BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J19

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P19173.3|COX5C_IPOBA  RecName: Full=Cytochrome c oxidase subun...    130   1e-35   Ipomoea batatas [batate]
ref|XP_009631036.1|  PREDICTED: cytochrome c oxidase subunit 5C         117   9e-31   Nicotiana tomentosiformis
ref|XP_009797280.1|  PREDICTED: cytochrome c oxidase subunit 5C         114   2e-29   Nicotiana sylvestris
ref|XP_009596474.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...    111   4e-28   Nicotiana tomentosiformis
ref|XP_009596475.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...    110   7e-28   Nicotiana tomentosiformis
ref|XP_006338585.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...    107   8e-27   Solanum tuberosum [potatoes]
gb|KCW50112.1|  hypothetical protein EUGRSUZ_K03546                     107   2e-26   Eucalyptus grandis [rose gum]
ref|NP_001067021.1|  Os12g0561000                                       103   2e-25   
ref|XP_003579253.1|  PREDICTED: cytochrome c oxidase subunit 5C         103   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_008660415.1|  PREDICTED: cytochrome c oxidase subunit 5C         104   3e-25   
ref|XP_004232316.1|  PREDICTED: cytochrome c oxidase subunit 5C-like    103   3e-25   Solanum lycopersicum
sp|Q8VY39.1|CX5C2_HELAN  RecName: Full=Cytochrome c oxidase subun...    103   3e-25   Helianthus annuus
gb|ACG39497.1|  cytochrome c oxidase polypeptide Vc                     103   4e-25   Zea mays [maize]
ref|XP_004962769.1|  PREDICTED: cytochrome c oxidase subunit 5C-like    103   4e-25   
ref|XP_003570359.1|  PREDICTED: cytochrome c oxidase subunit 5C-like    102   5e-25   Brachypodium distachyon [annual false brome]
ref|XP_002443358.1|  hypothetical protein SORBIDRAFT_08g018180          102   5e-25   Sorghum bicolor [broomcorn]
ref|XP_002320297.1|  hypothetical protein POPTR_0014s11560g             102   6e-25   
gb|KHG00470.1|  Cytochrome c oxidase subunit 5C                         102   7e-25   Gossypium arboreum [tree cotton]
ref|XP_003591400.1|  Cytochrome c oxidase subunit 5C                    102   8e-25   Medicago truncatula
ref|XP_011098443.1|  PREDICTED: cytochrome c oxidase subunit 5C i...    101   1e-24   Sesamum indicum [beniseed]
ref|XP_002862722.1|  cytochrome c oxidase subunit VC family protein     101   2e-24   
ref|XP_002515282.1|  Cytochrome c oxidase polypeptide Vc, putative      101   2e-24   
ref|XP_006402379.1|  hypothetical protein EUTSA_v10006359mg             101   2e-24   
gb|ADB85086.1|  cytochrome c oxidase polypeptide Vc                     101   2e-24   Jatropha curcas
ref|XP_009383933.1|  PREDICTED: cytochrome c oxidase subunit 5C-like    100   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011098444.1|  PREDICTED: cytochrome c oxidase subunit 5C i...    100   3e-24   Sesamum indicum [beniseed]
ref|XP_006397931.1|  hypothetical protein EUTSA_v10001714mg             100   4e-24   
ref|XP_003535930.1|  PREDICTED: cytochrome c oxidase subunit 5C-2       100   5e-24   Glycine max [soybeans]
gb|ACG31149.1|  cytochrome c oxidase polypeptide Vc                     100   5e-24   Zea mays [maize]
ref|XP_009133811.1|  PREDICTED: probable cytochrome c oxidase sub...    100   5e-24   Brassica rapa
gb|KJB06278.1|  hypothetical protein B456_001G144400                    100   6e-24   Gossypium raimondii
sp|Q9LZQ0.1|CX5C2_ARATH  RecName: Full=Cytochrome c oxidase subun...    100   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006446555.1|  hypothetical protein CICLE_v10017383mg             100   7e-24   
ref|XP_011042251.1|  PREDICTED: cytochrome c oxidase subunit 5C       99.8    9e-24   Populus euphratica
gb|KDP28259.1|  hypothetical protein JCGZ_14030                       99.4    1e-23   Jatropha curcas
gb|EYU44775.1|  hypothetical protein MIMGU_mgv11b013929mg               100   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_002302765.2|  hypothetical protein POPTR_0002s19690g           99.4    1e-23   
ref|XP_010521442.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     99.4    1e-23   Tarenaya hassleriana [spider flower]
ref|XP_006574529.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     99.0    2e-23   Glycine max [soybeans]
ref|XP_004495903.1|  PREDICTED: cytochrome c oxidase subunit 5C-2...  99.0    2e-23   Cicer arietinum [garbanzo]
ref|XP_010674655.1|  PREDICTED: cytochrome c oxidase subunit 5C       98.6    2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007051107.1|  Cytochrome c oxidase subunit 5C                  98.6    2e-23   Theobroma cacao [chocolate]
ref|XP_010038288.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     98.6    2e-23   Eucalyptus grandis [rose gum]
gb|ACG33529.1|  cytochrome c oxidase polypeptide Vc                   98.6    2e-23   Zea mays [maize]
ref|XP_010273899.1|  PREDICTED: cytochrome c oxidase subunit 5C       98.6    2e-23   
ref|XP_003521595.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  99.4    3e-23   Glycine max [soybeans]
ref|XP_004300448.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     98.2    3e-23   Fragaria vesca subsp. vesca
ref|XP_006577163.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  99.0    3e-23   Glycine max [soybeans]
gb|EYU35673.1|  hypothetical protein MIMGU_mgv1a017603mg              98.2    4e-23   Erythranthe guttata [common monkey flower]
ref|XP_009382494.1|  PREDICTED: probable cytochrome c oxidase sub...  98.2    4e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU15919.1|  unknown                                               97.8    4e-23   Glycine max [soybeans]
ref|XP_006387973.1|  hypothetical protein POPTR_0440s00200g           99.0    4e-23   
ref|XP_006470279.1|  PREDICTED: putative cytochrome c oxidase sub...  97.4    7e-23   Citrus sinensis [apfelsine]
ref|XP_010261730.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  97.1    8e-23   
gb|KHN30639.1|  Cytochrome c oxidase subunit 5C-2                     97.1    8e-23   Glycine soja [wild soybean]
ref|NP_200939.1|  putative cytochrome c oxidase subunit 5C-3          97.1    9e-23   
ref|XP_002282099.1|  PREDICTED: cytochrome c oxidase subunit 5C       96.7    1e-22   
gb|AFK48388.1|  unknown                                               96.7    1e-22   Lotus japonicus
ref|XP_006577164.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  96.7    1e-22   
ref|XP_009384427.1|  PREDICTED: cytochrome c oxidase subunit 5C       96.7    1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008797451.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  96.3    2e-22   
gb|KFK33110.1|  hypothetical protein AALP_AA6G332300                  96.3    2e-22   Arabis alpina [alpine rockcress]
gb|EYU20843.1|  hypothetical protein MIMGU_mgv1a017612mg              96.3    2e-22   Erythranthe guttata [common monkey flower]
ref|XP_006577165.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  96.3    2e-22   Glycine max [soybeans]
gb|AES82189.2|  cytochrome C oxidase subunit 5C                       97.4    2e-22   Medicago truncatula
ref|XP_004135996.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  95.9    3e-22   Cucumis sativus [cucumbers]
sp|Q8VY40.1|CX5C1_HELAN  RecName: Full=Cytochrome c oxidase subun...  95.5    3e-22   Helianthus annuus
ref|XP_009411629.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  95.5    3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007145147.1|  hypothetical protein PHAVU_007G214100g           95.1    5e-22   Phaseolus vulgaris [French bean]
ref|XP_003625971.1|  Cytochrome c oxidase subunit 5C                  94.4    8e-22   
ref|XP_002868657.1|  hypothetical protein ARALYDRAFT_493950           94.4    9e-22   
ref|XP_010931748.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  95.1    1e-21   Elaeis guineensis
ref|XP_010528240.1|  PREDICTED: putative cytochrome c oxidase sub...  94.0    1e-21   Tarenaya hassleriana [spider flower]
ref|XP_004229388.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     94.0    1e-21   Solanum lycopersicum
ref|XP_009136460.1|  PREDICTED: probable cytochrome c oxidase sub...  93.6    2e-21   Brassica rapa
ref|XP_009604952.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     93.6    2e-21   Nicotiana tomentosiformis
ref|XP_010441174.1|  PREDICTED: putative cytochrome c oxidase sub...  93.6    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006840451.1|  hypothetical protein AMTR_s00045p00172340        94.4    2e-21   
ref|XP_008812525.1|  PREDICTED: probable cytochrome c oxidase sub...  93.2    3e-21   Phoenix dactylifera
ref|XP_010435906.1|  PREDICTED: putative cytochrome c oxidase sub...  93.2    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010921491.1|  PREDICTED: cytochrome c oxidase subunit 5C i...  94.0    3e-21   Elaeis guineensis
ref|XP_011079230.1|  PREDICTED: probable cytochrome c oxidase sub...  92.8    4e-21   Sesamum indicum [beniseed]
ref|XP_008781111.1|  PREDICTED: cytochrome c oxidase subunit 5C       92.8    4e-21   Phoenix dactylifera
ref|XP_010921492.1|  PREDICTED: cytochrome c oxidase subunit 5C i...  92.8    4e-21   Elaeis guineensis
ref|NP_001119340.1|  putative cytochrome c oxidase subunit 5C-4       92.8    4e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AGE46018.1|  cytochrome c oxidase subunit 5C                       92.4    5e-21   Elaeis guineensis
ref|XP_009139998.1|  PREDICTED: putative cytochrome c oxidase sub...  92.0    8e-21   Brassica rapa
ref|XP_007201483.1|  hypothetical protein PRUPE_ppa014546mg           91.3    1e-20   Prunus persica
gb|KCW52911.1|  hypothetical protein EUGRSUZ_J02226                   91.7    2e-20   Eucalyptus grandis [rose gum]
ref|XP_010033301.1|  PREDICTED: putative cytochrome c oxidase sub...  90.1    4e-20   Eucalyptus grandis [rose gum]
ref|XP_008235147.1|  PREDICTED: probable cytochrome c oxidase sub...  89.7    6e-20   Prunus mume [ume]
gb|KDP45317.1|  hypothetical protein JCGZ_09566                       89.7    6e-20   Jatropha curcas
ref|XP_011070033.1|  PREDICTED: cytochrome c oxidase subunit 5C-2...  89.4    8e-20   Sesamum indicum [beniseed]
ref|XP_010106282.1|  Cytochrome c oxidase subunit 5C-2                89.4    8e-20   Morus notabilis
gb|KJB24414.1|  hypothetical protein B456_004G144400                  89.0    9e-20   Gossypium raimondii
ref|XP_006492338.1|  PREDICTED: probable cytochrome c oxidase sub...  89.0    9e-20   Citrus sinensis [apfelsine]
gb|EPS64250.1|  hypothetical protein M569_10536                       89.4    1e-19   Genlisea aurea
gb|KJB24415.1|  hypothetical protein B456_004G144400                  88.6    1e-19   Gossypium raimondii
ref|XP_008386720.1|  PREDICTED: probable cytochrome c oxidase sub...  88.6    2e-19   Malus domestica [apple tree]
emb|CDP17068.1|  unnamed protein product                              88.6    2e-19   Coffea canephora [robusta coffee]
ref|XP_010689705.1|  PREDICTED: putative cytochrome c oxidase sub...  87.8    3e-19   
ref|XP_008369045.1|  PREDICTED: probable cytochrome c oxidase sub...  86.7    8e-19   Malus domestica [apple tree]
ref|XP_010088697.1|  Cytochrome c oxidase subunit 5C-2                86.3    1e-18   
emb|CDP02085.1|  unnamed protein product                              86.3    1e-18   Coffea canephora [robusta coffee]
ref|XP_008345523.1|  PREDICTED: probable cytochrome c oxidase sub...  86.3    2e-18   Malus domestica [apple tree]
ref|XP_007163179.1|  hypothetical protein PHAVU_001G213100g           86.3    3e-18   Phaseolus vulgaris [French bean]
ref|XP_002524666.1|  Cytochrome c oxidase polypeptide Vc-2, putative  84.0    7e-18   
ref|XP_010660885.1|  PREDICTED: putative cytochrome c oxidase sub...  83.6    1e-17   Vitis vinifera
ref|XP_010251362.1|  PREDICTED: putative cytochrome c oxidase sub...  82.8    2e-17   
ref|XP_008785010.1|  PREDICTED: putative cytochrome c oxidase sub...  82.8    2e-17   
ref|XP_002880298.1|  cytochrome c oxidase subunit VC family protein   82.0    4e-17   
ref|NP_182260.1|  cytochrome c oxidase subunit Vc family protein      80.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292157.1|  hypothetical protein CARUB_v10018363mg           80.1    2e-16   Capsella rubella
ref|XP_009116909.1|  PREDICTED: probable cytochrome c oxidase sub...  79.7    3e-16   Brassica rapa
ref|XP_009104382.1|  PREDICTED: probable cytochrome c oxidase sub...  79.7    3e-16   Brassica rapa
emb|CDY25109.1|  BnaC06g18510D                                        81.3    4e-16   Brassica napus [oilseed rape]
ref|XP_002866426.1|  hypothetical protein ARALYDRAFT_496289           77.0    3e-15   
ref|XP_008237260.1|  PREDICTED: cytochrome c oxidase subunit 5C-2...  76.3    5e-15   Prunus mume [ume]
gb|ABK20891.1|  unknown                                               76.3    7e-15   Picea sitchensis
gb|ABL97970.1|  cytochrome-c oxidase                                  75.5    1e-14   Brassica rapa
gb|EMT09818.1|  Putative cytochrome c oxidase subunit 5C-4            75.9    1e-14   
emb|CDM81139.1|  unnamed protein product                              74.7    3e-14   Triticum aestivum [Canadian hard winter wheat]
emb|CDM81134.1|  unnamed protein product                              75.5    3e-14   Triticum aestivum [Canadian hard winter wheat]
emb|CDY02156.1|  BnaA03g40110D                                        79.3    6e-14   
emb|CDY23070.1|  BnaC07g31170D                                        78.6    1e-13   Brassica napus [oilseed rape]
emb|CDM81135.1|  unnamed protein product                              73.9    3e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002457267.1|  hypothetical protein SORBIDRAFT_03g004470        72.0    3e-13   Sorghum bicolor [broomcorn]
emb|CDJ26654.1|  unnamed protein product                              68.9    4e-12   Triticum aestivum [Canadian hard winter wheat]
gb|KHN33920.1|  Cytochrome c oxidase subunit 5C-2                     68.2    4e-12   Glycine soja [wild soybean]
gb|AAD02550.1|  PGPS/D8                                               67.4    1e-11   Petunia x hybrida [garden petunia]
ref|XP_006601150.1|  PREDICTED: probable cytochrome c oxidase sub...  67.0    1e-11   
ref|XP_007214274.1|  hypothetical protein PRUPE_ppa026977mg           68.6    2e-11   
ref|XP_007216586.1|  hypothetical protein PRUPE_ppb018456mg           66.6    2e-11   
ref|XP_008230942.1|  PREDICTED: uncharacterized protein LOC103330167  65.5    2e-10   
emb|CDY27493.1|  BnaC04g51340D                                        64.3    4e-10   Brassica napus [oilseed rape]
ref|XP_010652243.1|  PREDICTED: cytochrome c oxidase subunit 5C       61.6    1e-09   Vitis vinifera
ref|XP_001764108.1|  predicted protein                                60.8    2e-09   
ref|XP_001778406.1|  predicted protein                                60.8    2e-09   
gb|AFW62795.1|  hypothetical protein ZEAMMB73_426319                  58.9    1e-08   
gb|KHN49019.1|  Cytochrome c oxidase subunit 5C-2                     58.5    1e-08   Glycine soja [wild soybean]
gb|KHN35910.1|  Cytochrome c oxidase subunit 5C-2                     57.4    3e-08   Glycine soja [wild soybean]
ref|XP_007513118.1|  predicted protein                                50.4    1e-05   Bathycoccus prasinos
ref|XP_002960593.1|  hypothetical protein SELMODRAFT_437650           48.1    2e-04   
ref|XP_006362442.1|  PREDICTED: uncharacterized protein LOC102602011  48.9    8e-04   



>sp|P19173.3|COX5C_IPOBA RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome 
c oxidase polypeptide Vc [Ipomoea batatas]
 emb|CAA37470.1| unnamed protein product [Ipomoea batatas]
 gb|AAB31231.1| cytochrome c oxidase subunit Vc [Ipomoea batatas]
Length=64

 Score =   130 bits (327),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/64 (95%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGGHVAH+VYKGPSVVKELVIGFSLGL+AGGFWKMHHWNSQRR KEFYDMLEKGQISVV
Sbjct  1    MAGGHVAHLVYKGPSVVKELVIGFSLGLVAGGFWKMHHWNSQRRTKEFYDMLEKGQISVV  60

Query  275  ADEE  286
            ADEE
Sbjct  61   ADEE  64



>ref|XP_009631036.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana tomentosiformis]
 ref|XP_009631037.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana tomentosiformis]
Length=64

 Score =   117 bits (294),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG HVAH VYKGPSVVKE++IG +LG++AGGFWKMHHWN+QRR KEFYDMLEKG+ISVV
Sbjct  1    MAGSHVAHAVYKGPSVVKEILIGITLGMVAGGFWKMHHWNNQRRTKEFYDMLEKGEISVV  60

Query  275  ADEE  286
             DEE
Sbjct  61   VDEE  64



>ref|XP_009797280.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana sylvestris]
 ref|XP_009797281.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana sylvestris]
 ref|XP_009797282.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana sylvestris]
Length=64

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG HVAH VYKGPSVVKE++IG +LG++AGGFWK+HHWN+QRR KEFYDMLEKG+ISVV
Sbjct  1    MAGSHVAHAVYKGPSVVKEILIGITLGMVAGGFWKIHHWNNQRRTKEFYDMLEKGEISVV  60

Query  275  ADEE  286
             +EE
Sbjct  61   VNEE  64



>ref|XP_009596474.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X1 [Nicotiana 
tomentosiformis]
Length=92

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  92   RMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISV  271
            +MA  H+AH  YKGPSVVKE++IG +LG+ AGG WKMHHWN+QRR KEFYDMLEKG+ISV
Sbjct  28   KMASSHIAHAAYKGPSVVKEILIGIALGIAAGGLWKMHHWNNQRRTKEFYDMLEKGEISV  87

Query  272  VADEE  286
            V DEE
Sbjct  88   VVDEE  92



>ref|XP_009596475.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Nicotiana 
tomentosiformis]
Length=64

 Score =   110 bits (274),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA  H+AH  YKGPSVVKE++IG +LG+ AGG WKMHHWN+QRR KEFYDMLEKG+ISVV
Sbjct  1    MASSHIAHAAYKGPSVVKEILIGIALGIAAGGLWKMHHWNNQRRTKEFYDMLEKGEISVV  60

Query  275  ADEE  286
             DEE
Sbjct  61   VDEE  64



>ref|XP_006338585.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006338586.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Solanum 
tuberosum]
Length=64

 Score =   107 bits (267),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG H+AH  YKGPSVVKE+VIG +LG++AGG WKMHHWN+QRR KEFYD+L+K +ISVV
Sbjct  1    MAGSHIAHAAYKGPSVVKEIVIGIALGIVAGGLWKMHHWNNQRRTKEFYDLLDKNEISVV  60

Query  275  ADEE  286
             ++E
Sbjct  61   VNDE  64



>gb|KCW50112.1| hypothetical protein EUGRSUZ_K03546, partial [Eucalyptus grandis]
Length=93

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  11   RSQRRNRLYLLKRISFSLVSAFWCFCSRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGG  190
            RS+   R+ L +++  S+VS+    C RMAG  +AH   KGPSVVKE++IG +LGL AGG
Sbjct  5    RSRSLTRIQLQEKVD-SVVSSR-DRCGRMAGHKIAHATLKGPSVVKEILIGITLGLAAGG  62

Query  191  FWKMHHWNSQRRMKEFYDMLEKGQISVVADE  283
             WKMHHWN QR+++ FYD+LEKG+ISVVA+E
Sbjct  63   VWKMHHWNEQRKVRAFYDLLEKGEISVVAEE  93



>ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group]
 sp|Q9SXX7.3|COX5C_ORYSJ RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome 
c oxidase polypeptide Vc [Oryza sativa Japonica Group]
 dbj|BAA77682.1| cytochrome c oxidase subunit 5c [Oryza sativa Japonica Group]
 dbj|BAF30040.1| Os12g0561000 [Oryza sativa Japonica Group]
 gb|EAZ20870.1| hypothetical protein OsJ_36508 [Oryza sativa Japonica Group]
Length=63

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG +AH   KGPSVVKE+ IG +LGL+AGG WKMHHWN QR+ + FYDMLEKGQISVV
Sbjct  1    MAGGRIAHATLKGPSVVKEICIGLTLGLVAGGLWKMHHWNEQRKTRSFYDMLEKGQISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|XP_003579253.1| PREDICTED: cytochrome c oxidase subunit 5C [Brachypodium distachyon]
 sp|Q42841.3|COX5C_HORVU RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome 
c oxidase polypeptide Vc [Hordeum vulgare]
 emb|CAA92107.1| cytochrome c oxidase, Vc subunit [Hordeum vulgare subsp. vulgare]
 gb|EMS48910.1| Cytochrome c oxidase subunit 5C [Triticum urartu]
 gb|EMT13154.1| Cytochrome c oxidase subunit 5C [Aegilops tauschii]
Length=63

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG VAH   KGPSVVKE+ IG +LGL+AGG WKMHHWN QR+ + FYDMLEKGQISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLVAGGMWKMHHWNEQRKTRSFYDMLEKGQISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|XP_008660415.1| PREDICTED: cytochrome c oxidase subunit 5C [Zea mays]
Length=100

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  92   RMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISV  271
            +MAGG VAH   KGPSVVKE+ IG +LGLIAGG WKMHHWN QR+ + FYDML+KGQISV
Sbjct  37   QMAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISV  96

Query  272  VADE  283
            V +E
Sbjct  97   VVEE  100



>ref|XP_004232316.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Solanum lycopersicum]
 ref|XP_010316294.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Solanum lycopersicum]
Length=64

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG H+AH  YKGPSVVKE++IG +LG++AGG WK HHWN+QRR KEFYD+LEK +ISVV
Sbjct  1    MAGSHIAHAAYKGPSVVKEIMIGIALGMVAGGLWKKHHWNNQRRTKEFYDLLEKNEISVV  60

Query  275  ADEE  286
             +++
Sbjct  61   VNDQ  64



>sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome 
c oxidase polypeptide Vc-2 [Helianthus annuus]
 gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus]
Length=64

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            M GG VAH V KGPSVVKELVIG  LGL AGG WKMHHWN QR+ + FYD+LEKG+ISVV
Sbjct  1    MGGGRVAHPVLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVV  60

Query  275  ADEE  286
             DEE
Sbjct  61   VDEE  64



>gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays]
Length=77

 Score =   103 bits (257),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG VAH   KGPSVVKE+ IG +LGLIAGG WKMHHWN QR+ + FYDML+KGQISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVV  60

Query  275  ADEE  286
             +++
Sbjct  61   VEDQ  64



>ref|XP_004962769.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Setaria italica]
 gb|ACF80884.1| unknown [Zea mays]
 gb|ACF86858.1| unknown [Zea mays]
 gb|ACG24439.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG26171.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG26852.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG30837.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG47360.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 tpg|DAA46995.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays]
 tpg|DAA55250.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays]
Length=63

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG VAH   KGPSVVKE+ IG +LGLIAGG WKMHHWN QR+ + FYDML+KGQISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|XP_003570359.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium 
distachyon]
 ref|XP_010235932.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium 
distachyon]
Length=63

 Score =   102 bits (255),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG VAH   KGPSVVKE+ IG +LGL+AGG WKMHHWN QR+ + FYDMLEKGQISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLVAGGMWKMHHWNEQRKTRSFYDMLEKGQISVV  60

Query  275  ADE  283
              E
Sbjct  61   VKE  63



>ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor]
 gb|EES17196.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor]
Length=63

 Score =   102 bits (255),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG VAH   KGPSVVKE+ IG +LGLIAGG WKMHHWN QR+ + FYDML+KGQISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGMTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|XP_002320297.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 ref|XP_006375433.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 ref|XP_006375434.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 gb|ABK92994.1| unknown [Populus trichocarpa]
 gb|ABK94001.1| unknown [Populus trichocarpa]
 gb|ABK94684.1| unknown [Populus trichocarpa]
 gb|ABK95683.1| unknown [Populus trichocarpa]
 gb|ABK96646.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE98612.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 gb|ERP53230.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 gb|ERP53231.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
Length=63

 Score =   102 bits (254),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG VAHV  KGPSVV+EL IGF+LGL+AG  WKMHHWN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAGGRVAHVTLKGPSVVRELCIGFALGLVAGSLWKMHHWNEQRKVRSFYDLLEKGEISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>gb|KHG00470.1| Cytochrome c oxidase subunit 5C [Gossypium arboreum]
 gb|KJB24413.1| hypothetical protein B456_004G144400 [Gossypium raimondii]
Length=63

 Score =   102 bits (254),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKE+VIG +LGL AGG WKMHHWN QR+++ FYDMLEKG+ISV+
Sbjct  1    MAGSRVAHATLKGPSVVKEIVIGITLGLCAGGLWKMHHWNEQRKVRAFYDMLEKGEISVI  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago truncatula]
 gb|AES61651.1| cytochrome C oxidase subunit 5C [Medicago truncatula]
Length=64

 Score =   102 bits (254),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            M+G  +AH   KGPSVVKE++IG +LGL+AGG WKMHHWN QR+ + FYD+LEKG+ISVV
Sbjct  1    MSGPRIAHATLKGPSVVKEIIIGITLGLVAGGVWKMHHWNEQRKTRTFYDLLEKGEISVV  60

Query  275  ADEE  286
             DEE
Sbjct  61   VDEE  64



>ref|XP_011098443.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X1 [Sesamum 
indicum]
Length=67

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 57/69 (83%), Gaps = 3/69 (4%)
 Frame = +2

Query  80   CFCSRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKG  259
                RMA    AHVVYKGPSV+KE++IG  LGL+AGGFWKMHHWN+Q+R KEFYD+L+KG
Sbjct  2    SLGERMA---AAHVVYKGPSVLKEILIGIGLGLVAGGFWKMHHWNNQKRTKEFYDLLDKG  58

Query  260  QISVVADEE  286
            +ISVV ++E
Sbjct  59   EISVVREDE  67



>ref|XP_002862722.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
 ref|XP_002876673.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH38980.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52932.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=64

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKEL+IG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISVV
Sbjct  1    MAGHKVAHATLKGPSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRTFYDLLERGEISVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis]
 ref|XP_002520707.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis]
 gb|EEF41669.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis]
 gb|EEF47266.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis]
Length=63

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG +AH   KGPSVVKE+ IG +LGL AGG WKMHHWN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAGGRIAHATLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>ref|XP_006402379.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum]
 gb|ESQ43832.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum]
Length=64

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKEL+IG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISVV
Sbjct  1    MAGHKVAHATLKGPSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>gb|ADB85086.1| cytochrome c oxidase polypeptide Vc [Jatropha curcas]
 gb|KDP21540.1| hypothetical protein JCGZ_22011 [Jatropha curcas]
Length=63

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG +AH   KGPSVVKE+ IG +LGL AGG WKMHHWN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAGGKIAHATLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVV  60

Query  275  ADE  283
             DE
Sbjct  61   VDE  63



>ref|XP_009383933.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383934.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Musa acuminata 
subsp. malaccensis]
Length=64

 Score =   100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGPSV+KE+VIG +LGL AGG WKMHHWN QRR + FYDMLEKG+ISVV
Sbjct  1    MASPKIAHTTLKGPSVIKEIVIGLALGLFAGGLWKMHHWNEQRRTRAFYDMLEKGEISVV  60

Query  275  ADEE  286
             +EE
Sbjct  61   VEEE  64



>ref|XP_011098444.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X2 [Sesamum 
indicum]
Length=61

 Score =   100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  113  AHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            AHVVYKGPSV+KE++IG  LGL+AGGFWKMHHWN+Q+R KEFYD+L+KG+ISVV ++E
Sbjct  4    AHVVYKGPSVLKEILIGIGLGLVAGGFWKMHHWNNQKRTKEFYDLLDKGEISVVREDE  61



>ref|XP_006397931.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 ref|XP_006397932.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 ref|XP_006397933.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 gb|ESQ39384.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 gb|ESQ39385.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 gb|ESQ39386.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
Length=64

 Score =   100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKEL+IG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISVV
Sbjct  1    MAGHKVAHATLKGPSVVKELIIGMALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max]
Length=64

 Score =   100 bits (249),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE++IG +LGL AGG WKMHHWN QR+ + FYD+LEKG+I+VV
Sbjct  1    MAGPRIAHATLKGPSVVKEIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVV  60

Query  275  ADEE  286
            A+E+
Sbjct  61   AEEQ  64



>gb|ACG31149.1| cytochrome c oxidase polypeptide Vc [Zea mays]
Length=63

 Score =   100 bits (248),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG VAH   KGPSVVKE+ IG +LGLIAGG WKMH WN QR+ + FYDML+KGQISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHXWNEQRKTRSFYDMLDKGQISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|XP_009133811.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica 
rapa]
 emb|CDY37800.1| BnaC04g00250D [Brassica napus]
 emb|CDX95722.1| BnaC03g26030D [Brassica napus]
 emb|CDX83330.1| BnaA03g21760D [Brassica napus]
Length=64

 Score =   100 bits (248),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKEL+IG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISV+
Sbjct  1    MAGHRVAHATLKGPSVVKELIIGMALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVI  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>gb|KJB06278.1| hypothetical protein B456_001G144400 [Gossypium raimondii]
Length=63

 Score =   100 bits (248),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+VIG +LGL AGG WKMHHWN QR+++ FYDMLEK +ISVV
Sbjct  1    MAGSRIAHATLKGPSVVKEIVIGITLGLCAGGLWKMHHWNEQRKVRAFYDMLEKDEISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>sp|Q9LZQ0.1|CX5C2_ARATH RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome 
c oxidase polypeptide Vc-2 [Arabidopsis thaliana]
 emb|CAB82954.1| cytochrome c oxidase subunit 5c-like protein [Arabidopsis thaliana]
Length=64

 Score =   100 bits (248),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKEL+IG +LGL AGG WKMHHWN QR+ + FYD+LE+G+I VV
Sbjct  1    MAGHKVAHATLKGPSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRTFYDLLERGEIGVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   ASEE  64



>ref|XP_006446555.1| hypothetical protein CICLE_v10017383mg [Citrus clementina]
 gb|ESR59795.1| hypothetical protein CICLE_v10017383mg [Citrus clementina]
Length=72

 Score =   100 bits (248),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +2

Query  77   WCFCSRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEK  256
            W     MA   +AH  Y+GPSVVKE+V G S+GL AGG WKMH WN+QRR +EFYD+LEK
Sbjct  3    WKLQKEMAAHKIAHATYQGPSVVKEIVYGISIGLFAGGLWKMHQWNNQRRTREFYDLLEK  62

Query  257  GQISVVADEE  286
            G+ISVV ++E
Sbjct  63   GEISVVVEDE  72



>ref|XP_011042251.1| PREDICTED: cytochrome c oxidase subunit 5C [Populus euphratica]
 ref|XP_011042252.1| PREDICTED: cytochrome c oxidase subunit 5C [Populus euphratica]
 ref|XP_011042253.1| PREDICTED: cytochrome c oxidase subunit 5C [Populus euphratica]
Length=63

 Score = 99.8 bits (247),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG VAHV  KGPSVVKE+ IG +LGL AGG WKMHHWN QR+++ FYD+LEKG+I VV
Sbjct  1    MAGGRVAHVTLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRSFYDLLEKGEIGVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>gb|KDP28259.1| hypothetical protein JCGZ_14030 [Jatropha curcas]
Length=63

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG +AH   KGPSVVKE+ IG +LGL AGG WKMHHWN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAGGRIAHATLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>gb|EYU44775.1| hypothetical protein MIMGU_mgv11b013929mg [Erythranthe guttata]
Length=113

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  83   FCSRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQ  262
             C R       HVVYKGPSVVKE++IG  LGL+AGGFWK HHWN+QRR KEFYD+L+KG+
Sbjct  46   LCDRKDKMGGVHVVYKGPSVVKEILIGIGLGLVAGGFWKRHHWNNQRRTKEFYDLLDKGE  105

Query  263  ISVVADEE  286
            I+VV ++E
Sbjct  106  ITVVREDE  113



>ref|XP_002302765.2| hypothetical protein POPTR_0002s19690g [Populus trichocarpa]
 gb|EEE82038.2| hypothetical protein POPTR_0002s19690g [Populus trichocarpa]
Length=73

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  89   SRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQIS  268
            S MAGG VAHV  KGPSVVKE+ IG +LGL AG  WKMHHWN QR+++ FYD+LEKG+I 
Sbjct  9    SEMAGGRVAHVTLKGPSVVKEICIGIALGLAAGSLWKMHHWNEQRKVRSFYDLLEKGEIG  68

Query  269  VVADE  283
            VV +E
Sbjct  69   VVVEE  73



>ref|XP_010521442.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Tarenaya hassleriana]
Length=66

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+VIG +LGL AGG WKMHHWN QR+ K FYD+LEKG+ISVV
Sbjct  1    MAGHKIAHATLKGPSVVKEIVIGITLGLAAGGLWKMHHWNEQRKTKAFYDLLEKGEISVV  60

Query  275  AD  280
            A 
Sbjct  61   AS  62



>ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max]
 gb|KHN08636.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja]
Length=64

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE++IG +LGL AG  WKMHHWN QR+ + FYD+LEKG+ISVV
Sbjct  1    MAGPRIAHATLKGPSVVKEIIIGITLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVV  60

Query  275  ADEE  286
            A+E+
Sbjct  61   AEEQ  64



>ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Cicer arietinum]
Length=64

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE++IG +LG+ AG  WKMHHWN QR+ + FYD+LEKG+ISV+
Sbjct  1    MAGPRIAHATLKGPSVVKEIIIGITLGIAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVI  60

Query  275  ADEE  286
            A+EE
Sbjct  61   AEEE  64



>ref|XP_010674655.1| PREDICTED: cytochrome c oxidase subunit 5C [Beta vulgaris subsp. 
vulgaris]
Length=63

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKE+ IGF LGL AG  WKMHHWN QR+++ FYDMLEKGQISVV
Sbjct  1    MAGSKVAHAALKGPSVVKEIFIGFGLGLAAGTLWKMHHWNEQRKVRSFYDMLEKGQISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|XP_007051107.1| Cytochrome c oxidase subunit 5C [Theobroma cacao]
 gb|EOX95264.1| Cytochrome c oxidase subunit 5C [Theobroma cacao]
Length=63

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE++IG +LG  AGG WKMHHWN QR+++ FYDMLEKG ISVV
Sbjct  1    MAGPRIAHATLKGPSVVKEIIIGITLGFCAGGLWKMHHWNEQRKVRAFYDMLEKGDISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>ref|XP_010038288.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Eucalyptus grandis]
Length=63

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE++IG +LGL AGG WKMHHWN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAGHKIAHATLKGPSVVKEILIGITLGLAAGGVWKMHHWNEQRKVRAFYDLLEKGEISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>gb|ACG33529.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG34917.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG35185.1| cytochrome c oxidase polypeptide Vc [Zea mays]
Length=62

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG VAH   KGPSVVKE+ IG +LGLIAGG WKMHHWN QR+ + FYDML+KGQI VV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQIVVV  60

Query  275  AD  280
             +
Sbjct  61   EE  62



>ref|XP_010273899.1| PREDICTED: cytochrome c oxidase subunit 5C [Nelumbo nucifera]
 ref|XP_010273900.1| PREDICTED: cytochrome c oxidase subunit 5C [Nelumbo nucifera]
Length=63

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGPSVVKE+ IG +LGL+AGG WKMHHWN QR+++ FYDMLEKG+ISVV
Sbjct  1    MAAHKIAHATLKGPSVVKEICIGITLGLLAGGMWKMHHWNEQRKVRAFYDMLEKGEISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>ref|XP_003521595.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X1 [Glycine 
max]
 gb|KHN19213.1| Cytochrome c oxidase subunit 5C [Glycine soja]
Length=103

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  53   SFSLVSAFWCFCSRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMK  232
            S S +        +MAG  +AH   KGPSVVKE+ IG  LGL AG  WKMHHWN QR+ +
Sbjct  26   STSEIDKLLKTVKQMAGPRIAHATLKGPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTR  85

Query  233  EFYDMLEKGQISVVADEE  286
             FYD+LEK +ISVVADEE
Sbjct  86   AFYDLLEKDEISVVADEE  103



>ref|XP_004300448.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Fragaria vesca 
subsp. vesca]
Length=63

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKE++IG  LGL AGG WKMHHWN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAGHKVAHATLKGPSVVKEIIIGAVLGLAAGGLWKMHHWNEQRKVRTFYDLLEKGEISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>ref|XP_006577163.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Glycine 
max]
Length=95

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  92   RMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISV  271
            +MAG  +AH   KGPSVVKE+ IG  LGL AG  WKMHHWN QR+ + FYD+LEK +ISV
Sbjct  31   QMAGPRIAHATLKGPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISV  90

Query  272  VADEE  286
            VADEE
Sbjct  91   VADEE  95



>gb|EYU35673.1| hypothetical protein MIMGU_mgv1a017603mg [Erythranthe guttata]
Length=64

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            M G  VAHV  KGPSVVKEL+IG +LG+ AG  WKMHHWN QR+++ FYDML+KG+I+VV
Sbjct  1    MTGARVAHVTLKGPSVVKELLIGIALGVAAGSVWKMHHWNEQRKVRSFYDMLDKGEITVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>ref|XP_009382494.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Musa acuminata 
subsp. malaccensis]
Length=64

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGPSV+KE+ IG +LGL AGG WKMHHWN QR+ + FYDMLEKG+ISVV
Sbjct  1    MAAHKIAHATLKGPSVIKEICIGLTLGLFAGGLWKMHHWNEQRKTRAFYDMLEKGEISVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>gb|ACU15919.1| unknown [Glycine max]
Length=64

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   +GPSVVKE++IG +LGL AG  WKMHHWN QR+ + FYD+LEKG+ISVV
Sbjct  1    MAGPRIAHATLRGPSVVKEIIIGITLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVV  60

Query  275  ADEE  286
            A+E+
Sbjct  61   AEEQ  64



>ref|XP_006387973.1| hypothetical protein POPTR_0440s00200g, partial [Populus trichocarpa]
 gb|ERP46887.1| hypothetical protein POPTR_0440s00200g, partial [Populus trichocarpa]
Length=111

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  89   SRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQIS  268
            S MAGG VAHV  KGPSVVKE+ IG +LGL AG  WKMHHWN QR+++ FYD+LEKG+I 
Sbjct  47   SEMAGGRVAHVTLKGPSVVKEICIGIALGLAAGSLWKMHHWNEQRKVRSFYDLLEKGEIG  106

Query  269  VVADE  283
            VV  E
Sbjct  107  VVVKE  111



>ref|XP_006470279.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4-like [Citrus 
sinensis]
Length=64

 Score = 97.4 bits (241),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH  Y+GPSVVKE+V G S+GL AGG WKMH WN+QRR +EFYD+LEKG+ISVV
Sbjct  1    MAAHKIAHATYQGPSVVKEIVYGISIGLFAGGLWKMHQWNNQRRTREFYDLLEKGEISVV  60

Query  275  ADEE  286
             ++E
Sbjct  61   VEDE  64



>ref|XP_010261730.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Nelumbo nucifera]
Length=63

 Score = 97.1 bits (240),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGPSVVKE+ IG +LGL+AGG WKMHHWN QR+++ FYDML+KG+ISVV
Sbjct  1    MAAHKIAHATLKGPSVVKEICIGITLGLLAGGMWKMHHWNEQRKVRAFYDMLDKGEISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>gb|KHN30639.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja]
Length=64

 Score = 97.1 bits (240),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  + H   KGPSVVK+++IG +LGL AGG WKMHHWN QR+ + FYD+LEKG+I+VV
Sbjct  1    MAGPRIVHATLKGPSVVKDIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVV  60

Query  275  ADEE  286
            A+E+
Sbjct  61   AEEQ  64



>ref|NP_200939.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 ref|NP_851239.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 ref|NP_001032118.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 ref|NP_001119471.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 sp|Q9FLK2.1|CX5C3_ARATH RecName: Full=Probable cytochrome c oxidase subunit 5C-3; AltName: 
Full=Cytochrome c oxidase polypeptide Vc-3 [Arabidopsis 
thaliana]
 dbj|BAB08486.1| cytochrome c oxidase Vc subunit-like protein [Arabidopsis thaliana]
 gb|AAM65881.1| cytochrome c oxidase subunit-like [Arabidopsis thaliana]
 gb|ABD38860.1| At5g61310 [Arabidopsis thaliana]
 gb|AED97450.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 gb|AED97451.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 gb|AED97452.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 gb|AED97453.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
Length=64

 Score = 97.1 bits (240),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKELVIG +LGL AGG WKMHHWN QR+ + FYD+LE+G+I VV
Sbjct  1    MAGHKIAHATLKGPSVVKELVIGLTLGLAAGGLWKMHHWNEQRKTRVFYDLLERGEIGVV  60

Query  275  ADEE  286
              EE
Sbjct  61   VTEE  64



>ref|XP_002282099.1| PREDICTED: cytochrome c oxidase subunit 5C [Vitis vinifera]
 emb|CBI39596.3| unnamed protein product [Vitis vinifera]
Length=63

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGPSVVKE+ IG +LGL+AGG WKMHHWN Q++++ FYDMLEK QISVV
Sbjct  1    MAAHKIAHATLKGPSVVKEICIGATLGLLAGGLWKMHHWNEQKKLRTFYDMLEKDQISVV  60

Query  275  ADE  283
             DE
Sbjct  61   VDE  63



>gb|AFK48388.1| unknown [Lotus japonicus]
Length=64

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+VIG  LGL AG  WKMHHWN QR+ + FYD+LEKG+I VV
Sbjct  1    MAGPRIAHATLKGPSVVKEIVIGMVLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEIGVV  60

Query  275  ADEE  286
            A+EE
Sbjct  61   AEEE  64



>ref|XP_006577164.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X3 [Glycine 
max]
Length=68

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  92   RMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISV  271
            +MAG  +AH   KGPSVVKE+ IG  LGL AG  WKMHHWN QR+ + FYD+LEK +ISV
Sbjct  4    QMAGPRIAHATLKGPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISV  63

Query  272  VADEE  286
            VADEE
Sbjct  64   VADEE  68



>ref|XP_009384427.1| PREDICTED: cytochrome c oxidase subunit 5C [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384428.1| PREDICTED: cytochrome c oxidase subunit 5C [Musa acuminata subsp. 
malaccensis]
Length=64

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGPSVVKE+ IG +LGL AGG WKMHHWN QR+ + FYDMLEKG+ISVV
Sbjct  1    MAAHKIAHATLKGPSVVKEICIGLTLGLFAGGLWKMHHWNEQRKTRAFYDMLEKGEISVV  60

Query  275  ADEE  286
              EE
Sbjct  61   VAEE  64



>ref|XP_008797451.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Phoenix dactylifera]
Length=64

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGP+VVKE+ IG +LG++AG  WKMHHWN QR+ + FYDMLEKGQISVV
Sbjct  1    MAAHKIAHATLKGPNVVKEICIGITLGILAGSMWKMHHWNEQRKTRAFYDMLEKGQISVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>gb|KFK33110.1| hypothetical protein AALP_AA6G332300 [Arabis alpina]
Length=65

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +   VYKGPS+VKE++ G +LGL AGG WKMHHWN+QRR +EFYD+LEKG+ISVVA++E
Sbjct  7    IGKAVYKGPSIVKEIIYGIALGLAAGGLWKMHHWNNQRRTREFYDLLEKGEISVVAEDE  65



>gb|EYU20843.1| hypothetical protein MIMGU_mgv1a017612mg [Erythranthe guttata]
Length=64

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKE++IG +LG  AG  WKMHHWN QR+++ FYDML+KG+I+VV
Sbjct  1    MAGSRVAHATLKGPSVVKEILIGIALGFAAGSVWKMHHWNEQRKVRSFYDMLDKGEITVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>ref|XP_006577165.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X4 [Glycine 
max]
 ref|XP_006577166.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X5 [Glycine 
max]
Length=64

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+ IG  LGL AG  WKMHHWN QR+ + FYD+LEK +ISVV
Sbjct  1    MAGPRIAHATLKGPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVV  60

Query  275  ADEE  286
            ADEE
Sbjct  61   ADEE  64



>gb|AES82189.2| cytochrome C oxidase subunit 5C [Medicago truncatula]
Length=117

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  89   SRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQIS  268
            + MAG  +AH   KGPSVVKE+ IG  LGL AG  WKMHHWN QR+ + F+D+LEKG+IS
Sbjct  52   NEMAGPRIAHATLKGPSVVKEICIGIVLGLAAGSVWKMHHWNEQRKTRTFHDLLEKGEIS  111

Query  269  VVADEE  286
            V+A+EE
Sbjct  112  VIAEEE  117



>ref|XP_004135996.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform 1 [Cucumis 
sativus]
 ref|XP_004135997.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform 2 [Cucumis 
sativus]
 ref|XP_008451480.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Cucumis melo]
 gb|KGN45016.1| hypothetical protein Csa_7G407690 [Cucumis sativus]
Length=64

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA G VAHV  +GPSVVKE++ G  L L AG FWKMH WN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAAGRVAHVTLQGPSVVKEILTGMGLALFAGSFWKMHQWNEQRKVRAFYDLLEKGEISVV  60

Query  275  ADEE  286
             DEE
Sbjct  61   VDEE  64



>sp|Q8VY40.1|CX5C1_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-1; AltName: Full=Cytochrome 
c oxidase polypeptide Vc-1 [Helianthus annuus]
 gb|AAL67938.1| cytochrome c oxidase subunit 5c [Helianthus annuus]
Length=63

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            M GG VAH V KGPS VKEL+IG  LGL AGG WKMHHWN QR+ + FYD+LEKG+ISVV
Sbjct  1    MVGGRVAHPVLKGPSEVKELIIGSVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVV  60

Query  275  ADE  283
              E
Sbjct  61   VQE  63



>ref|XP_009411629.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Musa acuminata 
subsp. malaccensis]
Length=64

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGPSVVKE+ IG +LGL AGG WKM+HWN QRR + FYDMLEKG+ISVV
Sbjct  1    MAAHKIAHATLKGPSVVKEICIGLTLGLFAGGLWKMYHWNEQRRTRAFYDMLEKGEISVV  60

Query  275  ADEE  286
              EE
Sbjct  61   VAEE  64



>ref|XP_007145147.1| hypothetical protein PHAVU_007G214100g [Phaseolus vulgaris]
 gb|ESW17141.1| hypothetical protein PHAVU_007G214100g [Phaseolus vulgaris]
Length=64

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAGG +AH   KGPSVVKE++IG  LGL AG  WKMHHWN QR+++ FYD+LEKG+I VV
Sbjct  1    MAGGRIAHATLKGPSVVKEIIIGTVLGLAAGSVWKMHHWNEQRKVRTFYDLLEKGEIGVV  60

Query  275  ADEE  286
             +E+
Sbjct  61   LEEQ  64



>ref|XP_003625971.1| Cytochrome c oxidase subunit 5C [Medicago truncatula]
 gb|AFK47757.1| unknown [Medicago truncatula]
Length=64

 Score = 94.4 bits (233),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+ IG  LGL AG  WKMHHWN QR+ + F+D+LEKG+ISV+
Sbjct  1    MAGPRIAHATLKGPSVVKEICIGIVLGLAAGSVWKMHHWNEQRKTRTFHDLLEKGEISVI  60

Query  275  ADEE  286
            A+EE
Sbjct  61   AEEE  64



>ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44916.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. 
lyrata]
Length=65

 Score = 94.4 bits (233),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +   VYKGPSVVKE++ G +LGL  GG WKMHHWN+QRR KEFYD+LEKG+ISVV ++E
Sbjct  7    IGKAVYKGPSVVKEIIYGITLGLAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVVEDE  65



>ref|XP_010931748.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Elaeis guineensis]
Length=106

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  92   RMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISV  271
            +MA   +AH   KGP+VVKE+ IG +LG+ AG  WKMHHWN QR+ + FYDMLEKG ISV
Sbjct  42   QMAAHKIAHATLKGPNVVKEICIGITLGIFAGSMWKMHHWNEQRKTRAFYDMLEKGHISV  101

Query  272  VADEE  286
            VA EE
Sbjct  102  VAAEE  106



>ref|XP_010528240.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Tarenaya 
hassleriana]
 ref|XP_010528241.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Tarenaya 
hassleriana]
Length=66

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +A    KGPSVVKE++ G SLGLIAGG WKM+HWNSQR+ KEFY++LEKG+ISVV DE+
Sbjct  7    IAKAANKGPSVVKEIIYGISLGLIAGGLWKMYHWNSQRQTKEFYELLEKGEISVVVDED  65



>ref|XP_004229388.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Solanum lycopersicum]
 ref|XP_006349185.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Solanum tuberosum]
Length=63

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+VI   LGL AG  WKMHHWN QR+++ FYD+LEKG+IS+V
Sbjct  1    MAGHRIAHATLKGPSVVKEIVIASVLGLAAGSLWKMHHWNEQRKVRSFYDLLEKGEISIV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>ref|XP_009136460.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica 
rapa]
Length=63

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKEL+IG +LG+ AGG WKMHHWN QR+ + FYD+LEK +ISVV
Sbjct  1    MAGHKIAHATLKGPSVVKELIIGLALGIAAGGMWKMHHWNEQRKTRAFYDLLEKDEISVV  60

Query  275  ADE  283
              E
Sbjct  61   VAE  63



>ref|XP_009604952.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Nicotiana tomentosiformis]
 ref|XP_009774668.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Nicotiana sylvestris]
Length=63

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+VI   LGL AG  WKMHHWN QR+++ FYD+LEKG+IS+V
Sbjct  1    MAGHRIAHATLKGPSVVKEIVIATVLGLAAGSLWKMHHWNEQRKVRSFYDLLEKGEISLV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>ref|XP_010441174.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
 ref|XP_010441175.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
 ref|XP_010441176.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
 ref|XP_010450674.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
Length=65

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +   +YKGPS+VKE++ G +LG+  GG WKMHHWN+QRR KEFYD+LEKG+ISVVA++E
Sbjct  7    IGKAIYKGPSIVKEILYGIALGIAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVAEDE  65



>ref|XP_006840451.1| hypothetical protein AMTR_s00045p00172340 [Amborella trichopoda]
 gb|ERN02126.1| hypothetical protein AMTR_s00045p00172340 [Amborella trichopoda]
Length=99

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AHV Y GPS++KE+  G +LGL+AGG WK HHWN QR+ K FYD+LEKG+ISVV
Sbjct  36   MAAHRIAHVAYTGPSIIKEIFYGMTLGLLAGGVWKTHHWNEQRKTKAFYDLLEKGEISVV  95

Query  275  ADEE  286
              EE
Sbjct  96   VAEE  99



>ref|XP_008812525.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Phoenix 
dactylifera]
Length=64

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGP+VVKE+ IG +LG++AG  WKMHHWN Q++ + FYDMLEKG+ISV+
Sbjct  1    MAAHKIAHATLKGPNVVKEICIGITLGILAGSVWKMHHWNEQKKTRAFYDMLEKGEISVI  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>ref|XP_010435906.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
 ref|XP_010435907.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
Length=65

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +   +YKGPS+VKE+V G +LG+  GG WKMHHWN+QR+ KEFYD+LEKG+ISVVA++E
Sbjct  7    IGKAIYKGPSIVKEIVYGIALGIAVGGLWKMHHWNNQRQTKEFYDLLEKGEISVVAEDE  65



>ref|XP_010921491.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X1 [Elaeis 
guineensis]
Length=106

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  89   SRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQIS  268
            + MA   +AH   +GPSVVKE+ IG +LGL AG  WKMHHWN QR+ + FYDMLEKG+IS
Sbjct  42   AEMAAHKIAHATLRGPSVVKEICIGITLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEIS  101

Query  269  VVADE  283
            VV +E
Sbjct  102  VVVEE  106



>ref|XP_011079230.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Sesamum 
indicum]
Length=64

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+ IG  LG+ AG  WKMHHWN QR+++ FYD+L+KG+ISVV
Sbjct  1    MAGPRIAHATLKGPSVVKEIAIGIVLGIAAGSVWKMHHWNEQRKVRAFYDLLDKGEISVV  60

Query  275  ADEE  286
            A E+
Sbjct  61   AAEQ  64



>ref|XP_008781111.1| PREDICTED: cytochrome c oxidase subunit 5C [Phoenix dactylifera]
Length=63

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   KGP+VVKE+ IG +LGL AG  WKMHHWN QR+ + FYDMLEKG+ISVV
Sbjct  1    MAAHKIAHATLKGPNVVKEICIGLALGLFAGSLWKMHHWNEQRKTRTFYDMLEKGEISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|XP_010921492.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X2 [Elaeis 
guineensis]
Length=63

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   +GPSVVKE+ IG +LGL AG  WKMHHWN QR+ + FYDMLEKG+ISVV
Sbjct  1    MAAHKIAHATLRGPSVVKEICIGITLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana]
 sp|Q9FNE0.1|CX5C4_ARATH RecName: Full=Putative cytochrome c oxidase subunit 5C-4; AltName: 
Full=Cytochrome c oxidase polypeptide Vc-4 [Arabidopsis 
thaliana]
 dbj|BAB11594.1| cytochrome c oxidase Vc subunit [Arabidopsis thaliana]
 gb|AED94541.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana]
Length=65

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +   VYKGPSVVKE++ G +LG   GG WKMHHWN+QRR KEFYD+LEKG+ISVV ++E
Sbjct  7    IGKAVYKGPSVVKEIIYGITLGFAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVVEDE  65



>gb|AGE46018.1| cytochrome c oxidase subunit 5C [Elaeis guineensis]
Length=63

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   +AH   +GPSVVKE+ IG +LGL AG  WKMHHWN QR+ + FYDMLEKG+ISVV
Sbjct  1    MAAHKIAHATLRGPSVVKEIFIGITLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|XP_009139998.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Brassica 
rapa]
 ref|XP_009139999.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Brassica 
rapa]
 emb|CDY42588.1| BnaA04g10250D [Brassica napus]
 emb|CDY36854.1| BnaC04g32470D [Brassica napus]
Length=65

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +   VY+GPS+VKE++ G +LGL AGG WKMHHWN+QRR +EFYD+LEKG+ISVV  +E
Sbjct  7    IGKAVYQGPSIVKEIIYGIALGLAAGGLWKMHHWNNQRRTREFYDLLEKGEISVVVADE  65



>ref|XP_007201483.1| hypothetical protein PRUPE_ppa014546mg [Prunus persica]
 gb|EMJ02682.1| hypothetical protein PRUPE_ppa014546mg [Prunus persica]
Length=63

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+  G  + L AG  WKMHHWN QR++K FYD+LEKG+ISVV
Sbjct  1    MAGHKIAHATLKGPSVVKEICYGMVIALAAGSLWKMHHWNEQRKVKVFYDLLEKGEISVV  60

Query  275  ADE  283
            ADE
Sbjct  61   ADE  63



>gb|KCW52911.1| hypothetical protein EUGRSUZ_J02226, partial [Eucalyptus grandis]
Length=97

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 5/86 (6%)
 Frame = +2

Query  32   LYLLKRISFSLVSAFWCFCSRMAGGH-VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHH  208
            L+ LK    S +   W    +MAG H VA   ++GPSVVKE+V G +LG+ AG  WKMHH
Sbjct  16   LFFLK----SCLPKNWQRREQMAGPHQVARAAHRGPSVVKEIVYGITLGISAGLLWKMHH  71

Query  209  WNSQRRMKEFYDMLEKGQISVVADEE  286
            WN QRR KEFYD+LE+G+ISVV ++E
Sbjct  72   WNYQRRTKEFYDLLERGEISVVVEDE  97



>ref|XP_010033301.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Eucalyptus 
grandis]
Length=65

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  95   MAGGH-VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISV  271
            MAG H VA   ++GPSVVKE+V G +LG+ AG  WKMHHWN QRR KEFYD+LE+G+ISV
Sbjct  1    MAGPHQVARAAHRGPSVVKEIVYGITLGISAGLLWKMHHWNYQRRTKEFYDLLERGEISV  60

Query  272  VADEE  286
            V ++E
Sbjct  61   VVEDE  65



>ref|XP_008235147.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Prunus 
mume]
Length=63

 Score = 89.7 bits (221),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+  G  L L AG  WKMHHWN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAGHKIAHATLKGPSVVKEICYGMVLALAAGSLWKMHHWNEQRKVRVFYDLLEKGEISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>gb|KDP45317.1| hypothetical protein JCGZ_09566 [Jatropha curcas]
Length=65

 Score = 89.7 bits (221),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  98   AGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVA  277
            A   + H VY+GPSV+KE+V G SLGL AG  WKMHHWN+QRR KEFYD+LEK +I+VV 
Sbjct  3    AAKKLGHGVYRGPSVLKEIVYGISLGLAAGLLWKMHHWNNQRRTKEFYDLLEKDEITVVV  62

Query  278  DEE  286
            ++E
Sbjct  63   EDE  65



>ref|XP_011070033.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum]
 ref|XP_011070034.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum]
 ref|XP_011070035.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum]
Length=63

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  101  GGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVAD  280
             G + H   KGP+VVKE++IG +LG+ AG  WKMHHWN QR+++ FYD+L+KG+I+VVA 
Sbjct  2    AGRIPHPTLKGPNVVKEIIIGITLGIAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAA  61

Query  281  EE  286
            EE
Sbjct  62   EE  63



>ref|XP_010106282.1| Cytochrome c oxidase subunit 5C-2 [Morus notabilis]
 gb|EXC09699.1| Cytochrome c oxidase subunit 5C-2 [Morus notabilis]
Length=63

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKEL+IG  L L AG  WKMHHWN QR+++ FYD+L+KG+I VV
Sbjct  1    MAGHKVAHATLKGPSVVKELLIGSVLALAAGSLWKMHHWNEQRKVRTFYDLLDKGEIGVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>gb|KJB24414.1| hypothetical protein B456_004G144400 [Gossypium raimondii]
Length=57

 Score = 89.0 bits (219),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEK  256
            MAG  VAH   KGPSVVKE+VIG +LGL AGG WKMHHWN QR+++ FYDMLEK
Sbjct  1    MAGSRVAHATLKGPSVVKEIVIGITLGLCAGGLWKMHHWNEQRKVRAFYDMLEK  54



>ref|XP_006492338.1| PREDICTED: probable cytochrome c oxidase subunit 5C-3-like [Citrus 
sinensis]
Length=63

 Score = 89.0 bits (219),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE+ +G +LGL AGG WKM+ WN+QR+ + FYD+LEKG++SVV
Sbjct  1    MAGHKIAHATLKGPSVVKEICLGITLGLAAGGLWKMNQWNNQRKSRVFYDLLEKGEVSVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>gb|EPS64250.1| hypothetical protein M569_10536, partial [Genlisea aurea]
Length=70

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  89   SRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQIS  268
            ++M+G  V H   KGPSVVKE++IG SLGL AG  WKM HWN QR+ +EFYD+  KG++S
Sbjct  6    TKMSGSRVVHATLKGPSVVKEILIGASLGLAAGSVWKMFHWNQQRKTREFYDLYNKGEVS  65

Query  269  VVADE  283
            VV +E
Sbjct  66   VVVEE  70



>gb|KJB24415.1| hypothetical protein B456_004G144400 [Gossypium raimondii]
Length=64

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEK  256
            MAG  VAH   KGPSVVKE+VIG +LGL AGG WKMHHWN QR+++ FYDMLEK
Sbjct  1    MAGSRVAHATLKGPSVVKEIVIGITLGLCAGGLWKMHHWNEQRKVRAFYDMLEK  54



>ref|XP_008386720.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Malus 
domestica]
Length=63

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE++ G  L L  G  WKMHHWN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAGHKIAHATLKGPSVVKEILYGSVLALACGSLWKMHHWNEQRKVRAFYDLLEKGEISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>emb|CDP17068.1| unnamed protein product [Coffea canephora]
Length=63

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MA   VAH    GPSVVKEL+ G   GL AG  WKMHHWN QR+++ FYD+LEKG ISVV
Sbjct  1    MAAHKVAHATLTGPSVVKELIFGAVFGLAAGTLWKMHHWNEQRKVRAFYDLLEKGDISVV  60

Query  275  ADE  283
            A+E
Sbjct  61   AEE  63



>ref|XP_010689705.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Beta vulgaris 
subsp. vulgaris]
Length=64

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            M    +AHV  K PSVVKE++ G SLG   G  WKMHHWN+QRR KEF+D+LEKGQISVV
Sbjct  1    MGAQKIAHVASKNPSVVKEIIYGISLGTACGLLWKMHHWNNQRRTKEFHDLLEKGQISVV  60

Query  275  ADE  283
             ++
Sbjct  61   VED  63



>ref|XP_008369045.1| PREDICTED: probable cytochrome c oxidase subunit 5C-3 [Malus 
domestica]
 ref|XP_009378732.1| PREDICTED: probable cytochrome c oxidase subunit 5C-3 [Pyrus 
x bretschneideri]
Length=63

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKE++ G  L L  G  WKMHHWN QR+++ FYD+LEKG+ISVV
Sbjct  1    MAGHKIAHATLKGPSVVKEILYGSVLALACGSLWKMHHWNEQRKVRAFYDLLEKGEISVV  60

Query  275  ADE  283
             +E
Sbjct  61   VEE  63



>ref|XP_010088697.1| Cytochrome c oxidase subunit 5C-2 [Morus notabilis]
 gb|EXB36878.1| Cytochrome c oxidase subunit 5C-2 [Morus notabilis]
Length=71

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKEL+IG  L L AG  WKMHHWN QR+++ FYD+L+KG+I VV
Sbjct  1    MAGHKVAHATLKGPSVVKELLIGSVLALAAGSLWKMHHWNEQRKVRTFYDLLDKGEIGVV  60



>emb|CDP02085.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 5/69 (7%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKE-----FYDMLEKG  259
            MA   + HV  KGPSV K +V+G S G++AGG WKMHHWN+QRR KE     FYDMLEK 
Sbjct  1    MAAQRIGHVANKGPSVFKAIVLGMSFGVMAGGLWKMHHWNNQRRTKEHLGSSFYDMLEKD  60

Query  260  QISVVADEE  286
            +ISVV  EE
Sbjct  61   EISVVVVEE  69



>ref|XP_008345523.1| PREDICTED: probable cytochrome c oxidase subunit 5C-3 [Malus 
domestica]
Length=86

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  89   SRMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQIS  268
            S MAG   AH   KGPSVVKE++ G  L L  G  WKMHHWN QR+++ FYD+LEKG+IS
Sbjct  22   SEMAGHKFAHATLKGPSVVKEILYGSVLVLACGSLWKMHHWNEQRKVRAFYDLLEKGEIS  81

Query  269  VVADE  283
            VV +E
Sbjct  82   VVVEE  86



>ref|XP_007163179.1| hypothetical protein PHAVU_001G213100g, partial [Phaseolus vulgaris]
 gb|ESW35173.1| hypothetical protein PHAVU_001G213100g, partial [Phaseolus vulgaris]
Length=108

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +AH   KGPSVVKE++IG  LGL A  FWKMHHWN +++++ FYD LEKG+ISVV +EE
Sbjct  50   IAHATLKGPSVVKEIIIGTVLGLGAASFWKMHHWNEKKKIRTFYDFLEKGEISVVKEEE  108



>ref|XP_002524666.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis]
 gb|EEF37685.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis]
Length=65

 Score = 84.0 bits (206),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  125  YKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            Y GPS++KE++ G SLGL AG  WKMHHWN+Q+R KEFYD+LE+G+ISVV ++E
Sbjct  12   YNGPSIIKEIIYGISLGLGAGLLWKMHHWNNQKRAKEFYDLLERGEISVVVEDE  65



>ref|XP_010660885.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Vitis 
vinifera]
 emb|CBI34888.3| unnamed protein product [Vitis vinifera]
Length=65

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +    Y+GPS+ KE++ G + GLIAGG WK +HWN QRR KEFYDMLE+G+ISVV ++E
Sbjct  7    IGQASYRGPSIFKEIMYGLTAGLIAGGLWKRYHWNLQRRNKEFYDMLERGEISVVVEDE  65



>ref|XP_010251362.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Nelumbo 
nucifera]
Length=68

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  104  GHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADE  283
            GH ++    GPSV+KE++ G +LGLIAGGFWKMHHW+ ++R KEFYD+LEKG ISVV + 
Sbjct  8    GHASYNKGSGPSVLKEIMHGMALGLIAGGFWKMHHWSYRKRTKEFYDLLEKGDISVVVEG  67

Query  284  E  286
            +
Sbjct  68   D  68



>ref|XP_008785010.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Phoenix 
dactylifera]
Length=67

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +2

Query  110  VAHVVYKGPS--VVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADE  283
            V     KGPS  V+KE++ G SLGL AG FWKM+HW+SQRR +EFYD+L+KG+ISVV DE
Sbjct  8    VGQAASKGPSPSVIKEMIYGISLGLAAGFFWKMYHWSSQRRTREFYDLLDKGEISVVVDE  67



>ref|XP_002880298.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH56557.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=64

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKELVIG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISVV
Sbjct  1    MAGHKVAHATLKGPSVVKELVIGLALGLAAGGLWKMHHWNEQRKTRTFYDLLERGEISVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>ref|NP_182260.1| cytochrome c oxidase subunit Vc family protein [Arabidopsis thaliana]
 sp|O22912.1|CX5C1_ARATH RecName: Full=Probable cytochrome c oxidase subunit 5C-1; AltName: 
Full=Cytochrome c oxidase polypeptide Vc-1 [Arabidopsis 
thaliana]
 gb|AAB63838.1| putative cytochrome c oxidase Vc subunit [Arabidopsis thaliana]
 gb|AAL50091.1| At2g47380/T8I13.22 [Arabidopsis thaliana]
 gb|AAM10358.1| At2g47380/T8I13.22 [Arabidopsis thaliana]
 gb|AEC10834.1| cytochrome c oxidase subunit Vc family protein [Arabidopsis thaliana]
Length=64

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKEL IG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISVV
Sbjct  1    MAGHKVAHATLKGPSVVKELFIGLALGLAAGGLWKMHHWNEQRKTRTFYDLLERGEISVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>ref|XP_006292157.1| hypothetical protein CARUB_v10018363mg [Capsella rubella]
 gb|EOA25055.1| hypothetical protein CARUB_v10018363mg [Capsella rubella]
Length=64

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKEL IG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISVV
Sbjct  1    MAGHKVAHATLKGPSVVKELFIGLALGLAAGGLWKMHHWNEQRKTRSFYDLLERGEISVV  60

Query  275  ADEE  286
            A EE
Sbjct  61   AAEE  64



>ref|XP_009116909.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica 
rapa]
 emb|CDY11419.1| BnaA09g39850D [Brassica napus]
 emb|CDX76634.1| BnaC08g32200D [Brassica napus]
Length=64

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKELVIG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISVV
Sbjct  1    MAGHRVAHATLKGPSVVKELVIGLALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVV  60

Query  275  ADEE  286
              EE
Sbjct  61   HPEE  64



>ref|XP_009104382.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica 
rapa]
 ref|XP_009104383.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica 
rapa]
 ref|XP_009104384.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica 
rapa]
 emb|CDX67891.1| BnaA07g19310D [Brassica napus]
Length=64

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  VAH   KGPSVVKELVIG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISVV
Sbjct  1    MAGHKVAHATLKGPSVVKELVIGLALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVV  60

Query  275  ADEE  286
              EE
Sbjct  61   HPEE  64



>emb|CDY25109.1| BnaC06g18510D [Brassica napus]
Length=127

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  92   RMAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISV  271
             MAG  VAH   KGPSVVKELVIG +LGL AGG WKMHHWN QR+ + FYD+LE+G+ISV
Sbjct  63   EMAGHKVAHATLKGPSVVKELVIGLALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISV  122

Query  272  VADEE  286
            V  EE
Sbjct  123  VHPEE  127



>ref|XP_002866426.1| hypothetical protein ARALYDRAFT_496289 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42685.1| hypothetical protein ARALYDRAFT_496289 [Arabidopsis lyrata subsp. 
lyrata]
Length=64

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKELVIG +LGL AGG WKMHHWN QR+ + FYD+LE+G+I VV
Sbjct  1    MAGHKIAHATLKGPSVVKELVIGLALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEIGVV  60

Query  275  ADEE  286
              EE
Sbjct  61   VAEE  64



>ref|XP_008237260.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Prunus mume]
Length=62

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  101  GGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVAD  280
             G VAH   KGPSV++E+  G  +   AG FWKM+HW+ Q++ + FY++LEK ++SVV D
Sbjct  2    AGRVAHPTLKGPSVIREMCFGLVIAFAAGSFWKMYHWDLQKKTRSFYELLEKDEVSVVPD  61

Query  281  E  283
            E
Sbjct  62   E  62



>gb|ABK20891.1| unknown [Picea sitchensis]
 gb|ABK24962.1| unknown [Picea sitchensis]
 gb|ABK25688.1| unknown [Picea sitchensis]
Length=66

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +2

Query  113  AHVVYKG-PSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            +HV  KG PSV+KE+  G +LGL+AGG WKM+ W  QR+ +EFY+MLE+G ISVV +EE
Sbjct  8    SHVALKGGPSVIKEICYGLALGLMAGGVWKMYQWREQRKTREFYEMLERGVISVVHEEE  66



>gb|ABL97970.1| cytochrome-c oxidase [Brassica rapa]
Length=63

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKELVIG +LGL AGG WKMHHWN QR+ + FYD+L+K +ISVV
Sbjct  1    MAGHKIAHATLKGPSVVKELVIGLALGLAAGGLWKMHHWNEQRKTRAFYDLLDKDEISVV  60

Query  275  ADE  283
              E
Sbjct  61   VAE  63



>gb|EMT09818.1| Putative cytochrome c oxidase subunit 5C-4 [Aegilops tauschii]
Length=81

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  128  KGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADE  283
            + PSVVKE+V G SLGL AG  WK+HHW++QRR +EFY +L++G+I+VV DE
Sbjct  24   RPPSVVKEIVYGMSLGLFAGYLWKLHHWSNQRRTREFYALLDEGRITVVVDE  75



>emb|CDM81139.1| unnamed protein product [Triticum aestivum]
Length=81

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  134  PSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADE  283
            PSVV+E+V G SLGL AG  WK+HHW++QRR +EFY +L++G+I+VV DE
Sbjct  26   PSVVREIVYGMSLGLFAGYLWKLHHWSNQRRTREFYSLLDEGRITVVVDE  75



>emb|CDM81134.1| unnamed protein product [Triticum aestivum]
Length=105

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  128  KGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE*TSFTYF  307
            + PSVV+E+V G SLGL AG  WK+HHW++QRR +EF+ +L++G+ISVV DE   + T  
Sbjct  24   RPPSVVREIVYGMSLGLFAGYLWKLHHWSNQRRTREFHSLLDQGRISVVVDEPAGARTSI  83

Query  308  FAVV  319
              +V
Sbjct  84   IHIV  87



>emb|CDY02156.1| BnaA03g40110D [Brassica napus]
Length=520

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKELVIG +LGL AGG WKMHHWN QR+ + FYD+LEK +ISVV
Sbjct  457  MAGHKIAHATLKGPSVVKELVIGLALGLAAGGLWKMHHWNEQRKTRAFYDLLEKDEISVV  516

Query  275  ADE  283
              E
Sbjct  517  VAE  519



>emb|CDY23070.1| BnaC07g31170D [Brassica napus]
Length=526

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            MAG  +AH   KGPSVVKELVIG +LGL AGG WKMHHWN QR+ + FYD+L+K +ISVV
Sbjct  464  MAGHKIAHATLKGPSVVKELVIGLALGLAAGGMWKMHHWNEQRKTRAFYDLLDKDEISVV  523

Query  275  ADE  283
              E
Sbjct  524  VAE  526



>emb|CDM81135.1| unnamed protein product [Triticum aestivum]
Length=166

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  128  KGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADE  283
            + PSVV+E+V G SLGL+ G  WK+HHW++QRR +E Y +L++G ISVV DE
Sbjct  90   RSPSVVREIVYGMSLGLLVGYLWKLHHWSNQRRTRELYSLLDEGTISVVVDE  141



>ref|XP_002457267.1| hypothetical protein SORBIDRAFT_03g004470 [Sorghum bicolor]
 gb|EES02387.1| hypothetical protein SORBIDRAFT_03g004470 [Sorghum bicolor]
Length=81

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  134  PSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            PSV++E+V G SLGL AG  WK+HHW++QRR +EFY +L++G+I+VVA ++
Sbjct  25   PSVLREIVYGMSLGLFAGYLWKLHHWSNQRRTREFYSLLDQGKITVVAGDD  75



>emb|CDJ26654.1| unnamed protein product [Triticum aestivum]
Length=77

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  KGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            + PSVV E+V G SLGL+AG  WK+HHW++QR  +EFY +L++G+IS+V   E
Sbjct  24   RPPSVVTEIVYGMSLGLLAGYLWKLHHWSNQRHTREFYSLLDEGRISIVNCSE  76



>gb|KHN33920.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja]
Length=50

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYD  244
            MAG  +AH   KGPSVVKE++IG +LGL AGG WKMHH+N+++++   Y+
Sbjct  1    MAGPRIAHATLKGPSVVKEIIIGITLGLAAGGVWKMHHYNNKKKIIYIYN  50



>gb|AAD02550.1| PGPS/D8 [Petunia x hybrida]
Length=63

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  101  GGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVAD  280
            GG V H+   GP ++KE+VIGF L   AGG +KM HW++Q+R   FY  L++G+ +VVA+
Sbjct  2    GGRVQHIQLGGPMLIKEIVIGFVLAYAAGGAFKMWHWDTQKRTNHFYQQLDRGEATVVAE  61

Query  281  E  283
            +
Sbjct  62   D  62



>ref|XP_006601150.1| PREDICTED: probable cytochrome c oxidase subunit 5C-3-like [Glycine 
max]
Length=50

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYD  244
            MAG  +AH   KGPSVVK+++IG +LGL AGG WKMHH+N+++++   Y+
Sbjct  1    MAGPRIAHATLKGPSVVKDIIIGITLGLAAGGVWKMHHYNNKKKIIYIYN  50



>ref|XP_007214274.1| hypothetical protein PRUPE_ppa026977mg [Prunus persica]
 gb|EMJ15473.1| hypothetical protein PRUPE_ppa026977mg [Prunus persica]
Length=150

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  134  PSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADE  283
            PSVVKE+  G  L L  G  WKMHHWN QR+++ F+D+LEKG+I VVA E
Sbjct  101  PSVVKEIRYGMVLALATGKLWKMHHWNEQRKVRVFHDLLEKGEIRVVARE  150



>ref|XP_007216586.1| hypothetical protein PRUPE_ppb018456mg, partial [Prunus persica]
 gb|EMJ17785.1| hypothetical protein PRUPE_ppb018456mg, partial [Prunus persica]
Length=68

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  137  SVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            S+VKE++ G ++GL  G  WKM+HWN QRR KEFY++L++G+IS V +++
Sbjct  19   SIVKEIIYGATIGLSVGFLWKMYHWNLQRRTKEFYELLDRGEISTVVEDD  68



>ref|XP_008230942.1| PREDICTED: uncharacterized protein LOC103330167 [Prunus mume]
Length=153

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 4/55 (7%)
 Frame = +2

Query  122  VYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADEE  286
            ++ GPSVVKE+V G ++G +    WKM+HWN QRR KEFY++L +G+IS V +++
Sbjct  103  LFMGPSVVKEIVYGVTVGFL----WKMYHWNLQRRTKEFYELLGRGEISTVVEDD  153



>emb|CDY27493.1| BnaC04g51340D [Brassica napus]
Length=116

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  98   AGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVA  277
             G H+     KGPSVVKEL+IG +LGL AGG WKMHHWN QR+ + FYD+LE+G+I+V+A
Sbjct  55   TGLHMP-ATLKGPSVVKELIIGLALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEINVIA  113

Query  278  DEE  286
             EE
Sbjct  114  AEE  116



>ref|XP_010652243.1| PREDICTED: cytochrome c oxidase subunit 5C [Vitis vinifera]
Length=61

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  110  VAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVADE  283
            +AHV  KGPSVVKE+ +G  + L AGG WKM+HWN QR+ K FYDM  KG+ +VV +E
Sbjct  4    IAHVTLKGPSVVKEIAVGAVVALAAGGLWKMYHWNLQRQYKMFYDMQGKGECTVVTEE  61



>ref|XP_001764108.1| predicted protein [Physcomitrella patens]
 gb|EDQ70949.1| predicted protein [Physcomitrella patens]
Length=68

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  104  GHVAHVVYKG-PSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVAD  280
             HVA    K  P++VKE+  G  LG+  G FWK+HH N +R+ +EFY  LE G+I+V A+
Sbjct  9    AHVAAQANKASPNLVKEIFYGIGLGIFGGSFWKIHHLNERRKTEEFYARLEAGEITVNAE  68



>ref|XP_001778406.1| predicted protein [Physcomitrella patens]
 gb|EDQ56764.1| predicted protein [Physcomitrella patens]
Length=68

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  104  GHVAHVVYKG-PSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVVAD  280
             HVA    K  P++VKE+  G  LG+  G FWK+HH N +R+ +EFY  LE G+I+V A+
Sbjct  9    AHVAAQANKASPNLVKEIFYGIGLGIFGGSFWKIHHLNERRKTEEFYARLEAGEITVNAE  68



>gb|AFW62795.1| hypothetical protein ZEAMMB73_426319 [Zea mays]
Length=60

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 7/50 (14%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYD  244
            MA   VAH   KG SV        +LGLIAGG WKMHHWN QR+ + FY+
Sbjct  1    MASDRVAHATLKGSSV-------LTLGLIAGGMWKMHHWNKQRKTRSFYE  43



>gb|KHN49019.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja]
Length=52

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMK  232
            MAG  + H   KGPSVVK+++IG +LGL AGG  KMHHWN+    K
Sbjct  1    MAGPRIVHATLKGPSVVKDIIIGITLGLAAGGVRKMHHWNNNSVYK  46



>gb|KHN35910.1| Cytochrome c oxidase subunit 5C-2, partial [Glycine soja]
Length=40

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWN  214
            MAG  + H   KGPSVVK+++IG +LGL AGG  KMHHWN
Sbjct  1    MAGPRIVHATLKGPSVVKDIIIGITLGLAAGGVRKMHHWN  40



>ref|XP_007513118.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16676.1| predicted protein [Bathycoccus prasinos]
Length=55

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  95   MAGGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYD  244
            MAG  V H V +   +VKE VIG SLGL+AG  WK  HW  ++ ++ +YD
Sbjct  1    MAGPTVYHGVAQKVYLVKEAVIGMSLGLVAGAVWKYSHWERRKEIQSYYD  50



>ref|XP_002960593.1| hypothetical protein SELMODRAFT_437650 [Selaginella moellendorffii]
 ref|XP_002969236.1| hypothetical protein SELMODRAFT_410175 [Selaginella moellendorffii]
 gb|EFJ29324.1| hypothetical protein SELMODRAFT_410175 [Selaginella moellendorffii]
 gb|EFJ38132.1| hypothetical protein SELMODRAFT_437650 [Selaginella moellendorffii]
Length=111

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  134  PSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEKGQISVV  274
            P+V++EL IG +LG   G  WK++H N +R  +EFY  L+KG  + V
Sbjct  54   PNVLRELTIGLALGFAGGALWKIYHLNWRRHCEEFYVGLDKGIYTTV  100



>ref|XP_006362442.1| PREDICTED: uncharacterized protein LOC102602011 [Solanum tuberosum]
Length=1047

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 31/52 (60%), Gaps = 5/52 (10%)
 Frame = +2

Query  101  GGHVAHVVYKGPSVVKELVIGFSLGLIAGGFWKMHHWNSQRRMKEFYDMLEK  256
            GG + H+   GP ++KE+VI F L   AGG +KM HW+ Q     FY  L++
Sbjct  2    GGRIQHIQLGGPMLIKEIVIAFVLAFAAGGAFKMWHWDMQ-----FYHQLDR  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400