct  121  QTVADMIKGKTPEEIRTTFNIKNDFTP  147



>dbj|BAB85606.1| kinetochore protein [Brassica juncea]
Length=161

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 7/145 (5%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVA ESQT+ HM+EDDC +  IPLPNVTSKILAKVIEYC++
Sbjct  2    STKKIVLKSSDGESFEVDEAVARESQTLAHMVEDDCIENGIPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKSDDKA-------NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            HVD A +  +        ++DDLKA+D EF+K+DQ+TLF+LILAANYLNIK+LLDLTCQT
Sbjct  62   HVDAAAAKTEGAVDGAASSDDDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  408  VADMIKGKTPEEIRKTFNIKNDFTP  482
            VADMIKGKTPEEIR TFNIKNDF+P
Sbjct  122  VADMIKGKTPEEIRTTFNIKNDFSP  146



>ref|XP_002537506.1| skp1, putative [Ricinus communis]
 gb|EEF24877.1| skp1, putative [Ricinus communis]
Length=158

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 129/143 (90%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ K I LKS+DGETF+V EAVA+ESQTIKH+I+DDCAD+VIP+PNVT KIL+KVIEYC
Sbjct  1    MSASKKITLKSSDGETFDVEEAVAVESQTIKHIIDDDCADSVIPIPNVTGKILSKVIEYC  60

Query  243  RRHVDPA---KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV  A    +D+K ++D LK++DA+FV+VDQ+TLFDLILAANYLN+K LLDLTCQTVA
Sbjct  61   KKHVADAAFKDNDNKDSDDALKSWDADFVRVDQNTLFDLILAANYLNVKGLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>ref|XP_008811458.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=164

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 121/148 (82%), Gaps = 10/148 (7%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + K I LKS+DGE FEV E VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYC++
Sbjct  2    AEKKITLKSSDGEVFEVDEMVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKK  61

Query  249  HVDPAKSDD----------KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLT  398
            HVD A +            K  +DDLK +DAEFVKVDQ+TLFDLILAANYLNIK LLDLT
Sbjct  62   HVDAAAAAASKSAADDTSFKLADDDLKTWDAEFVKVDQATLFDLILAANYLNIKGLLDLT  121

Query  399  CQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            CQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  CQTVADMIKGKTPEEIRKTFNIKNDFTP  149



>ref|XP_007219396.1| hypothetical protein PRUPE_ppa020403mg [Prunus persica]
 gb|EMJ20595.1| hypothetical protein PRUPE_ppa020403mg [Prunus persica]
Length=156

 Score =   214 bits (544),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I LKS DGE FEV EAVA++SQTIKHM+EDDCAD  IPLPNVTS I+AKVIEYC++H 
Sbjct  7    KKITLKSDDGEIFEVEEAVAMQSQTIKHMVEDDCADGPIPLPNVTSNIVAKVIEYCKKHH  66

Query  255  DPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  434
            +   +D + N++D+K +D EFVKVDQST+FDLILAANYLN+KSLLDLTCQTVADMI GKT
Sbjct  67   E-EDADGEKNKEDIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVADMINGKT  125

Query  435  PEEIRKTFNIKNDFTPE  485
            PEEIR+ FNIKNDFTPE
Sbjct  126  PEEIREIFNIKNDFTPE  142



>gb|AII79406.1| S-phase kinase-associated protein 1-like protein 6 [Malus hupehensis]
Length=165

 Score =   214 bits (544),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 119/148 (80%), Gaps = 9/148 (6%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            +  KMI LKS+DGE FEV EAVA+ESQTIKHM+EDDCAD  IPLPNVTS ILAKVIEYCR
Sbjct  3    AEKKMITLKSSDGEAFEVDEAVAMESQTIKHMVEDDCADNAIPLPNVTSHILAKVIEYCR  62

Query  246  RHVDPAKSDDK------ANEDDLKAFDAEFV---KVDQSTLFDLILAANYLNIKSLLDLT  398
            +HV+     D        +E+ LK FD +FV   K DQ+ LFDLILAANYLNIKSLLDLT
Sbjct  63   KHVEGRTDGDSTDVGKIGDENTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSLLDLT  122

Query  399  CQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            CQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  123  CQTVADMIKGKTPEEIRKTFNIKNDFTP  150



>ref|XP_003577587.1| PREDICTED: SKP1-like protein 1A [Brachypodium distachyon]
Length=181

 Score =   214 bits (544),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 123/162 (76%), Gaps = 20/162 (12%)
 Frame = +3

Query  57   ATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  236
            A     KMI LKS+DGE FEV E VA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIE
Sbjct  5    AAEGEKKMITLKSSDGEEFEVEETVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIE  64

Query  237  YCRRHV----------------DPAKSDDK----ANEDDLKAFDAEFVKVDQSTLFDLIL  356
            YC +HV                +PA +++     A  +DLK +DA+FVKVDQ+TLFDLIL
Sbjct  65   YCNKHVHATAAAKAANPSDGDANPAAANNSSTTAAPGEDLKNWDADFVKVDQATLFDLIL  124

Query  357  AANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            AANYLNIK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  125  AANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  166



>ref|XP_003573486.1| PREDICTED: SKP1-like protein 1A [Brachypodium distachyon]
Length=168

 Score =   212 bits (540),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 121/152 (80%), Gaps = 10/152 (7%)
 Frame = +3

Query  57   ATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  236
            A+    KMI LKS+DGE FEV E VA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIE
Sbjct  2    ASDGEKKMITLKSSDGEEFEVEETVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIE  61

Query  237  YCRRHVDPAKSDDKANE----------DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSL  386
            YC +HV  A + D A            DDLK +DA+FVKVDQ+TLFDLILAANYLNIK L
Sbjct  62   YCNKHVHAADATDAAAANTSAAPAAPTDDLKNWDADFVKVDQATLFDLILAANYLNIKGL  121

Query  387  LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  153



>ref|XP_009355656.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=165

 Score =   212 bits (540),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 119/148 (80%), Gaps = 9/148 (6%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            +  KMI LKS+DGE FEV EAVA+ESQTIKHM+EDDCAD  IPLPNVTS ILAKVIEYCR
Sbjct  3    AEKKMITLKSSDGEAFEVDEAVAMESQTIKHMVEDDCADNAIPLPNVTSHILAKVIEYCR  62

Query  246  RHVDPAKSDDK------ANEDDLKAFDAEFV---KVDQSTLFDLILAANYLNIKSLLDLT  398
            +HV+     D        +E+ LK FD +FV   K DQ+ LFDLILAANYLNIKSLLDLT
Sbjct  63   KHVEGRTDGDSTDVGKIGDENTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSLLDLT  122

Query  399  CQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            CQTVADMIKGKTPE+IRKTFNIKNDFTP
Sbjct  123  CQTVADMIKGKTPEDIRKTFNIKNDFTP  150



>gb|AGT16907.1| SKP1-like protein [Saccharum hybrid cultivar R570]
Length=176

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 120/160 (75%), Gaps = 18/160 (11%)
 Frame = +3

Query  57   ATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  236
            A     KMI LKS+DGE FEV  AVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIE
Sbjct  2    AAEGEKKMITLKSSDGEEFEVEVAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIE  61

Query  237  YCRRHV---------DPAKSDDKANE---------DDLKAFDAEFVKVDQSTLFDLILAA  362
            YC +HV           A SDD             +DLK +DA+FVKVDQ+TLFDLILAA
Sbjct  62   YCNKHVHAAAAAAAASKAGSDDVGAAAANSTAASGEDLKNWDADFVKVDQATLFDLILAA  121

Query  363  NYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            NYLNIK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  NYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  161



>ref|XP_002313704.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
 gb|EEE87659.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
Length=158

 Score =   211 bits (538),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 120/144 (83%), Gaps = 3/144 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS  K I LKS+DGETF V EAVA+ESQTIKHMIEDDCA+  IPLPNVTSKILAKVIEYC
Sbjct  1    MSESKKITLKSSDGETFVVEEAVAVESQTIKHMIEDDCAENDIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDK---ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV+     D      ++ +K++DAEFVKVD++TLFDLILAANYLNIK LLDLTCQ  A
Sbjct  61   KKHVEADADKDATITGKDEFMKSWDAEFVKVDKNTLFDLILAANYLNIKDLLDLTCQAAA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTPE  485
            DMIKGKTP+EIRK FNIKNDFTPE
Sbjct  121  DMIKGKTPDEIRKIFNIKNDFTPE  144



>ref|XP_008232104.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
 ref|XP_008245448.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
Length=156

 Score =   211 bits (538),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR-H  251
            K I LKS DGE FEV EAVA++SQTI+HM+EDDCAD  IPLPNVTS I+AKVIEYC++ H
Sbjct  7    KKITLKSDDGEIFEVEEAVAMQSQTIRHMVEDDCADGPIPLPNVTSNIVAKVIEYCKKKH  66

Query  252  VDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  431
             + A  D + N++D+K +DA FVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  67   EEDA--DGEKNKEDIKNWDAAFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  124

Query  432  TPEEIRKTFNIKNDFTPE  485
            TPEEIR+ FNIKNDFTPE
Sbjct  125  TPEEIREIFNIKNDFTPE  142



>ref|XP_010061081.1| PREDICTED: SKP1-like protein 1B isoform X1 [Eucalyptus grandis]
 gb|KCW67978.1| hypothetical protein EUGRSUZ_F01672 [Eucalyptus grandis]
Length=160

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 5/144 (3%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I+L+S+D E+FEV  AVALE QTIKHMIEDDCA   IPLPNV+SKIL+K+IE+C
Sbjct  1    MSSSRKIVLESSDKESFEVEVAVALECQTIKHMIEDDCAGDGIPLPNVSSKILSKIIEFC  60

Query  243  RRHVDP-----AKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            R+HVD        +   A +D+LKA+DAEF+KVDQ+TLFDLILAANYLNIK LLDLTCQ 
Sbjct  61   RKHVDADRERAGSASPAAADDELKAWDAEFIKVDQATLFDLILAANYLNIKGLLDLTCQN  120

Query  408  VADMIKGKTPEEIRKTFNIKNDFT  479
            VADMIKGKTPEEIRK+FNIKNDFT
Sbjct  121  VADMIKGKTPEEIRKSFNIKNDFT  144



>ref|XP_007201294.1| hypothetical protein PRUPE_ppa012728mg [Prunus persica]
 gb|EMJ02493.1| hypothetical protein PRUPE_ppa012728mg [Prunus persica]
Length=157

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 117/143 (82%), Gaps = 5/143 (3%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            +  KMI LKSADGE FEV EAVALESQTIKHM EDDC D  IPLPNV S +LAKVIEYCR
Sbjct  3    TEKKMITLKSADGEIFEVEEAVALESQTIKHMAEDDCVDNAIPLPNVESHVLAKVIEYCR  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFV---KVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            +HV+ A +D+  N+D +K F+ +FV   K DQS LFD ILAANYLNIKSLLDLTCQTVAD
Sbjct  63   KHVELAANDE--NKDTVKEFNDDFVNEIKADQSVLFDTILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTPE  485
            MIKGK PEEIRKTFNI NDFTPE
Sbjct  121  MIKGKAPEEIRKTFNIHNDFTPE  143



>ref|XP_003605505.1| SKP1-like protein [Medicago truncatula]
 gb|AES87702.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=164

 Score =   211 bits (537),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 122/140 (87%), Gaps = 1/140 (1%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCAD-TVIPLPNVTSKILAKVIEYC  242
            ++ K I LKS+D ETFE+ +AVALESQTIKH+I+D+CAD + IPLPNVT KILA VIE+C
Sbjct  9    TATKKITLKSSDNETFEIEKAVALESQTIKHLIDDNCADDSGIPLPNVTGKILAMVIEHC  68

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HVD   SD+K +ED++  +D EFVKVDQ TLFDLILAANYLNIKSLLDLTC+TVADMI
Sbjct  69   KKHVDATSSDEKPSEDEINKWDTEFVKVDQDTLFDLILAANYLNIKSLLDLTCKTVADMI  128

Query  423  KGKTPEEIRKTFNIKNDFTP  482
            KG+TPEEIRKTFNI ND+TP
Sbjct  129  KGRTPEEIRKTFNIINDYTP  148



>ref|XP_007221090.1| hypothetical protein PRUPE_ppa017105mg [Prunus persica]
 gb|EMJ22289.1| hypothetical protein PRUPE_ppa017105mg [Prunus persica]
Length=156

 Score =   211 bits (536),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I LKS DGE FEV EAVA++SQTI+HM+EDDCAD  IPL NVTS I+AKVIEYC++H 
Sbjct  7    KKITLKSEDGEIFEVEEAVAMQSQTIRHMVEDDCADGPIPLQNVTSNIVAKVIEYCKKHH  66

Query  255  DPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  434
            +   +D + N++D+K +D EFVKVDQST+FDLILAANYLN+KSLLDLTCQTVADMI GKT
Sbjct  67   EE-DADGEKNKEDIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVADMINGKT  125

Query  435  PEEIRKTFNIKNDFTPE  485
            PEEIR+ FNIKNDFTPE
Sbjct  126  PEEIREIFNIKNDFTPE  142



>ref|XP_001753554.1| predicted protein [Physcomitrella patens]
 gb|EDQ81777.1| predicted protein [Physcomitrella patens]
Length=158

 Score =   210 bits (535),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + + + L+S+D E FEV EAVA ESQ +K+MIED   D VIPLPNV+SKILAKVIEYC+ 
Sbjct  2    AEQRVKLRSSDDEMFEVDEAVAFESQAVKNMIEDTGKDAVIPLPNVSSKILAKVIEYCKY  61

Query  249  HVDPAK--SDDK--ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            HVD  K  +DDK  A+EDD+KA+DA+FVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVAD
Sbjct  62   HVDNQKGATDDKPAASEDDIKAWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVAD  121

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  MIKGKTPEEIRKTFNIKNDFTP  143



>ref|XP_011046062.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=158

 Score =   210 bits (535),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 120/144 (83%), Gaps = 3/144 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS  K I LKS+DGETF V EAVA+ESQTIKHMIEDDCA++ IPLPNVT KILAKVIEYC
Sbjct  1    MSESKKITLKSSDGETFVVEEAVAVESQTIKHMIEDDCAESDIPLPNVTGKILAKVIEYC  60

Query  243  RRHVDPAKSDDK---ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            ++HV+     D      ++ LK++D+EFVKVD++TLFDLILAANYLNIK LLDLTCQ  A
Sbjct  61   KKHVEADADKDAIITGKDEFLKSWDSEFVKVDKNTLFDLILAANYLNIKDLLDLTCQAAA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTPE  485
            DMIKGKTP+EIRK FNIKNDFTPE
Sbjct  121  DMIKGKTPDEIRKIFNIKNDFTPE  144



>ref|XP_004231048.1| PREDICTED: SKP1-like protein 1A [Solanum lycopersicum]
Length=158

 Score =   210 bits (534),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSSPK ILLKS DGE FEV EAVALESQTIK +IEDDCA + IP+ NV+  ILAKV+EY 
Sbjct  1    MSSPKKILLKSNDGEVFEVEEAVALESQTIKFLIEDDCAGSHIPISNVSGNILAKVLEYL  60

Query  243  RRHVDP---AKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            +RHV+    +K++    +  LK FDAEFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KRHVEEESTSKTEGADADAALKVFDAEFVKVDQKTLFDLILAANYLNIKSLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPE IR TFNIKNDFTP
Sbjct  121  DMIKGKTPEAIRNTFNIKNDFTP  143



>ref|XP_010683700.1| PREDICTED: SKP1-like protein 1B isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=150

 Score =   209 bits (533),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI LKS+DGE FEV E+VALE +TIK MIEDDCADT IPLPNVT+KIL+KVIEYC++HV+
Sbjct  1    MITLKSSDGEKFEVEESVALECETIKLMIEDDCADTAIPLPNVTAKILSKVIEYCKKHVE  60

Query  258  PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  437
             A + +  NE+ LK +D EFVKVDQ TLF+LILAANYLNI+SLLDLTCQTV+D+IK KTP
Sbjct  61   SAAAANSTNEE-LKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDLTCQTVSDIIKDKTP  119

Query  438  EEIRKTFNIKNDFTPE  485
            EE+RK FNIKNDFTPE
Sbjct  120  EEVRKMFNIKNDFTPE  135



>dbj|BAE72119.1| SKP1-like protein [Silene latifolia]
Length=160

 Score =   210 bits (534),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 120/153 (78%), Gaps = 14/153 (9%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            A +  S K ILLKS+DGE FEV + VALESQTIKHMIEDDCAD  IPLPNVT KIL+KVI
Sbjct  2    AESTESTKKILLKSSDGEDFEVDQIVALESQTIKHMIEDDCADNAIPLPNVTGKILSKVI  61

Query  234  EYCRRHVDPAKSDDKAN--------------EDDLKAFDAEFVKVDQSTLFDLILAANYL  371
            EYC++HV+ A+ +                  +DDLK +D EFVKVDQ+TLFDLILAANYL
Sbjct  62   EYCKKHVEFAEKNKGETTTTTSAAGTGTTPVDDDLKNWDTEFVKVDQNTLFDLILAANYL  121

Query  372  NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKN  470
            NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKN
Sbjct  122  NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKN  154



>gb|ABB69022.1| SKP1 [Brassica napus]
Length=160

 Score =   209 bits (533),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+D E+FEV EAVA ESQT+ HM+EDDC D  IPLPNVT KILAKVIEYC++
Sbjct  2    STKKIVLKSSDNESFEVDEAVARESQTLAHMVEDDCTDNDIPLPNVTGKILAKVIEYCKK  61

Query  249  HVDPAKS------DDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            HVD A +         +++DDLKA+DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAAAKTEAADGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIR TFNIKNDF+P
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFSP  145



>ref|XP_004301672.1| PREDICTED: SKP1-like protein 1A [Fragaria vesca subsp. vesca]
Length=163

 Score =   209 bits (533),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 116/144 (81%), Gaps = 7/144 (5%)
 Frame = +3

Query  51   SAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKV  230
            +++T S  KMI L+SADGE FE+ E VALESQTIKHM+EDDCA+  IPLPNV   ILAKV
Sbjct  12   TSSTSSEKKMITLQSADGEPFEIEEVVALESQTIKHMVEDDCAENAIPLPNVKGAILAKV  71

Query  231  IEYCRRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            IEYC++HV+ A        +DLKA+DAE+V VDQ+ LFDLILAANYLNIK LLDLTCQ V
Sbjct  72   IEYCKKHVEDAG-------EDLKAWDAEYVNVDQNVLFDLILAANYLNIKGLLDLTCQKV  124

Query  411  ADMIKGKTPEEIRKTFNIKNDFTP  482
            ADMIKGKTPEEIR  FNI NDFTP
Sbjct  125  ADMIKGKTPEEIRTLFNITNDFTP  148



>ref|XP_004299943.1| PREDICTED: SKP1-like protein 1B [Fragaria vesca subsp. vesca]
Length=159

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = +3

Query  60   TMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEY  239
            +  + KM+ LKS DGE FE+ EAVA++SQTIKHM+EDDCAD  IPLPNV   ILA+VIEY
Sbjct  2    STENKKMLTLKSEDGEVFEIEEAVAVQSQTIKHMVEDDCADNAIPLPNVKGPILARVIEY  61

Query  240  CRRHVDPAKSDDKANEDD--LKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
             ++HV  A+ + ++ ++D  LK FD EF+KVDQS LFDLILAANYLNIK LLDLTCQ VA
Sbjct  62   LKKHVADAEENKESKKEDVGLKEFDEEFLKVDQSVLFDLILAANYLNIKELLDLTCQAVA  121

Query  414  DMIKGKTPEEIRKTFNIKNDFTPE  485
            DMIKGKTPE+IRKTFNIKNDFTPE
Sbjct  122  DMIKGKTPEQIRKTFNIKNDFTPE  145



>gb|KEH23706.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=158

 Score =   209 bits (532),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  60   TMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEY  239
            + +S KMI LKS DGETFEV EAVAL+SQTIKH+IEDDCAD VIP+PNVT KILAKVIEY
Sbjct  2    SSTSKKMITLKSDDGETFEVSEAVALKSQTIKHIIEDDCADNVIPVPNVTGKILAKVIEY  61

Query  240  CRRHVDPAKSDDKANEDDLKAFDAEFVK-VDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            C++HV+   SD+K +EDDLK +DA+F K VDQ TLF ++LAANYLNIK+LLDL CQTVAD
Sbjct  62   CKKHVEATSSDEKVSEDDLKNWDADFAKEVDQQTLFQILLAANYLNIKNLLDLCCQTVAD  121

Query  417  MIKGKTPEEIRKTFNIKNDFTPE  485
             IK K PEEIR+ F+++NDF PE
Sbjct  122  DIKDKKPEEIREIFSVENDFNPE  144



>ref|XP_010113308.1| SKP1-like protein 1A [Morus notabilis]
 gb|EXC35315.1| SKP1-like protein 1A [Morus notabilis]
Length=163

 Score =   209 bits (532),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 123/147 (84%), Gaps = 6/147 (4%)
 Frame = +3

Query  60   TMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEY  239
            + SS K I+L+S+DGE+FEV EAVAL+SQTIKHM+ED   D+ IPLPNVTS+IL+KVIEY
Sbjct  2    STSSSKKIVLRSSDGESFEVEEAVALQSQTIKHMVEDVSDDSAIPLPNVTSRILSKVIEY  61

Query  240  CRRHVDPAKSDDKANE------DDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
            C RH D + S   +        +DLK++DAEFVKVDQ+TLFDLILAANYLNIK+LLDLTC
Sbjct  62   CNRHSDASSSASASASAGASDDNDLKSWDAEFVKVDQATLFDLILAANYLNIKNLLDLTC  121

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIR TFNIKNDFTP
Sbjct  122  QTVADMIKGKTPEEIRSTFNIKNDFTP  148



>ref|XP_010428644.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=170

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 12/154 (8%)
 Frame = +3

Query  57   ATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  236
            +T ++ K I+LKS+DGE+FEV E VALESQTI HM+EDDC D  +PLPNVTSKILAKVIE
Sbjct  2    STTTTTKKIVLKSSDGESFEVDELVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIE  61

Query  237  YCRRHVDPAKSD------------DKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIK  380
            YC++HV+   S               A +++LK +DAEF+K+DQ+TLF+LILAANYLNIK
Sbjct  62   YCKKHVEVTASKTDAADGAAAGAASSAADEELKTWDAEFMKIDQATLFELILAANYLNIK  121

Query  381  SLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            +LLDLTCQTVADMIKGKTPEEIR TFNIKNDFTP
Sbjct  122  NLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTP  155



>ref|XP_008232108.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
Length=156

 Score =   209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I LKS DGE FEV EAVA++SQTI+HM+EDDCAD  IPLPNVTS ILAKVIEYCR+H 
Sbjct  7    KKITLKSDDGEIFEVEEAVAMQSQTIRHMMEDDCADGAIPLPNVTSNILAKVIEYCRKHK  66

Query  255  DPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  434
            + A +D +  +D LK +DAEFVK+DQ TLF LI+ ANYLNIKSLLDLT QTVA+MIKGKT
Sbjct  67   EEA-ADGENKKDILKEWDAEFVKLDQVTLFHLIMTANYLNIKSLLDLTAQTVAEMIKGKT  125

Query  435  PEEIRKTFNIKNDFTPE  485
            PEEIR+TFNIKNDFTPE
Sbjct  126  PEEIRETFNIKNDFTPE  142



>ref|XP_010669692.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=171

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 124/152 (82%), Gaps = 13/152 (9%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            ++ K I LKS+DGE F+V E+VALE QTIK++IEDDCAD VIPLPNVT+KIL+KVIEYC+
Sbjct  4    TTVKKITLKSSDGENFDVEESVALECQTIKYIIEDDCADNVIPLPNVTAKILSKVIEYCK  63

Query  246  RHVDPAKSDDK-------------ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSL  386
            +HV+   +                A+E++LK +DAEFVKVDQ+TLFDLILAANYLNIKSL
Sbjct  64   KHVESVAAAKSSTEDGSSSSNPTTADEEELKTWDAEFVKVDQNTLFDLILAANYLNIKSL  123

Query  387  LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LDLTCQTVA+M+ GKTPEEIRKTFNIKNDFTP
Sbjct  124  LDLTCQTVANMMTGKTPEEIRKTFNIKNDFTP  155



>gb|AAT12490.1| Skp1/Ask1-like protein [Zantedeschia hybrid cultivar]
Length=167

 Score =   209 bits (531),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 5/141 (4%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K + LKS+DGE FEV E VA+ESQTI+++IEDDC    +PLPNVT +ILAKVIE+C++HV
Sbjct  12   KKLTLKSSDGEVFEVEETVAMESQTIRNLIEDDCTADGVPLPNVTGRILAKVIEFCKKHV  71

Query  255  DPA--KSD---DKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            + A  K+D   D+A +++LK +DA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  72   EIAALKADEGVDRAADEELKVWDADFVKVDQTTLFDLILAANYLNIKSLLDLTCQTVADM  131

Query  420  IKGKTPEEIRKTFNIKNDFTP  482
            IKGKTPEEIRKTFNIKNDFTP
Sbjct  132  IKGKTPEEIRKTFNIKNDFTP  152



>gb|KFK36059.1| hypothetical protein AALP_AA4G072500 [Arabis alpina]
Length=151

 Score =   208 bits (529),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 6/142 (4%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS  KMI+LKS DGE FE+ EAVAL+SQTI HM+EDDC +  IP+ NVT +ILAKVIEYC
Sbjct  1    MSDRKMIVLKSFDGEIFEIEEAVALQSQTIAHMVEDDCVENGIPISNVTGEILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVK-VDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            ++HVD   S     E++LK +D EF+K +DQSTLF+LILAANYLNIK+LLD TCQTVADM
Sbjct  61   KKHVDGGGS-----EEELKTWDEEFMKNIDQSTLFNLILAANYLNIKTLLDFTCQTVADM  115

Query  420  IKGKTPEEIRKTFNIKNDFTPE  485
            IKGKTPE+IR+TFNIKNDFTPE
Sbjct  116  IKGKTPEQIRETFNIKNDFTPE  137



>gb|EMT01771.1| SKP1-like protein 1B [Aegilops tauschii]
Length=252

 Score =   211 bits (538),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 122/160 (76%), Gaps = 16/160 (10%)
 Frame = +3

Query  54   AATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  233
            AA     KMI LKS+DG+ F+V EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVI
Sbjct  2    AAVEGEKKMITLKSSDGQEFDVEEAVAMESQTIRHMIEDDCADNDIPLPNVDSKILSKVI  61

Query  234  EYCRRHVD--PAKSDDKANED--------------DLKAFDAEFVKVDQSTLFDLILAAN  365
            EYC++HV   P  +D  A  D              DLK+FDAEFVKVD++TLFDLILAAN
Sbjct  62   EYCKKHVQASPKPADSGAVTDANSSTSTAAAAPAEDLKSFDAEFVKVDRATLFDLILAAN  121

Query  366  YLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            YLNIK LLDLTCQTVADMIK  TPEEIRK FNIKNDFTPE
Sbjct  122  YLNIKGLLDLTCQTVADMIKDNTPEEIRKIFNIKNDFTPE  161



>emb|CDX73212.1| BnaC06g36600D [Brassica napus]
Length=161

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 122/145 (84%), Gaps = 7/145 (5%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+D E+FEV EAVA ESQT+ HM+EDDC D  IPLPNVT KILAKVIEYC++
Sbjct  2    STKKIVLKSSDNESFEVDEAVARESQTLAHMVEDDCTDNGIPLPNVTGKILAKVIEYCKK  61

Query  249  HVDPAKS-------DDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            HVD A +          +++DDLKA+DAEF+K+DQ+TLF+LILAANYLNIK+LLDLTCQT
Sbjct  62   HVDAAAAKTEAAADGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  408  VADMIKGKTPEEIRKTFNIKNDFTP  482
            VADMIKGKTP+EIR TFNIKNDF+P
Sbjct  122  VADMIKGKTPDEIRTTFNIKNDFSP  146



>gb|KEH23692.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=159

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            ++ KMI LKS D E FEV EAVALESQTIKHMIEDDCAD  IP+ NVT KILAKVIEYC+
Sbjct  4    TTTKMITLKSYDNEIFEVPEAVALESQTIKHMIEDDCADNAIPVQNVTGKILAKVIEYCK  63

Query  246  RHVDPAKSDDKANEDD--LKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            +HV  A +D+K +E +  LK +DA+FVKVD+ TLF+LILAANYL+IKSLLDLTCQ+ ADM
Sbjct  64   KHVQVASADEKPSESEEYLKNWDADFVKVDKETLFELILAANYLDIKSLLDLTCQSAADM  123

Query  420  IKGKTPEEIRKTFNIKNDFTPE  485
            +KGKTPEE+R+ FNIKNDF+PE
Sbjct  124  MKGKTPEEMREMFNIKNDFSPE  145



>ref|XP_008236029.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
 ref|XP_008236030.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
Length=157

 Score =   208 bits (529),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 118/143 (83%), Gaps = 5/143 (3%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            +  K+I LKSADGE FEV EAVALESQTIKHM EDDC D  IPLP V S ILAKVIEYCR
Sbjct  3    TEKKIITLKSADGEIFEVEEAVALESQTIKHMAEDDCVDNAIPLPIVESHILAKVIEYCR  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFV---KVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            +HV+ A +D+  N+D +K F+ +FV   K DQS LFD ILAANYLNIKSLLDLTCQTVAD
Sbjct  63   KHVEFAANDE--NKDTVKKFNDDFVNEIKTDQSVLFDTILAANYLNIKSLLDLTCQTVAD  120

Query  417  MIKGKTPEEIRKTFNIKNDFTPE  485
            MIKGKTPEEIRKTFNI+NDFTPE
Sbjct  121  MIKGKTPEEIRKTFNIQNDFTPE  143



>ref|XP_007024458.1| SKP1-like 4 [Theobroma cacao]
 gb|EOY27080.1| SKP1-like 4 [Theobroma cacao]
Length=152

 Score =   207 bits (528),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 120/139 (86%), Gaps = 4/139 (3%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ K I+L+S+DG+T EV EAVA++  TIKHMIEDDCAD  IP+PNVTS+ILAKV+EYC+
Sbjct  3    STSKKIMLRSSDGKTVEVEEAVAVQLLTIKHMIEDDCADNEIPIPNVTSEILAKVLEYCK  62

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HVD  K      ED+LKA+DA+FVKVDQ+ L+ L+LAANYLNI+SLLDL CQTVADMIK
Sbjct  63   KHVDKGK----MGEDELKAWDADFVKVDQNILYHLVLAANYLNIQSLLDLICQTVADMIK  118

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNI+NDFTP
Sbjct  119  GKTPEEIRKTFNIENDFTP  137



>ref|XP_002976912.1| hypothetical protein SELMODRAFT_271223 [Selaginella moellendorffii]
 ref|XP_002980633.1| hypothetical protein SELMODRAFT_154042 [Selaginella moellendorffii]
 gb|EFJ18284.1| hypothetical protein SELMODRAFT_154042 [Selaginella moellendorffii]
 gb|EFJ22022.1| hypothetical protein SELMODRAFT_271223 [Selaginella moellendorffii]
Length=157

 Score =   208 bits (529),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = +3

Query  81   ILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDP  260
            + L+S+DGE FEV EAVALESQT+K+MIED  +D  IPLPNV SKILAKVIEY + HVD 
Sbjct  5    VKLRSSDGEMFEVDEAVALESQTVKNMIEDTGSDAPIPLPNVPSKILAKVIEYSKYHVDA  64

Query  261  AKSDDKA----NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG  428
             KS D +     E+++KA+DAEFVKVDQ+TLFDLILAANYLNI++LLDLTCQTVADMIKG
Sbjct  65   QKSGDDSKVVPTEEEIKAWDAEFVKVDQATLFDLILAANYLNIRNLLDLTCQTVADMIKG  124

Query  429  KTPEEIRKTFNIKNDFTP  482
            KTPEEIRKTFNIKNDFTP
Sbjct  125  KTPEEIRKTFNIKNDFTP  142



>ref|XP_010683699.1| PREDICTED: SKP1-like protein 1B isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=152

 Score =   207 bits (528),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI LKS+DGE FEV E+VALE +TIK MIEDDCADT IPLPNVT+KIL+KVIEYC++HV+
Sbjct  1    MITLKSSDGEKFEVEESVALECETIKLMIEDDCADTAIPLPNVTAKILSKVIEYCKKHVE  60

Query  258  PAKSDDK-ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  434
             A +    + ED LK +D EFVKVDQ TLF+LILAANYLNI+SLLDLTCQTV+D+IK KT
Sbjct  61   SAAAAKSCSTEDKLKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDLTCQTVSDIIKDKT  120

Query  435  PEEIRKTFNIKNDFTPE  485
            PEE+RK FNIKNDFTPE
Sbjct  121  PEEVRKMFNIKNDFTPE  137



>emb|CDP16774.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   207 bits (528),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 119/137 (87%), Gaps = 2/137 (1%)
 Frame = +3

Query  78   MILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVD  257
            MI+L S+DGETFEV E+V L+SQTIKHMIEDDCA++ IPLPNVT  ILAKV+EYC++HV 
Sbjct  1    MIVLNSSDGETFEVEESVILQSQTIKHMIEDDCANSAIPLPNVTGTILAKVLEYCKQHVK  60

Query  258  PAKSDDKANED--DLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  431
            P   ++ + ++   LK+FDAEFVKVDQ TLFD+ILAANYL+IK LL LTCQTVADM+KGK
Sbjct  61   PNDGEESSKDEAERLKSFDAEFVKVDQKTLFDIILAANYLDIKGLLVLTCQTVADMMKGK  120

Query  432  TPEEIRKTFNIKNDFTP  482
            TPEEIRKTF+IKND+TP
Sbjct  121  TPEEIRKTFHIKNDYTP  137



>ref|XP_010440828.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   207 bits (527),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 121/147 (82%), Gaps = 7/147 (5%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS+ K I+LKS+DGE+FE  E VA ESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC
Sbjct  1    MSTTKKIVLKSSDGESFEADELVARESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSD-------DKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
            ++HV+   S          + +++LK +DAEF+K++Q+TLF+LILAANYLNIK+LLDLTC
Sbjct  61   KKHVEVTASKTDAADAVASSADEELKTWDAEFMKINQATLFELILAANYLNIKTLLDLTC  120

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIR TFNIKNDFTP
Sbjct  121  QTVADMIKGKTPEEIRTTFNIKNDFTP  147



>ref|XP_002887622.1| hypothetical protein ARALYDRAFT_339769 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63881.1| hypothetical protein ARALYDRAFT_339769 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 5/143 (3%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+DGE+FEV EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC++
Sbjct  2    SSKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  249  HVDPAKS-----DDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            HV+ A +     D   +++DLKA+D EF+K+DQ+TLF+LILAANYLNIK+LLDLTCQTVA
Sbjct  62   HVEVAAAKSEAVDGATSDEDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIR TFNIKNDFTP
Sbjct  122  DMIKGKTPEEIRTTFNIKNDFTP  144



>ref|XP_009373027.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=161

 Score =   206 bits (525),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  51   SAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKV  230
            S+++    K I LKS+D E FEV EAVA+ESQTIKHM+ED CA   IPLPNVTS ILAKV
Sbjct  3    SSSSADLKKKITLKSSDDEMFEVEEAVAIESQTIKHMVEDGCAGNAIPLPNVTSAILAKV  62

Query  231  IEYCRRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            IEYCR+H +   +     E ++K +DAEF+K+DQ+TL+DLI+AANYL+IK LLDLTCQTV
Sbjct  63   IEYCRKHREDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTV  122

Query  411  ADMIKGKTPEEIRKTFNIKNDFTPE  485
            ADMIKGKTPE+IR TFNIKNDFTPE
Sbjct  123  ADMIKGKTPEQIRTTFNIKNDFTPE  147



>gb|AEQ39057.1| putative SKP1-like protein 1 [Wolffia arrhiza]
Length=169

 Score =   206 bits (525),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 125/152 (82%), Gaps = 13/152 (9%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S+ K I LKS+DGE FEV EAVA+ESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC+
Sbjct  3    SATKKITLKSSDGEEFEVEEAVAMESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  62

Query  246  RHVDPAK-------------SDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSL  386
            +HVD A                ++  ED++KA+DAEFVKVDQ+TLFDLILAANYLNIKS 
Sbjct  63   KHVDAAAAASAAKSSESVSLGGERGVEDEIKAWDAEFVKVDQATLFDLILAANYLNIKSS  122

Query  387  LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  123  LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  154



>ref|XP_003605510.1| SKP1-like protein [Medicago truncatula]
 gb|AES87707.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=175

 Score =   206 bits (525),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS K I LKS DGETF++ EAVALESQTIKH+I+D   DT IP+PNVT KILAKVIEYC+
Sbjct  21   SSAKKITLKSYDGETFDIEEAVALESQTIKHLIDDVSDDTGIPIPNVTGKILAKVIEYCK  80

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD-MI  422
            +HV+ A+S++K  ED+LK +DAEFV+VDQ TLFDLILAANYLNIKSLLDLTC++VAD M+
Sbjct  81   KHVEYARSNEKPPEDELKKWDAEFVQVDQETLFDLILAANYLNIKSLLDLTCKSVADMML  140

Query  423  KGKTPEEIRKTFNIKNDFTPE  485
              KTPE IR+TFNIKND++PE
Sbjct  141  AAKTPEAIRETFNIKNDYSPE  161



>ref|XP_009372999.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=161

 Score =   206 bits (523),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  51   SAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKV  230
            S+++    K I LKS+D E FEV EAVA++SQTIKHM+ED CA   IPLPNVTS ILAKV
Sbjct  3    SSSSADLKKKITLKSSDDEMFEVEEAVAMQSQTIKHMVEDGCAGNAIPLPNVTSAILAKV  62

Query  231  IEYCRRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            IEYCR+H +   +     E ++K +DAEF+K+DQ+TL+DLI+AANYL+IK LLDLTCQTV
Sbjct  63   IEYCRKHREDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTV  122

Query  411  ADMIKGKTPEEIRKTFNIKNDFTPE  485
            ADMIKGKTPE+IR TFNIKNDFTPE
Sbjct  123  ADMIKGKTPEQIRTTFNIKNDFTPE  147



>ref|XP_004957494.1| PREDICTED: SKP1-like protein 1B-like [Setaria italica]
Length=174

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 117/149 (79%), Gaps = 13/149 (9%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KM++L S D E FEV E+VA ES+TI HMIED C D  IP+PNV  KILAKVIEYC++HV
Sbjct  11   KMLMLVSCDKENFEVEESVARESRTILHMIEDGCTDNGIPIPNVNGKILAKVIEYCKKHV  70

Query  255  D-------------PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDL  395
            +             P  + +KA+ED+LK FDA+FVKVDQ TLFDLILAANYL+IK LLDL
Sbjct  71   EARRGADGDGDAAEPTAATNKASEDELKTFDADFVKVDQGTLFDLILAANYLDIKGLLDL  130

Query  396  TCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            TCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  131  TCQTVADMIKGKTPEEIRKTFNIKNDFTP  159



>ref|XP_006646753.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
 ref|XP_006646755.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
Length=167

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 122/151 (81%), Gaps = 9/151 (6%)
 Frame = +3

Query  57   ATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  236
            A     KMI LKS+DGE FEV EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIE
Sbjct  2    AAEGEKKMITLKSSDGEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIE  61

Query  237  YCRRHVD---------PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLL  389
            YC +HV          PA + +  + DDLK +DA+FVKVDQ+TLFDLILAANYLNIK LL
Sbjct  62   YCNKHVHASNSTSDDAPAPATNSTSADDLKNWDADFVKVDQATLFDLILAANYLNIKGLL  121

Query  390  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            DLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  152



>emb|CAB87834.1| putative kinetochore protein [Vicia faba var. minor]
Length=124

 Score =   204 bits (519),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+S K I LKS+DGE FEV EAVALESQ IKHMIEDDCAD+ IPLPNVTSKILAKVIE+C
Sbjct  1    MASTKKITLKSSDGEAFEVDEAVALESQAIKHMIEDDCADSGIPLPNVTSKILAKVIEFC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            ++HV  A SDDK  ED+LKA+DA+FVKVDQ TLFDLILAANYLNIK+LLDLTCQTVADMI
Sbjct  61   KKHVXAAASDDKPTEDELKAWDADFVKVDQVTLFDLILAANYLNIKNLLDLTCQTVADMI  120

Query  423  KGKT  434
            KGKT
Sbjct  121  KGKT  124



>ref|NP_564105.1| SKP1-like protein 4 [Arabidopsis thaliana]
 sp|Q9LNT9.1|ASK4_ARATH RecName: Full=SKP1-like protein 4; Short=AtSK4 [Arabidopsis thaliana]
 gb|AAF79899.1|AC022472_8 Contains similarity to Skp1 mRNA from Medicago sativa gb|AF135596 
and is a member of Skp1 family PF|01466 [Arabidopsis thaliana]
 gb|AAL25617.1| At1g20140/T20H2_8 [Arabidopsis thaliana]
 gb|AAM19990.1| At1g20140/T20H2_8 [Arabidopsis thaliana]
 gb|AEE29943.1| SKP1-like protein 4 [Arabidopsis thaliana]
Length=163

 Score =   205 bits (522),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 119/146 (82%), Gaps = 7/146 (5%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + KMI+LKS+DGE+FE+ EAVA++SQTIKHMIEDDCAD  IPLPNVT  ILAKVIEYC++
Sbjct  4    TKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKK  63

Query  249  HVDPAK--SDDK-----ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            HV+ A     DK     A  D+LK +D+EFVKVDQ TLFDLILAANYLNI  LLDLTC+ 
Sbjct  64   HVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLTCKA  123

Query  408  VADMIKGKTPEEIRKTFNIKNDFTPE  485
            VAD ++GKTPE++R  FNIKND+TPE
Sbjct  124  VADQMRGKTPEQMRAHFNIKNDYTPE  149



>ref|XP_006661910.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
Length=169

 Score =   205 bits (521),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 121/147 (82%), Gaps = 11/147 (7%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KMI LKS+DGE FEV EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYC +HV
Sbjct  8    KMITLKSSDGEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  255  D-----------PAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
                        PA + +  + DDLK +DA+FVKVDQ+TLFDLILAANYLNIK LLDLTC
Sbjct  68   HASNSTSTSDDAPAPAANSTSADDLKNWDADFVKVDQATLFDLILAANYLNIKGLLDLTC  127

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  128  QTVADMIKGKTPEEIRKTFNIKNDFTP  154



>ref|XP_006359704.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=158

 Score =   204 bits (520),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 114/143 (80%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I L+S+DGE FEV EAVALESQTIK +IEDDCA + IP+ NVTS ILAKV+EY 
Sbjct  1    MSSLKKISLRSSDGEVFEVEEAVALESQTIKFLIEDDCAGSDIPISNVTSNILAKVLEYL  60

Query  243  RRHVDPAKSDDKANEDD---LKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            +RHV+               LK FDAEFVKVDQ TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KRHVEADDKAADDKAAADNDLKVFDAEFVKVDQKTLFDLILAANYLNIKGLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>ref|XP_008382315.1| PREDICTED: SKP1-like protein 1A isoform X2 [Malus domestica]
Length=154

 Score =   204 bits (519),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS K I LKS+D E FEV EA+A+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYC
Sbjct  1    MSSHK-ITLKSSDDEMFEVEEAIAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYC  59

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            R+H +   +     E ++K +DAEF+K+DQ+TL+DLI+AANYL+IK LLDLTCQTVADMI
Sbjct  60   RKHSEDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMI  119

Query  423  KGKTPEEIRKTFNIKNDFTPE  485
            KGKTPE+IR T NIKNDFTPE
Sbjct  120  KGKTPEQIRTTLNIKNDFTPE  140



>ref|XP_002880415.1| hypothetical protein ARALYDRAFT_481069 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56674.1| hypothetical protein ARALYDRAFT_481069 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   204 bits (519),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 7/146 (5%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + K I+LKS+DGE+FEV EAVA+ESQTIKHMIEDDCAD  IPLPNVT  ILAKVIEYC++
Sbjct  2    AAKKIILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKK  61

Query  249  HVDPAK--SDDK-----ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            HV+ A     DK        D+LKA+D +FVKVDQ TLFDLILAANYLNI  LLDLTC+ 
Sbjct  62   HVEAAAEAGGDKDFCGSTENDELKAWDNDFVKVDQPTLFDLILAANYLNISGLLDLTCKA  121

Query  408  VADMIKGKTPEEIRKTFNIKNDFTPE  485
            VADM++GKTPE++R+ FNIKND+TPE
Sbjct  122  VADMMRGKTPEQMREHFNIKNDYTPE  147



>ref|XP_003628375.1| SKP1-like protein [Medicago truncatula]
 gb|AET02851.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=157

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SS + + LKS+D ETFEV EAVAL+SQTIKHMIEDDCA T IPLPNVTSKILAKVIEYC+
Sbjct  3    SSARKVTLKSSDDETFEVEEAVALKSQTIKHMIEDDCAKTEIPLPNVTSKILAKVIEYCK  62

Query  246  RHVDPA-KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI  422
            +HV+    S+ K +EDD+KA+DAEFVKVD +T F+LILAANYL+IKSLL+LTCQ VA+ I
Sbjct  63   KHVEATTSSEGKPSEDDVKAWDAEFVKVDLNTRFELILAANYLDIKSLLELTCQDVAETI  122

Query  423  KGKTPEEIRKTFNIKNDFTPE  485
            K KT EEIRK FN++NDF+PE
Sbjct  123  KDKTVEEIRKIFNVENDFSPE  143



>ref|XP_008382314.1| PREDICTED: SKP1-like protein 1A isoform X1 [Malus domestica]
 gb|AII79404.1| S-phase kinase-associated protein 1-like protein 1 [Malus hupehensis]
Length=160

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I LKS+D E FEV EA+A+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYCR+H 
Sbjct  10   KKITLKSSDDEMFEVEEAIAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRKHS  69

Query  255  DPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  434
            +   +     E ++K +DAEF+K+DQ+TL+DLI+AANYL+IK LLDLTCQTVADMIKGKT
Sbjct  70   EDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKGKT  129

Query  435  PEEIRKTFNIKNDFTPE  485
            PE+IR T NIKNDFTPE
Sbjct  130  PEQIRTTLNIKNDFTPE  146



>ref|XP_009372996.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=160

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I LKS+D E FEV EAVA+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYCR+H 
Sbjct  10   KKITLKSSDDEMFEVEEAVAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRKHH  69

Query  255  DPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  434
            +   +     E ++  +DAEF+K+DQ+TL+DLI+AANYL+IK LLDLTCQTVADMIKGKT
Sbjct  70   EDEGATAADGEKNVNEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKGKT  129

Query  435  PEEIRKTFNIKNDFTPE  485
            PE+IR TFNIKNDFTPE
Sbjct  130  PEQIRTTFNIKNDFTPE  146



>ref|XP_010683698.1| PREDICTED: SKP1-like protein 1B isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=171

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 121/153 (79%), Gaps = 13/153 (8%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            ++ +MI LKS+DGE FEV E+VALE +TIK MIEDDCADT IPLPNVT+KIL+KVIEYC+
Sbjct  4    TTVRMITLKSSDGEKFEVEESVALECETIKLMIEDDCADTAIPLPNVTAKILSKVIEYCK  63

Query  246  RHVDPAKSDDKANEDD-------------LKAFDAEFVKVDQSTLFDLILAANYLNIKSL  386
            +HV+ A +    + +D             LK +D EFVKVDQ TLF+LILAANYLNI+SL
Sbjct  64   KHVESAAAAKSCSTEDSCSSTANSSTNEELKIWDKEFVKVDQKTLFNLILAANYLNIRSL  123

Query  387  LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            LDLTCQTV+D+IK KTPEE+RK FNIKNDFTPE
Sbjct  124  LDLTCQTVSDIIKDKTPEEVRKMFNIKNDFTPE  156



>ref|XP_009362142.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
 ref|XP_009373360.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=177

 Score =   203 bits (517),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGETFEV EAVAL SQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANED-DLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            R+HV+ AK +++A+ D DLKA+DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   RKHVEAAKPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEE  443
            IK KT EE
Sbjct  121  IKEKTLEE  128



>dbj|BAB85603.1| kinetochore protein [Brassica juncea]
 emb|CDX87650.1| BnaA07g32230D [Brassica napus]
Length=161

 Score =   203 bits (516),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 122/145 (84%), Gaps = 7/145 (5%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+D E+FEV EAVA ESQT+ HM+EDDC D  IPLPNVT KILAKVIEYC++
Sbjct  2    STKKIVLKSSDDESFEVDEAVARESQTLAHMVEDDCTDNGIPLPNVTGKILAKVIEYCKK  61

Query  249  HVDPAKS------DDKA-NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            HVD A +      D  A +++DLKA+DAEF+ +DQ+TLF+LILAANYLNIK+LLDLTCQT
Sbjct  62   HVDAAAAKTEATADGGAPSDEDLKAWDAEFMNIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  408  VADMIKGKTPEEIRKTFNIKNDFTP  482
            VADMIKGKTP+EIR TFNIKNDF+P
Sbjct  122  VADMIKGKTPDEIRTTFNIKNDFSP  146



>ref|XP_009413024.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=168

 Score =   203 bits (516),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 6/142 (4%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            + + LKS+DGE FEV EA A+ESQTI+HMIED CA++ IPLPNVTS+ILAKVIEYC +HV
Sbjct  12   RKVTLKSSDGEEFEVAEAAAMESQTIRHMIEDGCAESGIPLPNVTSRILAKVIEYCNKHV  71

Query  255  DPAK--SDDKAN----EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVAD  416
            D +    +D A     +DDLKA+DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  72   DASSKSGEDGATGRVADDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  131

Query  417  MIKGKTPEEIRKTFNIKNDFTP  482
            MIKGKTPEEIRKTFNIKNDFTP
Sbjct  132  MIKGKTPEEIRKTFNIKNDFTP  153



>ref|XP_001753031.1| predicted protein [Physcomitrella patens]
 gb|EDQ82072.1| predicted protein [Physcomitrella patens]
Length=157

 Score =   202 bits (515),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 119/139 (86%), Gaps = 3/139 (2%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K + LKS+D E FEV EAVA ESQ +K+MIED   D  IPLPNV+SKILAKVIEYC+ HV
Sbjct  4    KRVKLKSSDDEMFEVDEAVAFESQAVKNMIEDTGIDAPIPLPNVSSKILAKVIEYCKYHV  63

Query  255  DPAK-SDDKAN--EDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +  K SDDK    E+++KA+DA+FVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVADMIK
Sbjct  64   ENQKPSDDKQATPEEEIKAWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMIK  123

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GKTPEEIRKTFNIKNDFTP
Sbjct  124  GKTPEEIRKTFNIKNDFTP  142



>ref|XP_006304273.1| hypothetical protein CARUB_v10010505mg [Capsella rubella]
 gb|EOA37171.1| hypothetical protein CARUB_v10010505mg [Capsella rubella]
Length=162

 Score =   202 bits (514),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 7/148 (5%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M++ K I+LKS+DGE+FEV E VA+ESQTIKHMIEDDC    IPLPNVT  ILAKVIEYC
Sbjct  1    MAAAKKIILKSSDGESFEVDEVVAVESQTIKHMIEDDCTGNGIPLPNVTGTILAKVIEYC  60

Query  243  RRHVDPAKSD--DK-----ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
            ++H + A  D  DK        D+LKA+D EFVKVDQ+TLFDLILAANYLNI  LLDLTC
Sbjct  61   KKHAEAAADDGGDKDFCGSTENDELKAWDTEFVKVDQNTLFDLILAANYLNISGLLDLTC  120

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            + VAD +KGKTPEE+R  FNIKND++PE
Sbjct  121  KAVADQMKGKTPEEMRAHFNIKNDYSPE  148



>ref|XP_009372998.1| PREDICTED: SKP1-like protein 1A isoform X2 [Pyrus x bretschneideri]
Length=154

 Score =   202 bits (514),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + K I LKS+D E FEV E VA+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYCR+
Sbjct  2    AAKKITLKSSDDEMFEVEEVVAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRK  61

Query  249  HVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG  428
            H +   +     E ++K +DAEF+K+DQ+TL+DLI+AANYL+IK LLDLTCQTVADMIKG
Sbjct  62   HREDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKG  121

Query  429  KTPEEIRKTFNIKNDFTP  482
            KTPE+IR TFNIKNDFTP
Sbjct  122  KTPEQIRTTFNIKNDFTP  139



>emb|CAJ38399.1| fimbriata-associated protein [Plantago major]
Length=144

 Score =   201 bits (512),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 111/129 (86%), Gaps = 11/129 (9%)
 Frame = +3

Query  129  VALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDPA------KSDDK----  278
            V LESQTIKHM+ED+CAD++IPLPNVT KIL+KVIEYC+RHVD A      KSDDK    
Sbjct  1    VGLESQTIKHMVEDECADSIIPLPNVTGKILSKVIEYCKRHVDAAAYSAAAKSDDKLAST  60

Query  279  -ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKT  455
               +DDLK+FD +FVKVDQSTLFDLILAANYLNIK LLDLTCQTVADMIKGKTPEEIRKT
Sbjct  61   ATTDDDLKSFDTDFVKVDQSTLFDLILAANYLNIKPLLDLTCQTVADMIKGKTPEEIRKT  120

Query  456  FNIKNDFTP  482
            FNIKNDFTP
Sbjct  121  FNIKNDFTP  129



>ref|XP_009372997.1| PREDICTED: SKP1-like protein 1A isoform X1 [Pyrus x bretschneideri]
Length=160

 Score =   202 bits (513),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            K I LKS+D E FEV E VA+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYCR+H 
Sbjct  10   KKITLKSSDDEMFEVEEVVAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRKHR  69

Query  255  DPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  434
            +   +     E ++K +DAEF+K+DQ+TL+DLI+AANYL+IK LLDLTCQTVADMIKGKT
Sbjct  70   EDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKGKT  129

Query  435  PEEIRKTFNIKNDFTP  482
            PE+IR TFNIKNDFTP
Sbjct  130  PEQIRTTFNIKNDFTP  145



>ref|XP_010683792.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=170

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 120/152 (79%), Gaps = 12/152 (8%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            ++ + I LKS+DGE F+V E+VALE +TIK MIEDDCAD VIPLPNVT+KIL+KVI YC+
Sbjct  4    TTVRKITLKSSDGEKFDVEESVALECETIKLMIEDDCADNVIPLPNVTAKILSKVIVYCK  63

Query  246  RHVDPAKSDDKANED------------DLKAFDAEFVKVDQSTLFDLILAANYLNIKSLL  389
            +HV+ A +   + ED            +LK +D EFVKVDQSTL DLILAANYLNIKSLL
Sbjct  64   KHVESAAAKSCSTEDSCSSTANSTTNEELKIWDKEFVKVDQSTLLDLILAANYLNIKSLL  123

Query  390  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE  485
            DLTCQTV+DMIK KTPEE+RK FNIKNDFTPE
Sbjct  124  DLTCQTVSDMIKDKTPEEVRKMFNIKNDFTPE  155



>gb|EMT15207.1| SKP1-like protein 1B [Aegilops tauschii]
Length=169

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 118/153 (77%), Gaps = 11/153 (7%)
 Frame = +3

Query  57   ATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  236
            A  ++ K + LKS+DGE FEV  AVA+ SQTIKHM+ED CAD +IPLPNVT+KIL+KVIE
Sbjct  2    AASAAAKKLTLKSSDGEDFEVEVAVAMASQTIKHMVEDGCADNIIPLPNVTAKILSKVIE  61

Query  237  YCRRHVDPAKSDD-----------KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKS  383
            YC +H   A               K +E+ LKAFD EFVKV+Q+TLFDLILAANYL+IK 
Sbjct  62   YCTQHAPKADDAAAADSTGTATAVKPDEEKLKAFDTEFVKVEQATLFDLILAANYLDIKG  121

Query  384  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LLDLTCQTVADMIKGKTPEEIRKTFNI NDFTP
Sbjct  122  LLDLTCQTVADMIKGKTPEEIRKTFNITNDFTP  154



>gb|EMS52877.1| SKP1-like protein 1B [Triticum urartu]
Length=166

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 118/150 (79%), Gaps = 8/150 (5%)
 Frame = +3

Query  57   ATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  236
            A  ++ K + LKS+DGE FEV  AVA+ SQTIKHM+ED CAD +IPLPNV +K+L+KVIE
Sbjct  2    AASAAAKKLTLKSSDGEDFEVEVAVAMASQTIKHMVEDGCADNIIPLPNVNAKVLSKVIE  61

Query  237  YCRRHVDPAKSDD--------KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLD  392
            YC +H   A            K +E+ LKAFDAEFVKV+Q+TLFDLILAANYL+IK LLD
Sbjct  62   YCTQHAPKADDAATADSATAVKPDEETLKAFDAEFVKVEQATLFDLILAANYLDIKGLLD  121

Query  393  LTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LTCQTVADMIKGKTPEEIRKTFNI NDFTP
Sbjct  122  LTCQTVADMIKGKTPEEIRKTFNITNDFTP  151



>emb|CCG34083.1| SCF ubiquitin ligase [uncultured eukaryote]
Length=158

 Score =   201 bits (512),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+    + LKS+D E F+V EAVA ESQTIK+MIED      IPLPNV+SKIL+KVIEYC
Sbjct  1    MARESKVSLKSSDDELFDVTEAVAFESQTIKNMIEDTGTANAIPLPNVSSKILSKVIEYC  60

Query  243  RRHVDPAK-SDDKA--NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            + HV+  K +D+K+  +ED++K +D EFVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KFHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>ref|XP_002462746.1| hypothetical protein SORBIDRAFT_02g031280 [Sorghum bicolor]
 gb|EER99267.1| hypothetical protein SORBIDRAFT_02g031280 [Sorghum bicolor]
Length=173

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 117/147 (80%), Gaps = 11/147 (7%)
 Frame = +3

Query  75   KMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHV  254
            KM+ L S+D E FEV E+ A ES+TI +MIED CAD  IPLPNV ++ILAKVI YCR+H 
Sbjct  12   KMLTLISSDLEKFEVEESAARESRTIGNMIEDSCADNDIPLPNVNARILAKVIVYCRKHA  71

Query  255  -----------DPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTC  401
                       +P  + +KA+ED+LK FDAEFVKVDQ+TLFDLILAANYL+IK LLDLTC
Sbjct  72   SARGGTDAGDAEPTAATNKASEDELKTFDAEFVKVDQATLFDLILAANYLDIKGLLDLTC  131

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            QTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  132  QTVADMIKGKTPEEIRKTFNIKNDFTP  158



>ref|XP_009106248.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
Length=161

 Score =   201 bits (512),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 121/145 (83%), Gaps = 7/145 (5%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S K I+LKS+D E+FEV EAVA ESQT+ HM+EDDC D  IPLPNVT KILAKVIEYC++
Sbjct  2    STKKIVLKSSDAESFEVDEAVARESQTLAHMVEDDCTDNGIPLPNVTGKILAKVIEYCKK  61

Query  249  HVDPAKS------DDKA-NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            HVD A +      D  A +++DLKA+DAEF+ +DQ+TLF+LILAANYLNIK+LLDLTCQT
Sbjct  62   HVDAAAAKTEATADGGAPSDEDLKAWDAEFMNIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  408  VADMIKGKTPEEIRKTFNIKNDFTP  482
            V DMIKGKTP+EIR TFNIKNDF+P
Sbjct  122  VPDMIKGKTPDEIRTTFNIKNDFSP  146



>gb|AAX92710.1| SCF ubiquitin ligase [Picea abies]
Length=190

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 122/144 (85%), Gaps = 3/144 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+    + LKS+D E F+V EAVA ESQTIK+MIED    + IPLPNV+SKIL+KVIEYC
Sbjct  1    MARECKVSLKSSDDELFDVNEAVAFESQTIKNMIEDTGTASAIPLPNVSSKILSKVIEYC  60

Query  243  RRHVDPAK-SDDKA--NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            + HV+  K +D+K+  +ED++K +D EFVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KYHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTPE  485
            DMIKGKTPEEIRKTFNIKNDFTPE
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTPE  144



>ref|XP_009376944.1| PREDICTED: SKP1-like protein 1B [Pyrus x bretschneideri]
Length=163

 Score =   201 bits (512),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 119/147 (81%), Gaps = 9/147 (6%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            +  KMI LKS+DGE FEV EAVA+ESQTIKH++ED C D VIPL NVTS ILAK+IEYCR
Sbjct  3    AEKKMITLKSSDGEAFEVDEAVAMESQTIKHLVED-CTDNVIPLHNVTSHILAKIIEYCR  61

Query  246  RHVDPAKSDD-----KANEDDLKAFDAEFV---KVDQSTLFDLILAANYLNIKSLLDLTC  401
            +HV+  K  D     ++ ++ LK FD +FV   K DQ+ LFDLILAANYLNIKSLLDLTC
Sbjct  62   KHVEGRKDGDSTDLGQSGDETLKKFDEDFVNEIKADQNVLFDLILAANYLNIKSLLDLTC  121

Query  402  QTVADMIKGKTPEEIRKTFNIKNDFTP  482
            Q+VADMIKGKTPE++RKTFNIKNDFTP
Sbjct  122  QSVADMIKGKTPEDVRKTFNIKNDFTP  148



>ref|XP_010646804.1| PREDICTED: SKP1-like protein 1A isoform X3 [Vitis vinifera]
Length=301

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  81   ILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDP  260
            + L+S+DG  F V  AVA+ESQTIKHMIED CAD  IPLPNVTSKILA+VIEYC++HV+ 
Sbjct  153  LTLQSSDGMFFYVDVAVAMESQTIKHMIEDRCADNAIPLPNVTSKILARVIEYCKKHVET  212

Query  261  AKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPE  440
             K+++ A  D+L+A+DA+FVKVDQ+TLFDLILAANYL+IKSLLDLTCQTVADMIKGKTP 
Sbjct  213  PKAEEHAVNDELRAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKGKTPS  272

Query  441  EIRKTFNIKNDFTP  482
            EIRKTF  KNDFTP
Sbjct  273  EIRKTFIYKNDFTP  286


 Score =   189 bits (479),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 117/154 (76%), Gaps = 15/154 (10%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+S K I L+S+DGE F++ E VA+ESQTIKHMIED CAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MASSKTITLRSSDGEAFDLEEVVAVESQTIKHMIEDGCADNAIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM-  419
            ++HV+  K+++ A  D+LKA+DA+FVKVDQ+TLFDLILAANYL IKSLLDLTCQTVADM 
Sbjct  61   KKHVETPKAEEHAVNDELKAWDADFVKVDQATLFDLILAANYLGIKSLLDLTCQTVADMI  120

Query  420  --------------IKGKTPEEIRKTFNIKNDFT  479
                          IK ++ E+I K +NIK   T
Sbjct  121  KEMSGNENCEIHLLIKERSLEKICKIYNIKTKLT  154



>ref|XP_002867118.1| hypothetical protein ARALYDRAFT_912943 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43377.1| hypothetical protein ARALYDRAFT_912943 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   201 bits (510),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 4/139 (3%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            S  MI+L S+DG++FEV EAVA++SQTI HM+EDDCA   IPL NVTSK LAKVIEYC++
Sbjct  2    SSTMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCAANGIPLANVTSKTLAKVIEYCKK  61

Query  249  H-VDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            H VD A   +  +ED+LK +D EF++ DQST+FDLILAANYLNIKSLLDLTCQT+ADMIK
Sbjct  62   HHVDEA---NPISEDELKKWDTEFMETDQSTIFDLILAANYLNIKSLLDLTCQTIADMIK  118

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GK PEEIR  FNIKNDFTP
Sbjct  119  GKNPEEIRTLFNIKNDFTP  137



>ref|XP_010646801.1| PREDICTED: SKP1-like protein 1A isoform X2 [Vitis vinifera]
Length=306

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  87   LKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDPAK  266
            L+S+DG  F V  AVA+ESQTIKHMIED CAD  IPLPNVTSKILA+VIEYC++HV+  K
Sbjct  160  LQSSDGMFFYVDVAVAMESQTIKHMIEDRCADNAIPLPNVTSKILARVIEYCKKHVETPK  219

Query  267  SDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEI  446
            +++ A  D+L+A+DA+FVKVDQ+TLFDLILAANYL+IKSLLDLTCQTVADMIKGKTP EI
Sbjct  220  AEEHAVNDELRAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKGKTPSEI  279

Query  447  RKTFNIKNDFTP  482
            RKTF  KNDFTP
Sbjct  280  RKTFIYKNDFTP  291


 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 109/159 (69%), Gaps = 20/159 (13%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIED-----DCADTVIPLPNVTSKILAK  227
            M+S K+I L+S++GE F +    A+E   IK MIE+        D  IPLPNVTSKILAK
Sbjct  1    MASSKIITLRSSEGEDFGLDVVAAMELLVIKPMIEELQVIKPMIDNAIPLPNVTSKILAK  60

Query  228  VIEYCRRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            VIEYC++HV+  K+++ A  D+LKA+DA+FVKVDQ+TLFDLILAANYL IKSLLDLTCQT
Sbjct  61   VIEYCKKHVETPKAEEHAVNDELKAWDADFVKVDQATLFDLILAANYLGIKSLLDLTCQT  120

Query  408  VADM---------------IKGKTPEEIRKTFNIKNDFT  479
            VADM               IK ++ E+I K +NIK   T
Sbjct  121  VADMIKEMSGNENCEIHLLIKERSLEKICKIYNIKTKLT  159



>gb|ACR38888.1| SKP1 [Pellia endiviifolia (species B)]
 gb|ACR38897.1| SKP1 [Pellia endiviifolia (species B)]
Length=158

 Score =   201 bits (510),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MS    + LKS+D E FEV + VA ESQT+K+MIED   +  IPLPNV+SKIL+KVIEYC
Sbjct  1    MSKETKVKLKSSDDEMFEVEDVVAFESQTVKNMIEDTGTENAIPLPNVSSKILSKVIEYC  60

Query  243  RRHVDPAKS-DDK--ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            + HV+  K+ DDK  A ED++K +DAEFVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KFHVETQKAADDKPVATEDEIKTWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTF  KNDFTP
Sbjct  121  DMIKGKTPEEIRKTFTFKNDFTP  143



>ref|XP_002890373.1| hypothetical protein ARALYDRAFT_889462 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66632.1| hypothetical protein ARALYDRAFT_889462 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   201 bits (510),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 7/145 (5%)
 Frame = +3

Query  69   SPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRR  248
            + K I+LKS+DGE+FE+ EAVA+ESQTIKHMIEDDCAD  IPLPNVT  ILAKVIEYC++
Sbjct  2    AAKKIILKSSDGESFEIDEAVAVESQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKK  61

Query  249  HVDPAKSDD-------KANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQT  407
            HV+ A               D+LKA+D +FVKVDQ TLFDLILAANYLNI  LLDLTC+ 
Sbjct  62   HVEAAAESGGDEDFCGSTENDELKAWDNDFVKVDQPTLFDLILAANYLNISGLLDLTCKA  121

Query  408  VADMIKGKTPEEIRKTFNIKNDFTP  482
            VADM++GKTPE++R+ FNIKND+TP
Sbjct  122  VADMMRGKTPEQMREHFNIKNDYTP  146



>gb|ABK21374.1| unknown [Picea sitchensis]
 gb|ABK26105.1| unknown [Picea sitchensis]
 gb|ABK26432.1| unknown [Picea sitchensis]
Length=158

 Score =   200 bits (509),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+    + LKS+D E F+V EAVA ESQTIK+MIED    + IPLPNV+SKIL+KVIEYC
Sbjct  1    MARECKVSLKSSDDELFDVNEAVAFESQTIKNMIEDTGTASAIPLPNVSSKILSKVIEYC  60

Query  243  RRHVDPAK-SDDKA--NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            + HV+  K +D+K+  +ED++K +D EFVKVDQ+TLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KYHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>ref|NP_001176525.1| Os11g0456300 [Oryza sativa Japonica Group]
 gb|ABA93508.1| SKP1-like protein 1B, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH95253.1| Os11g0456300 [Oryza sativa Japonica Group]
Length=173

 Score =   201 bits (510),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 119/157 (76%), Gaps = 15/157 (10%)
 Frame = +3

Query  57   ATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  236
            A     KMI LKS+DGE FEV E VA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIE
Sbjct  2    AAEGEKKMITLKSSDGEEFEVEEPVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIE  61

Query  237  YCRRHVDPAKSDDKA---------------NEDDLKAFDAEFVKVDQSTLFDLILAANYL  371
            YC +HV  A +                   + +DLK +DA+FVKVDQ+TLFDLILAANYL
Sbjct  62   YCNKHVHAAAAAASKAADDAASAAAAVPPPSGEDLKNWDADFVKVDQATLFDLILAANYL  121

Query  372  NIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            NIK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  122  NIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  158



>emb|CDP16773.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   200 bits (508),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 120/139 (86%), Gaps = 5/139 (4%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            SSPKMI L+S+DGETFEV E VA+ES+TIKHMIEDDCA++ IP+PNVTS  L KVIEYC+
Sbjct  4    SSPKMITLQSSDGETFEVEEVVAMESRTIKHMIEDDCANSSIPIPNVTSNTLTKVIEYCK  63

Query  246  RHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  425
            +HV+ AK+D    E+ LK+FDA+F+K+D+ TL+DL++A+NYL+IKSLLDL CQTVAD IK
Sbjct  64   KHVE-AKND----EEGLKSFDADFMKIDKDTLYDLLMASNYLDIKSLLDLGCQTVADKIK  118

Query  426  GKTPEEIRKTFNIKNDFTP  482
            GK PE+IRK F IKNDF+P
Sbjct  119  GKNPEDIRKEFGIKNDFSP  137



>ref|XP_003636464.1| SKP1-like protein [Medicago truncatula]
 gb|KEH36015.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=158

 Score =   200 bits (508),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 117/142 (82%), Gaps = 2/142 (1%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            S  K I L S+DGETF+V + VA ESQ IKHMIE+DCA+  IPL +VT+ ILA VIEYC+
Sbjct  3    SYTKKITLNSSDGETFKVSKMVARESQVIKHMIEEDCANEAIPLQDVTANILAMVIEYCK  62

Query  246  RHVDPA--KSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            +HVD A   SD K +EDDL+ +DAEFVKVD+ TLF+LI AANYL IKSLLDLTCQTVADM
Sbjct  63   KHVDAAAASSDGKPSEDDLEDWDAEFVKVDKGTLFNLIDAANYLEIKSLLDLTCQTVADM  122

Query  420  IKGKTPEEIRKTFNIKNDFTPE  485
            +KGKTPEEIR TFNI+NDFTP+
Sbjct  123  MKGKTPEEIRNTFNIENDFTPQ  144



>ref|XP_009363144.1| PREDICTED: uncharacterized protein LOC103953139 [Pyrus x bretschneideri]
Length=275

 Score =   204 bits (518),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            MSS + I LKS+DGETFEV EAVAL SQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  243  RRHVDPAKSDDKANED-DLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            R+HV+ AK +++A+ D DLKA+DAEFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   RKHVEAAKPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  420  IKGKTPEE  443
            IK KT EE
Sbjct  121  IKEKTLEE  128



>emb|CAJ38400.1| fimbriata-associated protein [Plantago major]
Length=186

 Score =   201 bits (510),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 111/129 (86%), Gaps = 11/129 (9%)
 Frame = +3

Query  129  VALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCRRHVDPAKS------DDK----  278
            VA+ESQTIKHMIEDDCAD VIPLPNVT KIL+KVIEYC+RHVD A +      +DK    
Sbjct  43   VAVESQTIKHMIEDDCADNVIPLPNVTGKILSKVIEYCKRHVDAAAANTAAKAEDKLAST  102

Query  279  -ANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKT  455
               +DDLKAFD +FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKT
Sbjct  103  APTDDDLKAFDTDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKT  162

Query  456  FNIKNDFTP  482
            FNIKNDFTP
Sbjct  163  FNIKNDFTP  171



>ref|XP_008372868.1| PREDICTED: SKP1-like protein 1B [Malus domestica]
Length=165

 Score =   200 bits (508),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 113/148 (76%), Gaps = 9/148 (6%)
 Frame = +3

Query  66   SSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCR  245
            +  KMI LKS+DGE FEV EAVA+ESQTIKHM+EDDCAD  IPLPNVTS ILAKVIEYCR
Sbjct  3    AEKKMITLKSSDGEAFEVDEAVAMESQTIKHMVEDDCADNAIPLPNVTSHILAKVIEYCR  62

Query  246  RHVDPAKSDDK------ANEDDLKAFDAEFV---KVDQSTLFDLILAANYLNIKSLLDLT  398
            +HV+     D        +E  LK FD +FV   K DQ+ LFDLILAANYLNIKSLLDLT
Sbjct  63   KHVEGRTDGDSTDXGKIGDEXTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSLLDLT  122

Query  399  CQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            C TVADMIKG TPE I KTFNIKN FTP
Sbjct  123  CXTVADMIKGXTPEXIXKTFNIKNXFTP  150



>gb|ABK25195.1| unknown [Picea sitchensis]
Length=158

 Score =   199 bits (507),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 3/143 (2%)
 Frame = +3

Query  63   MSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  242
            M+    + LKS+D E F+V EAVA ESQTIK+MIED    + IPLPNV+SKIL+KVIEYC
Sbjct  1    MARECKVSLKSSDDELFDVNEAVAFESQTIKNMIEDTGTASAIPLPNVSSKILSKVIEYC  60

Query  243  RRHVDPAK-SDDKA--NEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  413
            + HV+  K +D+K+  +ED++K +D EFVKVDQ+TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KYHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKDLLDLTCQTVA  120

Query  414  DMIKGKTPEEIRKTFNIKNDFTP  482
            DMIKGKTPEEIRKTFNIKNDFTP
Sbjct  121  DMIKGKTPEEIRKTFNIKNDFTP  143



>emb|CAB85491.1| putative kinetochore protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score =   200 bits (508),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 122/158 (77%), Gaps = 14/158 (9%)
 Frame = +3

Query  51   SAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKV  230
            +A      KMI LKS+DGE FEV EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KV
Sbjct  3    AAGDAGEKKMITLKSSDGEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKV  62

Query  231  IEYCRRHVDPAKSDDKANE--------------DDLKAFDAEFVKVDQSTLFDLILAANY  368
            IEYC +HV    +D  A+               +DLK +DAEFVKVDQ+TLFDLILAANY
Sbjct  63   IEYCNKHVQAKPADAGASSDTASAAXGAPAAPAEDLKNWDAEFVKVDQATLFDLILAANY  122

Query  369  LNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  482
            LNIK LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP
Sbjct  123  LNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTP  160



>ref|XP_008382316.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
 gb|AII79403.1| S-phase kinase-associated protein 1-like protein 3 [Malus hupehensis]
Length=161

 Score =   198 bits (504),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  51   SAATMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKV  230
            S+++    K I LKS+D E FEV EAVA++SQTIKHM+ED CA   IPLPNVTS ILAKV
Sbjct  3    SSSSADLKKKINLKSSDDEMFEVEEAVAMKSQTIKHMVEDGCAGNAIPLPNVTSAILAKV  62

Query  231  IEYCRRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTV  410
            IEYCR+H +   +    +E ++K +DAEF+K+DQ+ L+DLI+AANYL+IK LLDLTCQTV
Sbjct  63   IEYCRKHSEDEGATAADSEKNVKEWDAEFMKIDQNILYDLIMAANYLDIKGLLDLTCQTV  122

Query  411  ADMIKGKTPEEIRKTFNIKNDFTPE  485
            A+MIKGKTPE+IR TFNI NDFTPE
Sbjct  123  ANMIKGKTPEQIRTTFNITNDFTPE  147



>ref|XP_004289997.1| PREDICTED: SKP1-like protein 1A [Fragaria vesca subsp. vesca]
Length=154

 Score =   197 bits (502),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 116/142 (82%), Gaps = 3/142 (2%)
 Frame = +3

Query  60   TMSSPKMILLKSADGETFEVMEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEY  239
            +  + K+++L +AD ETFE+ EAV L+SQTIKHM+ED+CAD  IPLPNVTSK L+KV+EY
Sbjct  2    STETKKILVLHTADNETFEIEEAVVLQSQTIKHMVEDECADNAIPLPNVTSKTLSKVLEY  61

Query  240  CRRHVDPAKSDDKANEDDLKAFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM  419
            C++H   A+   +  E+ L+A+DA+FV  D  TL+D+I+AANYLNIKSLLDLTCQ VADM
Sbjct  62   CKKH---AEDSGEGGEEALRAWDADFVNFDTDTLYDVIMAANYLNIKSLLDLTCQRVADM  118

Query  420  IKGKTPEEIRKTFNIKNDFTPE  485
             KGKTPEEIR TFNIKNDF+PE
Sbjct  119  CKGKTPEEIRNTFNIKNDFSPE  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960