BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J17

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10064.1|  unnamed protein product                                270   2e-84   Coffea canephora [robusta coffee]
ref|XP_002519083.1|  sugar transporter, putative                        261   6e-81   Ricinus communis
ref|XP_008350306.1|  PREDICTED: putative polyol transporter 1           253   2e-80   
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    259   2e-80   Sesamum indicum [beniseed]
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               258   5e-80   Sesamum indicum [beniseed]
emb|CAP58706.1|  putative polyol transporter protein 1                  256   4e-79   Hevea brasiliensis [jebe]
gb|EYU42630.1|  hypothetical protein MIMGU_mgv1a0059091mg               246   5e-79   Erythranthe guttata [common monkey flower]
gb|KDP46230.1|  hypothetical protein JCGZ_10070                         256   6e-79   Jatropha curcas
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               256   1e-78   Nicotiana tomentosiformis
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           256   1e-78   Pyrus x bretschneideri [bai li]
emb|CAP58707.1|  putative polyol transported protein 2                  256   1e-78   Hevea brasiliensis [jebe]
gb|AAY86779.1|  putative sugar transporter protein                      247   1e-78   Noccaea caerulescens
emb|CAD58710.1|  polyol transporter                                     254   2e-78   Plantago major [cart-track plant]
ref|NP_001281033.1|  polyol transporter 5-like                          254   5e-78   Malus domestica [apple tree]
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           253   7e-78   Pyrus x bretschneideri [bai li]
ref|XP_007200585.1|  hypothetical protein PRUPE_ppa007633mg             248   8e-78   
gb|AGG19155.1|  sorbitol transporter                                    253   8e-78   Pyrus pyrifolia [sha li]
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           253   9e-78   Pyrus x bretschneideri [bai li]
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               253   1e-77   Solanum tuberosum [potatoes]
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           253   1e-77   Malus domestica [apple tree]
gb|ABK29439.1|  sugar transport protein                                 253   1e-77   Coffea canephora [robusta coffee]
emb|CDO97075.1|  unnamed protein product                                253   1e-77   Coffea canephora [robusta coffee]
emb|CAD58709.1|  polyol transporter                                     253   1e-77   Plantago major [cart-track plant]
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           253   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_002313809.1|  putative sorbitol transporter family protein       252   2e-77   Populus trichocarpa [western balsam poplar]
gb|EPS69995.1|  sugar transport protein                                 252   2e-77   Genlisea aurea
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               252   3e-77   Nicotiana sylvestris
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           252   3e-77   Malus domestica [apple tree]
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    250   1e-76   Sesamum indicum [beniseed]
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               250   1e-76   Solanum tuberosum [potatoes]
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    250   1e-76   
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               250   2e-76   Populus euphratica
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           249   3e-76   Pyrus x bretschneideri [bai li]
gb|ACB56939.1|  mannitol transporter                                    249   3e-76   Artemisia annua [sweet Annie]
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               249   4e-76   Prunus mume [ume]
emb|CDP17996.1|  unnamed protein product                                248   4e-76   Coffea canephora [robusta coffee]
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                249   5e-76   
emb|CDP18000.1|  unnamed protein product                                248   6e-76   Coffea canephora [robusta coffee]
gb|AAM44082.1|  putative sorbitol transporter                           247   2e-75   Prunus cerasus [pie cherry]
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               247   2e-75   Fragaria vesca subsp. vesca
ref|XP_010096202.1|  Polyol transporter 5                               246   4e-75   Morus notabilis
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                245   6e-75   Erythranthe guttata [common monkey flower]
gb|KCW55335.1|  hypothetical protein EUGRSUZ_I01255                     243   9e-75   Eucalyptus grandis [rose gum]
gb|KHN25361.1|  Polyol transporter 5                                    244   1e-74   Glycine soja [wild soybean]
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               244   1e-74   
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           244   1e-74   
ref|XP_009780685.1|  PREDICTED: polyol transporter 5-like               233   1e-74   Nicotiana sylvestris
gb|AAT06053.2|  sorbitol transporter                                    244   2e-74   Malus domestica [apple tree]
emb|CAR82416.1|  polyol transporter                                     233   2e-74   Plantago major [cart-track plant]
gb|KHN39768.1|  Polyol transporter 5                                    244   3e-74   Glycine soja [wild soybean]
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               243   4e-74   Malus domestica [apple tree]
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               244   4e-74   Solanum tuberosum [potatoes]
ref|NP_001289249.1|  polyol transporter 5-like                          243   4e-74   Pyrus x bretschneideri [bai li]
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    243   5e-74   Arabis alpina [alpine rockcress]
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               243   5e-74   Fragaria vesca subsp. vesca
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               243   6e-74   Nicotiana tomentosiformis
gb|AIU41385.1|  sorbitol transporter 1                                  243   6e-74   Prunus salicina [Japanese plum]
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               243   6e-74   Nicotiana tomentosiformis
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               243   7e-74   Eucalyptus grandis [rose gum]
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           243   7e-74   
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               242   8e-74   
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           243   9e-74   Pyrus x bretschneideri [bai li]
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             243   9e-74   Eutrema salsugineum [saltwater cress]
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               243   1e-73   Cicer arietinum [garbanzo]
ref|NP_001287655.1|  polyol transporter 5-like                          243   1e-73   Solanum lycopersicum
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               242   1e-73   Nicotiana sylvestris
ref|XP_003539021.2|  PREDICTED: polyol transporter 5-like               236   1e-73   
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           242   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               242   1e-73   Phoenix dactylifera
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     242   2e-73   Medicago truncatula
gb|AFI61955.1|  polyol transporter                                      242   2e-73   Camellia sinensis [black tea]
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           242   2e-73   
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               242   2e-73   Eucalyptus grandis [rose gum]
gb|KJB32189.1|  hypothetical protein B456_005G228500                    242   2e-73   Gossypium raimondii
gb|KHG20989.1|  Polyol transporter 5 -like protein                      242   2e-73   Gossypium arboreum [tree cotton]
ref|NP_001280902.1|  putative polyol transporter 1                      241   2e-73   Malus domestica [apple tree]
ref|NP_001236592.1|  sorbitol-like transporter                          241   2e-73   
gb|AGY96955.1|  polyol transporter 1                                    241   3e-73   Vitis vinifera
emb|CAJ29291.1|  putative polyol transporter protein 4                  241   3e-73   Lotus japonicus
gb|ACC61047.1|  mannitol transporter                                    237   3e-73   Gossypium hirsutum [American cotton]
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    241   4e-73   Vitis vinifera
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             240   5e-73   Prunus persica
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               240   5e-73   Prunus mume [ume]
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             240   6e-73   Phaseolus vulgaris [French bean]
gb|AAO39267.1|AF482011_1  sorbitol transporter                          239   7e-73   Prunus cerasus [pie cherry]
gb|KJB12315.1|  hypothetical protein B456_002G011400                    240   1e-72   Gossypium raimondii
gb|KGN44323.1|  Sugar transporter                                       239   1e-72   Cucumis sativus [cucumbers]
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           239   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_002885281.1|  ATPLT5                                             239   2e-72   Arabidopsis lyrata subsp. lyrata
emb|CDY61985.1|  BnaC03g73840D                                          239   2e-72   Brassica napus [oilseed rape]
ref|XP_004170410.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    239   3e-72   
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               239   3e-72   Cucumis sativus [cucumbers]
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    238   4e-72   Brassica rapa
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             238   4e-72   Citrus clementina [clementine]
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    238   4e-72   Populus euphratica
ref|XP_004171995.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    238   4e-72   
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               238   4e-72   Eucalyptus grandis [rose gum]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               238   5e-72   Citrus sinensis [apfelsine]
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               238   9e-72   Sesamum indicum [beniseed]
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    237   2e-71   Brassica rapa
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           236   2e-71   Prunus mume [ume]
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           236   2e-71   
gb|AAL85876.2|AF480069_1  mannitol transporter                          236   3e-71   Apium graveolens Dulce Group [celery]
gb|AAN07021.1|  putative mannitol transporter                           235   4e-71   Phelipanche ramosa
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             235   5e-71   Prunus persica
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             235   6e-71   Populus trichocarpa [western balsam poplar]
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             235   7e-71   Phaseolus vulgaris [French bean]
ref|XP_006856084.1|  hypothetical protein AMTR_s00059p00122840          235   7e-71   Amborella trichopoda
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               234   1e-70   Tarenaya hassleriana [spider flower]
gb|KJB12316.1|  hypothetical protein B456_002G011500                    234   1e-70   Gossypium raimondii
emb|CDX95491.1|  BnaC01g33830D                                          234   1e-70   
ref|XP_006856085.1|  hypothetical protein AMTR_s00059p00123280          234   1e-70   
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           234   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             233   2e-70   Phaseolus vulgaris [French bean]
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         234   2e-70   
gb|ACB86853.1|  mannitol transporter                                    234   2e-70   Citrus sinensis [apfelsine]
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               233   3e-70   Glycine max [soybeans]
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             233   3e-70   
ref|XP_009121242.1|  PREDICTED: putative polyol transporter 1           225   3e-70   
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         234   3e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           233   6e-70   
gb|ACJ85869.1|  unknown                                                 230   7e-70   Medicago truncatula
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    232   9e-70   Tarenaya hassleriana [spider flower]
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    232   9e-70   Tarenaya hassleriana [spider flower]
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   231   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    232   1e-69   Tarenaya hassleriana [spider flower]
gb|KFK41272.1|  hypothetical protein AALP_AA2G108500                    229   1e-69   Arabis alpina [alpine rockcress]
ref|NP_001060108.1|  Os07g0582400                                       233   2e-69   
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    231   2e-69   Tarenaya hassleriana [spider flower]
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             231   2e-69   Citrus clementina [clementine]
ref|NP_188513.1|  polyol transporter 5                                  231   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               231   2e-69   Citrus sinensis [apfelsine]
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             230   3e-69   
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          230   3e-69   Sorghum bicolor [broomcorn]
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           230   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002884156.1|  predicted protein                                  230   3e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_003603886.1|  Mannitol transporter                               230   4e-69   Medicago truncatula
gb|KDP46229.1|  hypothetical protein JCGZ_10069                         230   4e-69   Jatropha curcas
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               230   4e-69   Zea mays [maize]
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               231   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               230   5e-69   Brachypodium distachyon [annual false brome]
gb|KFK40045.1|  hypothetical protein AALP_AA3G322700                    229   7e-69   Arabis alpina [alpine rockcress]
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             229   8e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           229   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006827104.1|  hypothetical protein AMTR_s00010p00243760          229   1e-68   
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           229   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             228   2e-68   Capsella rubella
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           228   2e-68   Camelina sativa [gold-of-pleasure]
emb|CDY46217.1|  BnaA07g03530D                                          228   3e-68   Brassica napus [oilseed rape]
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    228   3e-68   Cucumis melo [Oriental melon]
emb|CDY46218.1|  BnaA07g03520D                                          228   3e-68   Brassica napus [oilseed rape]
gb|EAZ04480.1|  hypothetical protein OsI_26629                          228   4e-68   Oryza sativa Indica Group [Indian rice]
dbj|BAC83310.1|  putative sorbitol transporter                          228   4e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             227   4e-68   Eutrema salsugineum [saltwater cress]
emb|CDP02097.1|  unnamed protein product                                227   5e-68   Coffea canephora [robusta coffee]
emb|CDP17999.1|  unnamed protein product                                227   5e-68   Coffea canephora [robusta coffee]
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               227   5e-68   Cicer arietinum [garbanzo]
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           227   6e-68   Camelina sativa [gold-of-pleasure]
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     227   6e-68   Eucalyptus grandis [rose gum]
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               227   6e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    228   6e-68   Camelina sativa [gold-of-pleasure]
dbj|BAJ85302.1|  predicted protein                                      228   7e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   227   7e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           227   8e-68   
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           226   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           226   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             227   9e-68   Prunus persica
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              226   9e-68   
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           226   9e-68   Brassica rapa
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             227   1e-67   Prunus persica
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           227   1e-67   Prunus mume [ume]
gb|AAG43998.1|AF215837_1  mannitol transporter                          226   1e-67   Apium graveolens Dulce Group [celery]
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             227   1e-67   
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           226   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               227   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           226   1e-67   Phoenix dactylifera
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           226   1e-67   Elaeis guineensis
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               226   1e-67   
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               226   2e-67   Setaria italica
gb|EMS55536.1|  Polyol transporter 5                                    226   2e-67   Triticum urartu
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    226   2e-67   Brassica rapa
ref|XP_008668471.1|  PREDICTED: hypothetical protein isoform X1         225   3e-67   Zea mays [maize]
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               225   3e-67   Phoenix dactylifera
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               225   4e-67   Prunus mume [ume]
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           224   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_003558585.1|  PREDICTED: putative polyol transporter 1           225   5e-67   Brachypodium distachyon [annual false brome]
gb|AEX55225.1|  sugar transporter                                       225   5e-67   Allium sativum
gb|KHN25431.1|  Polyol transporter 5                                    224   1e-66   Glycine soja [wild soybean]
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          224   1e-66   Sorghum bicolor [broomcorn]
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           224   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           225   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               224   1e-66   Glycine max [soybeans]
gb|EMS50618.1|  Polyol transporter 5                                    218   2e-66   Triticum urartu
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               223   2e-66   Oryza brachyantha
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           223   2e-66   Pyrus x bretschneideri [bai li]
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           223   2e-66   Pyrus x bretschneideri [bai li]
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           223   3e-66   Prunus mume [ume]
dbj|BAJ86526.1|  predicted protein                                      223   3e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003607077.1|  Sorbitol-like transporter                          223   3e-66   Medicago truncatula
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           223   4e-66   Pyrus x bretschneideri [bai li]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           223   4e-66   Pyrus x bretschneideri [bai li]
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    222   5e-66   
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                222   5e-66   Erythranthe guttata [common monkey flower]
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    222   5e-66   Setaria italica
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           222   7e-66   Pyrus x bretschneideri [bai li]
dbj|BAJ93158.1|  predicted protein                                      222   7e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86116.1|  predicted protein                                      222   7e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    221   9e-66   
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               221   1e-65   Setaria italica
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    221   1e-65   Setaria italica
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             221   1e-65   
ref|NP_001147446.1|  sorbitol transporter                               221   1e-65   Zea mays [maize]
ref|XP_007208924.1|  hypothetical protein PRUPE_ppb008257mg             214   1e-65   
ref|NP_001049269.1|  Os03g0197100                                       221   1e-65   
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             221   2e-65   Capsella rubella
ref|NP_001150711.1|  LOC100284344                                       221   2e-65   Zea mays [maize]
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               220   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABX71752.1|  mannitol transporter                                    220   3e-65   Apium graveolens
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           220   4e-65   Pyrus x bretschneideri [bai li]
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               219   8e-65   Brachypodium distachyon [annual false brome]
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               219   9e-65   Sesamum indicum [beniseed]
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               219   1e-64   Nelumbo nucifera [Indian lotus]
ref|NP_001142160.1|  hypothetical protein                               218   1e-64   Zea mays [maize]
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    219   1e-64   Phoenix dactylifera
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    218   1e-64   
dbj|BAC83311.1|  putative sorbitol transporter                          218   2e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           218   2e-64   Pyrus x bretschneideri [bai li]
gb|EMT15230.1|  Polyol transporter 5                                    218   2e-64   
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               218   2e-64   Phoenix dactylifera
ref|XP_010527168.1|  PREDICTED: putative polyol transporter 1           213   3e-64   Tarenaya hassleriana [spider flower]
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          217   3e-64   Sorghum bicolor [broomcorn]
ref|NP_001060109.2|  Os07g0582500                                       217   4e-64   
ref|XP_004148312.1|  PREDICTED: polyol transporter 5-like               216   5e-64   
gb|EAZ04481.1|  hypothetical protein OsI_26630                          216   5e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             217   6e-64   Phaseolus vulgaris [French bean]
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           216   9e-64   Phoenix dactylifera
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               216   1e-63   Prunus mume [ume]
gb|EAY88906.1|  hypothetical protein OsI_10385                          216   1e-63   Oryza sativa Indica Group [Indian rice]
gb|EEE58504.1|  hypothetical protein OsJ_09775                          216   1e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649563.1|  PREDICTED: polyol transporter 5-like               216   1e-63   Oryza brachyantha
ref|XP_010527595.1|  PREDICTED: polyol transporter 5-like               211   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               215   1e-63   Oryza brachyantha
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               215   2e-63   Oryza brachyantha
emb|CBI32562.3|  unnamed protein product                                211   3e-63   Vitis vinifera
gb|KJB12318.1|  hypothetical protein B456_002G011700                    214   5e-63   Gossypium raimondii
ref|XP_002468337.1|  hypothetical protein SORBIDRAFT_01g044010          214   7e-63   Sorghum bicolor [broomcorn]
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               214   9e-63   Brachypodium distachyon [annual false brome]
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      214   1e-62   
ref|NP_001281038.1|  polyol transporter 5-like                          212   2e-62   Malus domestica [apple tree]
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      212   2e-62   Setaria italica
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           212   4e-62   Brachypodium distachyon [annual false brome]
gb|EMT15229.1|  Putative polyol transporter 1                           207   5e-62   
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    211   5e-62   Tarenaya hassleriana [spider flower]
ref|XP_004149937.1|  PREDICTED: polyol transporter 5-like               211   6e-62   
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               210   1e-61   Nelumbo nucifera [Indian lotus]
gb|EMS55537.1|  Putative polyol transporter 1                           207   1e-61   Triticum urartu
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               210   1e-61   Cucumis melo [Oriental melon]
dbj|BAJ93015.1|  predicted protein                                      210   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00091.1|  predicted protein                                      210   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    209   4e-61   Zea mays [maize]
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               208   8e-61   Cucumis melo [Oriental melon]
ref|XP_004985339.1|  PREDICTED: polyol transporter 5-like               208   9e-61   Setaria italica
gb|AAY88181.2|  mannitol transporter 1                                  207   1e-60   Olea europaea
gb|EMS52712.1|  Putative polyol transporter 2                           208   1e-60   Triticum urartu
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          208   1e-60   Sorghum bicolor [broomcorn]
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               208   1e-60   
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           207   3e-60   
gb|KGN44327.1|  hypothetical protein Csa_7G253820                       205   1e-59   Cucumis sativus [cucumbers]
gb|AAO88964.1|  sorbitol transporter                                    204   2e-59   Malus domestica [apple tree]
gb|KGN44326.1|  Mannitol transporter                                    204   2e-59   Cucumis sativus [cucumbers]
gb|KHG12832.1|  Polyol transporter 5 -like protein                      194   3e-59   Gossypium arboreum [tree cotton]
dbj|BAM66296.1|  sorbitol transporter                                   202   3e-59   Pyrus pyrifolia [sha li]
gb|KJB12317.1|  hypothetical protein B456_002G011600                    203   4e-59   Gossypium raimondii
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               204   5e-59   Cucumis sativus [cucumbers]
ref|XP_004163631.1|  PREDICTED: polyol transporter 5-like               204   5e-59   
dbj|BAM66295.1|  sorbitol transporter                                   202   6e-59   Pyrus pyrifolia [sha li]
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1           199   6e-59   
ref|XP_004148302.1|  PREDICTED: polyol transporter 5-like               203   1e-58   Cucumis sativus [cucumbers]
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               202   2e-58   Cucumis melo [Oriental melon]
gb|ABR16466.1|  unknown                                                 202   2e-58   
ref|XP_007200584.1|  hypothetical protein PRUPE_ppa007633mg             197   2e-58   
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               201   3e-58   
ref|XP_010497306.1|  PREDICTED: putative polyol transporter 1           192   3e-58   
gb|AGG19156.1|  sorbitol transporter                                    201   3e-58   
ref|NP_001281036.1|  polyol transporter 5-like                          201   3e-58   
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               201   3e-58   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           201   4e-58   
ref|XP_006360474.1|  PREDICTED: polyol transporter 5-like               202   5e-58   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               201   5e-58   
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                    201   5e-58   
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               199   1e-57   
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               199   1e-57   
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    200   1e-57   
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               199   2e-57   
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               199   2e-57   
gb|EYU23018.1|  hypothetical protein MIMGU_mgv1a005494mg                198   3e-57   
gb|ABF94465.1|  Sugar transporter family protein, expressed             199   4e-57   
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               198   4e-57   
ref|XP_009607069.1|  PREDICTED: polyol transporter 5-like               198   4e-57   
ref|XP_009774532.1|  PREDICTED: polyol transporter 5-like               198   6e-57   
gb|KDP33672.1|  hypothetical protein JCGZ_07243                         197   7e-57   
ref|XP_010095276.1|  putative polyol transporter 6                      197   8e-57   
emb|CDP03333.1|  unnamed protein product                                197   9e-57   
ref|XP_010531021.1|  PREDICTED: probable polyol transporter 3           197   1e-56   
ref|XP_004243120.1|  PREDICTED: polyol transporter 5-like               196   2e-56   
emb|CBI28072.3|  unnamed protein product                                200   2e-56   
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               194   1e-55   
ref|XP_003529995.1|  PREDICTED: polyol transporter 5-like               195   1e-55   
gb|KGN48817.1|  hypothetical protein Csa_6G502060                       194   2e-55   
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           194   2e-55   
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             194   3e-55   
ref|XP_003620669.1|  Myo-inositol transporter                           193   4e-55   
ref|XP_008466921.1|  PREDICTED: putative polyol transporter 1           185   4e-55   
emb|CDY66291.1|  BnaCnng50240D                                          192   4e-55   
ref|XP_002514303.1|  sugar transporter, putative                        193   5e-55   
emb|CDY66868.1|  BnaUnng01720D                                          192   8e-55   
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  192   1e-54   
ref|XP_007046983.1|  Major facilitator superfamily protein              192   1e-54   
gb|ACJ85829.1|  unknown                                                 191   1e-54   
ref|XP_006590681.1|  PREDICTED: probable polyol transporter 3-like      191   2e-54   
gb|KDP33673.1|  hypothetical protein JCGZ_07244                         192   2e-54   
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            192   2e-54   
ref|XP_010099586.1|  Polyol transporter 5                               191   2e-54   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           191   2e-54   
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               192   3e-54   
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           191   3e-54   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           191   3e-54   
gb|KCW55336.1|  hypothetical protein EUGRSUZ_I01255                     189   3e-54   
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           191   4e-54   
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      190   4e-54   
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             190   4e-54   
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               190   5e-54   
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             190   5e-54   
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           190   5e-54   
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      191   5e-54   
ref|XP_008447046.1|  PREDICTED: polyol transporter 5-like               190   5e-54   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           190   6e-54   
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           190   7e-54   
gb|KDP27565.1|  hypothetical protein JCGZ_20028                         189   7e-54   
ref|XP_002514302.1|  sugar transporter, putative                        190   1e-53   
gb|KGN44328.1|  hypothetical protein Csa_7G257320                       189   1e-53   
ref|XP_007013362.1|  Polyol/monosaccharide transporter 5, putative      189   1e-53   
gb|AFK37582.1|  unknown                                                 189   1e-53   
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           190   1e-53   
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         189   1e-53   
ref|XP_008337386.1|  PREDICTED: polyol transporter 5-like               189   2e-53   
ref|NP_001066878.1|  Os12g0514000                                       188   2e-53   
ref|XP_004143580.1|  PREDICTED: probable polyol transporter 3-like      186   2e-53   
gb|EEC66802.1|  hypothetical protein OsI_33208                          187   3e-53   
ref|XP_002443259.1|  hypothetical protein SORBIDRAFT_08g016530          187   4e-53   
ref|XP_010049692.1|  PREDICTED: polyol transporter 5-like               188   4e-53   
ref|NP_001146002.1|  uncharacterized protein LOC100279532               187   4e-53   
ref|XP_007156923.1|  hypothetical protein PHAVU_002G028600g             187   4e-53   
gb|AAK13147.1|AC083945_22  Putative sugar transporter                   189   5e-53   
gb|AFW56602.1|  major myo-inositol transporter iolT                     187   5e-53   
ref|XP_006590682.1|  PREDICTED: probable polyol transporter 6-like      187   5e-53   
gb|EAZ15802.1|  hypothetical protein OsJ_31220                          187   6e-53   
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           187   7e-53   
ref|NP_001064429.1|  Os10g0360100                                       187   7e-53   
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           187   8e-53   
gb|KCW81997.1|  hypothetical protein EUGRSUZ_C03362                     187   8e-53   
ref|XP_011011702.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    191   8e-53   
ref|XP_007152832.1|  hypothetical protein PHAVU_004G163600g             187   1e-52   
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       186   2e-52   
ref|XP_010649162.1|  PREDICTED: probable polyol transporter 6 iso...    183   2e-52   
ref|XP_006451144.1|  hypothetical protein CICLE_v10007938mg             186   2e-52   
ref|NP_001168177.1|  uncharacterized protein LOC100381931               186   2e-52   
ref|XP_006475613.1|  PREDICTED: polyol transporter 5-like               186   2e-52   
gb|KDO50887.1|  hypothetical protein CISIN_1g009185mg                   186   2e-52   
ref|XP_007013177.1|  Polyol/monosaccharide transporter 5 isoform 1      186   3e-52   
ref|XP_003539908.1|  PREDICTED: probable polyol transporter 4-like      186   3e-52   
gb|KJB40206.1|  hypothetical protein B456_007G051000                    185   3e-52   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               185   3e-52   
dbj|BAK07233.1|  predicted protein                                      185   4e-52   
ref|XP_008463391.1|  PREDICTED: probable polyol transporter 6           185   4e-52   
ref|XP_002531429.1|  sugar transporter, putative                        185   5e-52   
ref|XP_006346993.1|  PREDICTED: probable polyol transporter 6-like      185   5e-52   
gb|KJB64901.1|  hypothetical protein B456_010G071400                    185   5e-52   
gb|KHN00554.1|  Putative polyol transporter 3                           184   6e-52   
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               184   6e-52   
gb|KHG11695.1|  Polyol transporter 5 -like protein                      185   6e-52   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           184   7e-52   
ref|XP_007148196.1|  hypothetical protein PHAVU_006G188100g             185   7e-52   
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     184   8e-52   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6-like      184   9e-52   
ref|XP_010536004.1|  PREDICTED: polyol transporter 5-like               184   9e-52   
ref|XP_004170584.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    184   1e-51   
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           184   1e-51   
ref|XP_010680814.1|  PREDICTED: probable polyol transporter 3           183   1e-51   
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           184   2e-51   
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    184   2e-51   
ref|XP_004233968.1|  PREDICTED: probable polyol transporter 6           183   2e-51   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           183   2e-51   
gb|EMT00465.1|  Putative polyol transporter 1                           183   2e-51   
emb|CBI17542.3|  unnamed protein product                                182   2e-51   
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          183   3e-51   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           183   3e-51   
ref|NP_001132062.1|  proton myo-inositol cotransporter                  183   3e-51   
gb|ACG35144.1|  proton myo-inositol cotransporter                       183   3e-51   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             183   3e-51   
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             182   3e-51   
ref|XP_007132713.1|  hypothetical protein PHAVU_011G118500g             183   3e-51   
gb|EAY83298.1|  hypothetical protein OsI_38507                          182   4e-51   
ref|XP_003575479.1|  PREDICTED: polyol transporter 5-like               182   4e-51   
gb|EEE53303.1|  hypothetical protein OsJ_36274                          187   4e-51   
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           182   4e-51   
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           182   4e-51   
ref|XP_002310213.2|  mannitol transporter family protein                182   4e-51   
ref|XP_009356716.1|  PREDICTED: probable polyol transporter 6           182   5e-51   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    182   6e-51   
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    182   6e-51   
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g             182   7e-51   
ref|XP_004233514.1|  PREDICTED: probable polyol transporter 6           182   7e-51   
ref|XP_003527443.1|  PREDICTED: probable polyol transporter 4-like      182   7e-51   
ref|XP_010531022.1|  PREDICTED: probable polyol transporter 6           181   8e-51   
ref|XP_006346943.1|  PREDICTED: probable polyol transporter 6-like      181   8e-51   
emb|CDY35469.1|  BnaC03g61910D                                          181   1e-50   
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             181   1e-50   
ref|XP_002886176.1|  predicted protein                                  181   1e-50   
ref|XP_006347075.1|  PREDICTED: probable polyol transporter 4-lik...    181   1e-50   
ref|XP_004134957.1|  PREDICTED: probable polyol transporter 4-like      181   1e-50   
ref|XP_004148314.1|  PREDICTED: polyol transporter 5-like               181   2e-50   
gb|KJB54071.1|  hypothetical protein B456_009G019700                    181   2e-50   
ref|NP_179438.1|  putative polyol transporter 3                         181   2e-50   
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             181   2e-50   
tpg|DAA43975.1|  TPA: polyol transporter protein 4                      181   2e-50   
gb|KJB77296.1|  hypothetical protein B456_012G130400                    181   2e-50   
ref|XP_010049693.1|  PREDICTED: probable polyol transporter 6           182   2e-50   
ref|XP_008229167.1|  PREDICTED: probable polyol transporter 4           181   3e-50   
ref|XP_003616024.1|  hypothetical protein MTR_5g075300                  180   3e-50   
gb|EPS74022.1|  hypothetical protein M569_00722                         180   3e-50   
gb|ACG47895.1|  polyol transporter protein 4                            181   3e-50   
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    180   3e-50   
ref|XP_011025750.1|  PREDICTED: probable polyol transporter 3           180   3e-50   
ref|XP_007215837.1|  hypothetical protein PRUPE_ppa004119mg             181   3e-50   
ref|NP_001239704.1|  uncharacterized protein LOC100778511               180   4e-50   
ref|XP_003618299.1|  Mannitol transporter                               180   4e-50   
ref|XP_004514460.1|  PREDICTED: probable polyol transporter 4-like      180   4e-50   
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    180   4e-50   
ref|XP_003561393.1|  PREDICTED: probable polyol transporter 6           179   4e-50   
ref|XP_006664062.1|  PREDICTED: polyol transporter 5-like               179   5e-50   
gb|KFK40451.1|  hypothetical protein AALP_AA3G374800                    180   6e-50   
ref|XP_007160334.1|  hypothetical protein PHAVU_002G312900g             179   6e-50   
ref|XP_007149864.1|  hypothetical protein PHAVU_005G105000g             179   7e-50   
ref|XP_009408151.1|  PREDICTED: probable polyol transporter 4           179   7e-50   
ref|XP_006363185.1|  PREDICTED: probable polyol transporter 6-like      179   7e-50   
emb|CCC58382.1|  polyol/monosaccharide transporter 4                    179   7e-50   
emb|CDY72252.1|  BnaCnng76720D                                          178   8e-50   
ref|XP_010041832.1|  PREDICTED: polyol transporter 5-like               179   9e-50   
ref|XP_011096257.1|  PREDICTED: probable polyol transporter 4           179   1e-49   
emb|CAJ29288.1|  putative polyol transporter 1                          178   1e-49   
ref|XP_004166834.1|  PREDICTED: polyol transporter 5-like               179   1e-49   
ref|XP_010548339.1|  PREDICTED: probable polyol transporter 6           178   1e-49   
ref|XP_011460253.1|  PREDICTED: probable polyol transporter 4           179   1e-49   
dbj|BAO96231.1|  polyol/monosaccharide Transporter 8                    178   1e-49   
ref|XP_002519026.1|  sugar transporter, putative                        179   1e-49   
ref|XP_003630795.1|  Polyol transporter                                 178   1e-49   
emb|CBI28773.3|  unnamed protein product                                178   1e-49   
ref|NP_195385.1|  putative polyol transporter 6                         178   1e-49   
gb|KJB64902.1|  hypothetical protein B456_010G071500                    176   2e-49   
gb|KJB31705.1|  hypothetical protein B456_005G202400                    179   2e-49   
ref|XP_004983249.1|  PREDICTED: probable polyol transporter 3-like      178   2e-49   
ref|XP_002517946.1|  sugar transporter, putative                        178   2e-49   
ref|XP_003545891.1|  PREDICTED: probable polyol transporter 4-lik...    178   2e-49   
ref|XP_009109331.1|  PREDICTED: probable polyol transporter 6           178   2e-49   
emb|CDY24775.1|  BnaA08g15350D                                          178   2e-49   
ref|XP_004148313.1|  PREDICTED: polyol transporter 5-like               178   2e-49   
ref|XP_007025694.1|  Major facilitator superfamily protein              178   2e-49   
ref|XP_010686555.1|  PREDICTED: probable polyol transporter 4           178   2e-49   
ref|XP_003593550.1|  hypothetical protein MTR_2g013310                  178   2e-49   
ref|XP_004232838.1|  PREDICTED: probable polyol transporter 4 iso...    178   2e-49   
ref|XP_011100123.1|  PREDICTED: uncharacterized protein LOC105178355    182   2e-49   
ref|XP_008439885.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    177   3e-49   
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    177   3e-49   
emb|CAN66670.1|  hypothetical protein VITISV_017987                     177   3e-49   
ref|XP_004962896.1|  PREDICTED: polyol transporter 5-like               177   3e-49   
ref|XP_002263849.1|  PREDICTED: probable polyol transporter 4           177   4e-49   
gb|KHN08546.1|  Putative polyol transporter 4                           177   4e-49   
ref|XP_003543064.1|  PREDICTED: probable polyol transporter 4-lik...    177   4e-49   
ref|XP_004159155.1|  PREDICTED: polyol transporter 5-like               176   4e-49   
ref|XP_009624322.1|  PREDICTED: probable polyol transporter 4 iso...    177   4e-49   
ref|XP_009121193.1|  PREDICTED: probable polyol transporter 4           177   5e-49   
gb|EPS63014.1|  hypothetical protein M569_11773                         176   5e-49   
ref|XP_004503439.1|  PREDICTED: polyol transporter 5-like               177   5e-49   
ref|XP_009773456.1|  PREDICTED: probable polyol transporter 4 iso...    176   6e-49   
ref|XP_006827815.1|  hypothetical protein AMTR_s00009p00268230          177   6e-49   
ref|XP_004301902.2|  PREDICTED: probable polyol transporter 6           177   6e-49   
ref|XP_009773455.1|  PREDICTED: probable polyol transporter 4 iso...    177   6e-49   
gb|AFW56603.1|  hypothetical protein ZEAMMB73_309095                    168   7e-49   
ref|XP_008225034.1|  PREDICTED: probable polyol transporter 4           177   7e-49   
ref|XP_002866999.1|  hypothetical protein ARALYDRAFT_490969             176   8e-49   
ref|XP_007211557.1|  hypothetical protein PRUPE_ppa004144mg             177   8e-49   
ref|XP_002319907.2|  mannitol transporter family protein                176   1e-48   
ref|XP_006449296.1|  hypothetical protein CICLE_v10014943mg             176   1e-48   
ref|XP_010052344.1|  PREDICTED: probable polyol transporter 4 iso...    175   1e-48   
ref|XP_006297425.1|  hypothetical protein CARUB_v10013450mg             176   1e-48   
ref|NP_179671.2|  putative polyol transporter 4                         176   1e-48   
ref|XP_002886303.1|  hypothetical protein ARALYDRAFT_480914             176   1e-48   
ref|XP_011045507.1|  PREDICTED: probable polyol transporter 4           176   1e-48   
ref|XP_003548895.1|  PREDICTED: probable polyol transporter 3-like      175   2e-48   



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A S +P D GPP +PKRNKY+LAC+LLASMTSILLGYDTGVMSGA++YIKQDL +SDVQ+
Sbjct  13   AESSIP-DFGPPPRPKRNKYSLACALLASMTSILLGYDTGVMSGATLYIKQDLHVSDVQI  71

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L+GTINIYSLVGSA+AG+TSD++GRRYTIV+A  VFFVGA LMGFATNYAFLM GRFV
Sbjct  72   EILVGTINIYSLVGSAIAGKTSDMVGRRYTIVIAAVVFFVGAFLMGFATNYAFLMFGRFV  131

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AGIGVGYALMIAPVY+AEVAP S RGFLTSFPEVFINFGVLLG+V+NY FAK
Sbjct  132  AGIGVGYALMIAPVYTAEVAPSSSRGFLTSFPEVFINFGVLLGYVSNYFFAK  183



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   261 bits (668),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            A  S +P P ++   AD  PPKKPKRNK+ALAC++LASMTSILLGYD GVMSGA+IYIK 
Sbjct  6    ADSSTQPAPISNKTIADFDPPKKPKRNKFALACAILASMTSILLGYDIGVMSGAAIYIKD  65

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            +  +SD+QVE L+GT+N+YSLVGSA AGRTSD IGRRYTIVVAG +FFVGA+LMGFAT+Y
Sbjct  66   EFRLSDLQVEILVGTLNLYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATSY  125

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            AFLMVGRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+N++F+
Sbjct  126  AFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  185

Query  559  K  561
            K
Sbjct  186  K  186



>ref|XP_008350306.1| PREDICTED: putative polyol transporter 1, partial [Malus domestica]
Length=282

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PP+KPKRNKYA AC++LASMTSILLGYD GVMSGA+IYIK DL ISDV+VE L+G +
Sbjct  21   DFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEILLGIL  80

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GSA AGRTSD +GRRYTIV+AG +FFVGA+LMGFATNYAFLM GRFVAG+GVGY
Sbjct  81   NLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGVGVGY  140

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  141  ALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSK  185



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = +1

Query  34   KPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGIS  213
            +P  A  LL      P K KRNKYALA S+LASMTS+LLGYDTGVMSGA+IYIK+DL IS
Sbjct  18   EPTEARRLLSTT--SPTKHKRNKYALAISVLASMTSVLLGYDTGVMSGATIYIKRDLKIS  75

Query  214  DVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMV  393
            DVQ+E L+GTINIYSL+GSAVAGRTSD IGRRYTIV A  +FF GA+LMGFA NYAFLMV
Sbjct  76   DVQIEILVGTINIYSLLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMV  135

Query  394  GRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GRFVAGIGVGYALMIAPVY+AEVAP S RGFLTSFPEVFINFGVLLG+V+NY+FAK
Sbjct  136  GRFVAGIGVGYALMIAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNYAFAK  191



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 155/182 (85%), Gaps = 7/182 (4%)
 Frame = +1

Query  16   MASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIK  195
            MA H+  P PA         PP+KPKRNKYA+ACS LASMTSILLGYD GVMSGA IYI+
Sbjct  1    MADHTHLPIPA-------FDPPQKPKRNKYAMACSFLASMTSILLGYDIGVMSGAIIYIQ  53

Query  196  QDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATN  375
            +DL ISDVQ E ++G +N+YSL+GSA AGRTSD IGRRYTIV AG +FF GA+LMGFATN
Sbjct  54   KDLQISDVQKEVIMGILNVYSLLGSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATN  113

Query  376  YAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            YAFLMVGRFVAGIGVGYALMIAPVY+AEVAP S RGFLTSFPEVFINFG+LLG+V+N++F
Sbjct  114  YAFLMVGRFVAGIGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINFGILLGYVSNFAF  173

Query  556  AK  561
            +K
Sbjct  174  SK  175



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 158/185 (85%), Gaps = 3/185 (2%)
 Frame = +1

Query  13   LMASHSAKP--PPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASI  186
            L A     P   PA   L AD  PPKKPKRNK+ALAC+ LASMTSILLGYD GVMSGA+I
Sbjct  4    LNAERDVNPSSQPAEKTL-ADFDPPKKPKRNKFALACAALASMTSILLGYDIGVMSGAAI  62

Query  187  YIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGF  366
            YIK DL ISD QVE L+GT+NIYSLVGSA AGRTSD IGRRYTIVVAG +FFVGA+LMGF
Sbjct  63   YIKDDLKISDTQVEILVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGGIFFVGALLMGF  122

Query  367  ATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVAN  546
            ATNYAFLMVGRF+AGIGVGYA++IAPVY+AEV+P S RGFLTSFPEVFIN G+L+G+V+N
Sbjct  123  ATNYAFLMVGRFIAGIGVGYAVVIAPVYTAEVSPASSRGFLTSFPEVFINSGILIGYVSN  182

Query  547  YSFAK  561
            ++F+K
Sbjct  183  FAFSK  187



>gb|EYU42630.1| hypothetical protein MIMGU_mgv1a0059091mg, partial [Erythranthe 
guttata]
Length=189

 Score =   246 bits (627),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 3/183 (2%)
 Frame = +1

Query  22   SHSAKPPP--ATSLLP-ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYI  192
            +HS KP    A + LP     PPKKPKRN YALACS LASMTSILLGYD GVMSGA IYI
Sbjct  2    AHSGKPETNGAQTRLPIPGFDPPKKPKRNMYALACSFLASMTSILLGYDIGVMSGAIIYI  61

Query  193  KQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFAT  372
            +++ GI+ VQ E ++G +N+YSL+GSA AGRTSD IGRRYTIV+AG +FFVGA+LMGFAT
Sbjct  62   QEEFGITSVQKEVVMGILNVYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFAT  121

Query  373  NYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYS  552
            NYAFLMVGRFVAGIGVGYALMIAPVY+AEVAP S RGFL+SFPEVFINFG  LG+V+N++
Sbjct  122  NYAFLMVGRFVAGIGVGYALMIAPVYTAEVAPASSRGFLSSFPEVFINFGTQLGYVSNFA  181

Query  553  FAK  561
            F+K
Sbjct  182  FSK  184



>gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKKPK NK+ALAC++LASMTSILLGYD GVMSGA+IYIK DL ISD+QVE L+GT
Sbjct  26   ADFDPPKKPKSNKFALACAVLASMTSILLGYDIGVMSGAAIYIKDDLKISDLQVEVLVGT  85

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSLVGSA AGRTSD IGRRYTIVVAG +FFVGA+LMGFAT YAFLMVGRFVAGIGVG
Sbjct  86   LNIYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATTYAFLMVGRFVAGIGVG  145

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+N++F+K
Sbjct  146  YALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSK  191



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIY  255
            P K PKRNKYA ACSLLASMTS+LLGYDTGVMSGA IYIK+DL ISDVQ+E L+GTINIY
Sbjct  25   PCKNPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIY  84

Query  256  SLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALM  435
            SLVG+A+AGRTSD IGRRYTI+ A  +FF GA+LMGFATNY FLM GRFVAGIGVGYALM
Sbjct  85   SLVGAALAGRTSDWIGRRYTIIFASAIFFAGAILMGFATNYGFLMFGRFVAGIGVGYALM  144

Query  436  IAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            IAPVY+AEVAP S RGF TSFPEVFIN GVLLG+V+NY+F+K
Sbjct  145  IAPVYTAEVAPASCRGFFTSFPEVFINGGVLLGYVSNYAFSK  186



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            ++  PPKKPKRNKYA AC++LASMTSILLGYD GVMSGA+IYIK+DL ISDV++E L+G 
Sbjct  21   SEFDPPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDLKISDVEIEILLGI  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            IN+YSL+GSA AGRTSD IGRRYTIV+AG +FF GA+LMGFATNY FLMVGRFVAGIG+G
Sbjct  81   INVYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFTGAILMGFATNYVFLMVGRFVAGIGIG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  141  YALMIAPVYTAEVSPASSRGFLTSFPEVFVNIGILLGYVSNYAFSK  186



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 157/178 (88%), Gaps = 2/178 (1%)
 Frame = +1

Query  28   SAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLG  207
            S++P    +L  AD  P KKPKRNK+A AC++LASMTSILLGYD GVMSGA+IYIK++L 
Sbjct  13   SSQPSAEKTL--ADFDPQKKPKRNKFAFACAILASMTSILLGYDIGVMSGAAIYIKKNLK  70

Query  208  ISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFL  387
            ISD QVE L GT+NIYSLVGSA AGRTSD IGRRYTIV+AG +FFVGA+LMGFATNYAFL
Sbjct  71   ISDTQVEILAGTLNIYSLVGSAAAGRTSDWIGRRYTIVMAGGIFFVGALLMGFATNYAFL  130

Query  388  MVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            MVGRFVAG+GVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+N++F+K
Sbjct  131  MVGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSK  188



>gb|AAY86779.1| putative sugar transporter protein [Noccaea caerulescens]
Length=253

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +1

Query  37   PPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISD  216
            PPPAT  LP    PP KPKRNKYA AC++LASMTSILLGYD GVMSGA IYIK+DL  +D
Sbjct  14   PPPATKHLPESGPPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKCTD  73

Query  217  VQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVG  396
            +Q+  L G++NIYSLVGS  AGRTSD IGRRYTIV+AG +FF GA+LMGF+ NYAFLM G
Sbjct  74   LQIGILAGSLNIYSLVGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFSPNYAFLMFG  133

Query  397  RFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            RFVAG+GVGYALMIAPVY+AEVAP S RGFLTSFPEVFIN G++LG+V+N +F+K
Sbjct  134  RFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSK  188



>emb|CAD58710.1| polyol transporter [Plantago major]
Length=530

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            A  S KP  A+ L   D  P K   RNKYALA S+LASMTS+LLGYDTGVMSGA++YIK 
Sbjct  18   AGKSQKPDAASVL---DTLPKKPVTRNKYALAISILASMTSVLLGYDTGVMSGATLYIKD  74

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            DL ISDVQVE L+GTINIYSLVGSAVAGRTSD +GRRYT V A  VFFVGA+LMG ATNY
Sbjct  75   DLKISDVQVELLVGTINIYSLVGSAVAGRTSDWVGRRYTTVFASVVFFVGAILMGIATNY  134

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
             FLM GRFVAGIGVGYALMIAPVY+AEVAP S RGFLTSFPEVFINFGVLLGFV+NY+FA
Sbjct  135  VFLMAGRFVAGIGVGYALMIAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGFVSNYAFA  194

Query  559  K  561
            K
Sbjct  195  K  195



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KPKRNKYA AC++LASMTSILLGYD GVMSGA+IYIK DL ISDV+VE L+G 
Sbjct  20   ADFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLGI  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA AGRTSD +GRRYTIV+AG +FFVGA+LMGFATNY+FLM GRFVAGIGVG
Sbjct  80   LNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYSFLMFGRFVAGIGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  140  YALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSK  185



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            +D  PPKKPKRNKYA  C++LASMTSILLGYD GVMSGA+IYI++DL ISDVQ+E L+G 
Sbjct  21   SDFDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDVQIEILLGI  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL GSA AGRTSD IGRRYTIV+AG +FF GA+LMGFATNY FLMVGRFVAGIGVG
Sbjct  81   LNVYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYVFLMVGRFVAGIGVG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  141  YALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSK  186



>ref|XP_007200585.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01784.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=361

 Score =   248 bits (634),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 153/186 (82%), Gaps = 4/186 (2%)
 Frame = +1

Query  16   MASHSAKPPPATSLLP----ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGAS  183
            MA   A+     S  P    AD  PP KPKRNKYA AC++LASMTSILLGYD GVMSGA+
Sbjct  1    MADERAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  184  IYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMG  363
            IYIK+DL +SDV++E LIG +N+YSL+GSA AGRTSD IGRRYTIV+AG +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  364  FATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVA  543
            FA NYAFLM GRF+AGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+L G+V+
Sbjct  121  FAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVS  180

Query  544  NYSFAK  561
            NY F+K
Sbjct  181  NYGFSK  186



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PP+KPKRNKYA AC++LASMTSILLGYD GVMSGA+IYIK DL ISDV+VE L+G +
Sbjct  21   DFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLGIL  80

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GSA AGRTSD +GRRYTIV+AG +FFVGA+LMGFATNYAFLM GRFVAGIGVGY
Sbjct  81   NLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGVGY  140

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  141  ALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSK  185



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PP+KPKRNKYA AC++LASMTSILLGYD GVMSGA+IYIK DL ISDV+VE L+G +
Sbjct  21   DFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLGIL  80

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GSA AGRTSD +GRRYTIV+AG +FFVGA+LMGFATNYAFLM GRFVAGIGVGY
Sbjct  81   NLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGVGY  140

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  141  ALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSK  185



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            K PKRNKYALACSLLASMTSILLGYDTGVMSGA IYIK+DL ISDVQ+E L+GTINIYSL
Sbjct  10   KSPKRNKYALACSLLASMTSILLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIYSL  69

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            VG+A+AGRTSD IGRRYTI++A  +FFVGA+LMGFA NY FLM GRFVAGIGVGYALMIA
Sbjct  70   VGAAIAGRTSDWIGRRYTIILASLIFFVGAILMGFAPNYWFLMFGRFVAGIGVGYALMIA  129

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY+AEVAP S RGF TSFPEVFIN GVLLG+++NY+F+K
Sbjct  130  PVYTAEVAPASCRGFFTSFPEVFINGGVLLGYISNYAFSK  169



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            +D  PPKKPKRNKYA  C++LASMTSILLGYD GVMSGA+IYI++DL ISDV++E L+G 
Sbjct  22   SDFDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDVEIEILLGI  81

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            IN+YSL GSA AGRTSD IGRRYTIV+AG +FF GA+LMGF+TNYAFLMVGRFVAGIG+G
Sbjct  82   INVYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFSTNYAFLMVGRFVAGIGIG  141

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  142  YALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSK  187



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKKPKRNKYALACS LASMTS+LLGYD GVMSGA+IYIK+D  +SDV+VE L+G 
Sbjct  21   ADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAAIYIKRDFKLSDVKVEILVGI  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA AGRTSD IGRR TIV A  +FF GA+LMGF+TNYAFLMVGRFVAG+GVG
Sbjct  81   LNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMGFSTNYAFLMVGRFVAGVGVG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY F+K
Sbjct  141  YALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSK  186



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKKPKRNKYALACS LASMTS+LLGYD GVMSGA+IYIK+D  +SDV+VE L+G 
Sbjct  21   ADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAAIYIKRDFKLSDVKVEILVGI  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA AGRTSD IGRR TIV A  +FF GA+LMGF+TNYAFLMVGRFVAG+GVG
Sbjct  81   LNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMGFSTNYAFLMVGRFVAGVGVG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY F+K
Sbjct  141  YALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSK  186



>emb|CAD58709.1| polyol transporter [Plantago major]
 emb|CAR82415.1| polyol transporter [Plantago major]
Length=529

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = +1

Query  79   PKKP-KRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIY  255
            PKKP KRNKYALA S+LASMTS+LLGYD GVMSGA+ +I++DL I+DVQVE L+GTINIY
Sbjct  33   PKKPLKRNKYALAISILASMTSVLLGYDCGVMSGATQFIQEDLIITDVQVELLVGTINIY  92

Query  256  SLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALM  435
            SLVGSAVAGRTSD +GRRYTIV A  +FF+GA+LMGFATNYAFLMVGRFVAGIGVGYALM
Sbjct  93   SLVGSAVAGRTSDWVGRRYTIVFASTIFFLGAILMGFATNYAFLMVGRFVAGIGVGYALM  152

Query  436  IAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            IAPVY+AEVAP S RGFLTSFPEVFINFGVLLG+V+N++FAK
Sbjct  153  IAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNFAFAK  194



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PP+KPKRNKYA AC++LASMTSILLGYD GVMSGA+IYIK DL I+DV+VE L+G +
Sbjct  21   DFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKITDVEVEVLLGIL  80

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GSA AGRTSD +GRRYTIV+AG +FFVGA+LMGFATNYAFLM GRFVAGIGVGY
Sbjct  81   NLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGVGY  140

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  141  ALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSK  185



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = +1

Query  43   PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            PA     AD  P KKPKRNK+A AC++LASMTS+LLGYD GVMSGA+IYI+ DL ISD+Q
Sbjct  16   PALDRTLADFDPVKKPKRNKFAFACAILASMTSVLLGYDIGVMSGANIYIQDDLKISDLQ  75

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            V  L+GT+N+YSLVGSA AGRTSD IGRRYTIV+AG +FF+G++LMGFATNYAFLMVGRF
Sbjct  76   VALLVGTLNLYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSILMGFATNYAFLMVGRF  135

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VAG+GVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  136  VAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSK  188



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            ++  PPKKPKRNKYALAC+ LASMTSILLGYD GVMSGA IYI++D+ ++DVQ E ++G 
Sbjct  17   SEFDPPKKPKRNKYALACAFLASMTSILLGYDIGVMSGAIIYIRRDIRMTDVQQEVIMGI  76

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA+AGRTSD +GRRYTI++AG +FF GA+LMGFATNYAFLMVGRFVAGIGVG
Sbjct  77   LNLYSLIGSALAGRTSDWLGRRYTIILAGAIFFFGALLMGFATNYAFLMVGRFVAGIGVG  136

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEVAP S RGFLTSFPEVFINFG+LLG+V+NY F+K
Sbjct  137  YALMIAPVYTAEVAPASSRGFLTSFPEVFINFGILLGYVSNYGFSK  182



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 155/182 (85%), Gaps = 2/182 (1%)
 Frame = +1

Query  16   MASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIK  195
            +AS++ +P   TS+   D  PPKKPKRNKYA+ACS LAS+ SILLGYD GVMSGA IYIK
Sbjct  6    LASNNGQPQIVTSI--QDFDPPKKPKRNKYAIACSFLASLASILLGYDIGVMSGAIIYIK  63

Query  196  QDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATN  375
            +DL I+D QVE L+G +NIYSL GSA AGRTSD IGRRYT+VVA  +FF GA+LMGFAT 
Sbjct  64   KDLHITDTQVEILVGILNIYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLMGFATT  123

Query  376  YAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            YAFLMVGRFVAG+GVGYALM+APVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+N++F
Sbjct  124  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAF  183

Query  556  AK  561
            ++
Sbjct  184  SR  185



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            ++   PKKPKRNKYA AC++LASMTSILLGYD GVMSGA+IYIK+DL ISDV++E L+G 
Sbjct  21   SEFDSPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDLKISDVEIEILLGI  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            IN+YSL+GSA AGRTSD IGRRYTIV+AG +FF GA+LMGFATNY FLMVGRFVAGIG+G
Sbjct  81   INVYSLIGSAAAGRTSDRIGRRYTIVLAGAIFFTGALLMGFATNYVFLMVGRFVAGIGIG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  141  YALMIAPVYTAEVSPASSRGFLTSFPEVFVNIGILLGYVSNYAFSK  186



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 151/176 (86%), Gaps = 4/176 (2%)
 Frame = +1

Query  34   KPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGIS  213
            +P  A  LL      P K KRNKYALA S+LASMTS+LLGY  GVMSGA+IYIK+DL IS
Sbjct  18   EPTEARRLLSTT--SPTKHKRNKYALAISVLASMTSVLLGY--GVMSGATIYIKRDLKIS  73

Query  214  DVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMV  393
            DVQ+E L+GTINIYSL+GSAVAGRTSD IGRRYTIV A  +FF GA+LMGFA NYAFLMV
Sbjct  74   DVQIEILVGTINIYSLLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMV  133

Query  394  GRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GRFVAGIGVGYALMIAPVY+AEVAP S RGFLTSFPEVFINFGVLLG+V+NY+FAK
Sbjct  134  GRFVAGIGVGYALMIAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNYAFAK  189



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  76   PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIY  255
            P KKPKRNKYA ACSLLASMTS+LLGYDTGVMSGA IYIK+DL ISDV +E L+GTINIY
Sbjct  21   PLKKPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVAIEVLVGTINIY  80

Query  256  SLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALM  435
            SLVG+A+AGRTSD IGRRYTI++A  +F VGA+LMGFA NY FLM GRFVAGIGVGYALM
Sbjct  81   SLVGAAIAGRTSDWIGRRYTIILASGIFLVGALLMGFAPNYWFLMFGRFVAGIGVGYALM  140

Query  436  IAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            IAPVY+AEVAP S RGF TSFPEVFIN GVLLG++ANY+F+
Sbjct  141  IAPVYTAEVAPASCRGFCTSFPEVFINAGVLLGYIANYAFS  181



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PP+KPKRNKYA AC++LASMTSILLG D GVMSGA+IYIK DL ISDV+VE L+G +
Sbjct  21   DFDPPQKPKRNKYAFACAILASMTSILLGLDIGVMSGAAIYIKDDLKISDVEVEILLGIL  80

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GSA AGRTSD +GRRYTIV+AG +FFVGA+LMGFATNYAFLM GRFVAG+GVGY
Sbjct  81   NLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGVGVGY  140

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  141  ALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSK  185



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = +1

Query  43   PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            PA     AD  P KKPKRNK+A AC+ +ASMTS+LLGYD GVMSGA+IYI+ DL I+D+Q
Sbjct  16   PALDRKLADFDPAKKPKRNKFAFACASIASMTSVLLGYDIGVMSGANIYIQDDLKINDLQ  75

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            V  L+GT+NIYSLVGSA AGRTSD IGRRYTIV+AG +FF+G+VLMGFATNYAFLMVGRF
Sbjct  76   VALLVGTLNIYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSVLMGFATNYAFLMVGRF  135

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VAG+GVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  136  VAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSK  188



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            +D  PPKK KRNKYA  C++LASMTSILLGYD GVMSGA+IYI++DL ISDVQ+E L+G 
Sbjct  21   SDFDPPKKLKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDVQIEILLGI  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL GSA AGRTSD IGRRYTIV+AG +FF GA+LMGFATNY FLMVGRFVAGIGVG
Sbjct  81   LNVYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYVFLMVGRFVAGIGVG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  141  YALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSK  186



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPK PKRNKYA AC++LASMTS+LLGYD GVMSGA IYIK+DL  SD Q++ L+G 
Sbjct  19   ADFDPPKAPKRNKYAFACAMLASMTSVLLGYDIGVMSGAQIYIKRDLHCSDNQIQILVGI  78

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSLVGSA AGRTSD IGRRYTIV+AG +FF GA+LMGFATNYAFLM GRFVAGIGVG
Sbjct  79   LNLYSLVGSAAAGRTSDWIGRRYTIVLAGVIFFTGAILMGFATNYAFLMFGRFVAGIGVG  138

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+N++F+K
Sbjct  139  YALMIAPVYTAEVSPASARGFLTSFPEVFINAGILLGYVSNFAFSK  184



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 153/186 (82%), Gaps = 4/186 (2%)
 Frame = +1

Query  16   MASHSAKPPPATSLLP----ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGAS  183
            MA   A+     S  P    AD  PP KPKRNKYA AC++LASMTSILLGYD GVMSGA+
Sbjct  1    MADRRAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  184  IYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMG  363
            IYIK+DL +SDV++E LIG +N+YSL+GSA AGRTSD IGRRYTIV+AG +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGGIFFAGALLMG  120

Query  364  FATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVA  543
            FA NYAFLM GRF+AGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+L G+V+
Sbjct  121  FAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVS  180

Query  544  NYSFAK  561
            NY F+K
Sbjct  181  NYGFSK  186



>emb|CDP17996.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D GPP K  +NKYALAC+LLA M+S+LLGYDTGVMSG  IYI++DL ISDVQ E L+GTI
Sbjct  19   DFGPPPKATKNKYALACALLACMSSVLLGYDTGVMSGGMIYIQRDLKISDVQKEVLVGTI  78

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GSA+AGRT D +GRRYTI +AG +FFVGA LM FATNYAFLMVGRFVAGIGVGY
Sbjct  79   NVYSLLGSAIAGRTCDWVGRRYTIAMAGVIFFVGAFLMAFATNYAFLMVGRFVAGIGVGY  138

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            A+MIAPVYSAE++P SIRGF+TSF EVFINFGVLLG+V+NY FAK
Sbjct  139  AMMIAPVYSAEISPRSIRGFITSFTEVFINFGVLLGYVSNYFFAK  183



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = +1

Query  28   SAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLG  207
            S+KP      L  D  P KKPKRNK+A AC++LAS+TSILLGYD GVMSGA IYIK DL 
Sbjct  12   SSKPVVDNKTL-GDFEPAKKPKRNKFAFACAILASLTSILLGYDIGVMSGAVIYIKDDLK  70

Query  208  ISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFL  387
            I+DVQVE L+G +N+Y LVGS  AGRTSD IGRRYTIV A  +FFVGA+LMGFATNYAFL
Sbjct  71   INDVQVEILVGILNLYCLVGSCAAGRTSDWIGRRYTIVFACAIFFVGALLMGFATNYAFL  130

Query  388  MVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            MVGRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  131  MVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSK  188



>emb|CDP18000.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  25   HSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDL  204
            H+        L   D  PP KPKRNKYALAC+LLA M+S+LLGYDTGVMSGA IYI++DL
Sbjct  5    HNQAITRGVGLSNPDSVPPPKPKRNKYALACALLACMSSVLLGYDTGVMSGAMIYIQRDL  64

Query  205  GISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAF  384
             I+DVQ E L+GTIN+YSL+GSA+AGRT D IGRRYTI +AG +FF GA+LM  ATNYAF
Sbjct  65   KINDVQKEILVGTINVYSLLGSAIAGRTCDWIGRRYTIAMAGVIFFAGAILMACATNYAF  124

Query  385  LMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            LM GRFVAG+GVGYALMIAPVYSAE++P SIRGF+TSF EVFINFGVLLG+V+NY FAK
Sbjct  125  LMFGRFVAGLGVGYALMIAPVYSAEISPRSIRGFITSFTEVFINFGVLLGYVSNYFFAK  183



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP KPKRNKYA AC++LASMTSILLGYD GVMSGA IYIK+DL +SDV++E L+G 
Sbjct  21   ADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAVIYIKKDLKVSDVEIEVLVGI  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA AGRTSD IGRRYTIV+AG +FF GA+LMGFA NYAFLM GRFVAGIGVG
Sbjct  81   LNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIGVG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVFIN G+L G+V+NY F+K
Sbjct  141  YALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVSNYGFSK  186



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            A  +A     T    AD  P  KPKRNKYA AC++LASMTSILLGYD GVMSGA+I+IK 
Sbjct  6    AEENAVSGQPTQKAIADFDPAPKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIFIKD  65

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            DL ISDVQVE L+G +N+YSL+GSA AGRTSD IGRRYTIV+AG +FF GA+LMGFATNY
Sbjct  66   DLKISDVQVEVLMGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNY  125

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            +FLM GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++N++F+
Sbjct  126  SFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNWAFS  185

Query  559  K  561
            +
Sbjct  186  E  186



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPK+P++N +A+AC++LASMTSILLGYD GVMSGA I+IK+DL ISDV+VE L G 
Sbjct  20   ADFDPPKRPRKNIFAIACAVLASMTSILLGYDIGVMSGAVIFIKEDLKISDVKVEILTGI  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA AGRTSD IGRRYTIV+AG +FF GA+LMGFATNYAFLM GRFVAGIGVG
Sbjct  80   LNLYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMFGRFVAGIGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  140  YALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSK  185



>gb|EYU20732.1| hypothetical protein MIMGU_mgv1a026176mg [Erythranthe guttata]
Length=509

 Score =   245 bits (626),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKK K NKYAL  S+LASMTSILLGYDTGVMSGA++YIK+DL ISDVQ+E L+G+INIY+
Sbjct  12   PKKQKINKYALCISILASMTSILLGYDTGVMSGATVYIKKDLKISDVQIEILVGSINIYA  71

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            LVG+AVAGRTSD IGRR TI+ A  +FF GA+LMGFATNY+FLMVGRFVAG+G+GYALMI
Sbjct  72   LVGAAVAGRTSDWIGRRCTIIFAAAIFFAGAILMGFATNYSFLMVGRFVAGVGMGYALMI  131

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+ EVAP S RGFLTSFPEVFINFGVLLG+V+NY+FAK
Sbjct  132  APVYATEVAPPSSRGFLTSFPEVFINFGVLLGYVSNYAFAK  172



>gb|KCW55335.1| hypothetical protein EUGRSUZ_I01255 [Eucalyptus grandis]
Length=467

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 155/189 (82%), Gaps = 7/189 (4%)
 Frame = +1

Query  16   MASHSAKPPPATSLLPADL-------GPPKKPKRNKYALACSLLASMTSILLGYDTGVMS  174
            MA H A   P +++LP +         P K+P RNKYA AC++LASMTSILLGYD GVMS
Sbjct  1    MAEHKAMSDPKSNVLPREKSLVEDVEAPKKRPPRNKYAFACAILASMTSILLGYDIGVMS  60

Query  175  GASIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgav  354
            GA+I IK+ L ++DV+VE L+G IN+YSL+GSAVAGRTSD +GRRYT+V+AG +FFVGA+
Sbjct  61   GAAIPIKKQLHLNDVEVEVLVGIINLYSLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAI  120

Query  355  LMGFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLG  534
            LM FA NYAFLM GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFGVLLG
Sbjct  121  LMAFAFNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGVLLG  180

Query  535  FVANYSFAK  561
            +V+NY F K
Sbjct  181  YVSNYVFNK  189



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PPKK KRNKYA AC++LASMTSILLGYD GVMSGA++YIK+DL +SDVQ+E L+G I
Sbjct  18   DFDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKVSDVQIEILLGII  77

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GS +AGRTSD IGRRYTIV AG +FFVGA+LMGF+ NY+FLM GRFVAGIG+GY
Sbjct  78   NLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFGRFVAGIGIGY  137

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++NY F+K
Sbjct  138  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSK  182



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PPKK KRNKYA AC++LASMTSILLGYD GVMSGA++YIK+DL +SDVQ+E L+G I
Sbjct  18   DFDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKVSDVQIEILLGII  77

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GS +AGRTSD IGRRYTIV AG +FFVGA+LMGF+ NY+FLM GRFVAGIG+GY
Sbjct  78   NLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFGRFVAGIGIGY  137

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++NY F+K
Sbjct  138  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSK  182



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = +1

Query  40   PPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDV  219
            P  TS+   D+ PPKKPK +K+A+AC+LLA  TS+LLGYD GVMSGAS++IK++L ISDV
Sbjct  15   PQNTSI--EDIDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGASLFIKENLKISDV  72

Query  220  QVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGR  399
            QVE L GT+NIYSL+GSA AGRTSD IGR+YTIV+AG +F VGA+LMGFATNYAFLMVGR
Sbjct  73   QVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMGFATNYAFLMVGR  132

Query  400  FVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            FVAG+GVGY +MIAPVY+AE++P S RGFLTSFPEVF+N G+LLG++ANY+F+K
Sbjct  133  FVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFSK  186



>ref|XP_009780685.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=174

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIY  255
            P KK KRNKYA ACSLLASMTS+LLGYDTGVMSGA IYIK+DL ISDVQ+E L+GTINIY
Sbjct  25   PCKKSKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIY  84

Query  256  SLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALM  435
            SLVG+A+AGRTSD IGRRYTI+ A  +FF GA+LMGFATNY FLM GRFVAGIGVGYALM
Sbjct  85   SLVGAALAGRTSDWIGRRYTIIFASAIFFAGAILMGFATNYGFLMFGRFVAGIGVGYALM  144

Query  436  IAPVYSAEVAPESIRGFLTSFPEVFINFG  522
            IAPVY+AEVAP S RGF TSFPEVFIN G
Sbjct  145  IAPVYTAEVAPASCRGFFTSFPEVFINGG  173



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KPKRNKYA AC++LASMTSIL+GYD GVMSGASIYI++DL ++D Q+E +IG 
Sbjct  20   ADFDPPQKPKRNKYAFACAILASMTSILMGYDIGVMSGASIYIEKDLKVTDTQIEIMIGV  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            I IYSL+GSA+AG+TSD +GRRYTIV++G +FF+GA+LMGF+TNY FLM GRFVAGIGVG
Sbjct  80   IEIYSLIGSAMAGKTSDWVGRRYTIVISGAIFFIGAILMGFSTNYTFLMCGRFVAGIGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            YAL IAPVYSAEV+P S RGFLTSFPEVF+N G+LLG+++NY+F+
Sbjct  140  YALTIAPVYSAEVSPTSSRGFLTSFPEVFVNIGILLGYLSNYAFS  184



>emb|CAR82416.1| polyol transporter [Plantago major]
Length=181

 Score =   233 bits (595),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 139/167 (83%), Gaps = 3/167 (2%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            A  S KP  A+ L   D  P K   RNKYALA S+LASMTS+LLGYDTGVMSGA++YIK 
Sbjct  18   AGKSQKPDAASVL---DTLPKKPVTRNKYALAISILASMTSVLLGYDTGVMSGATLYIKD  74

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            DL ISDVQVE L+GTINIYSLVGSAVAGRTSD +GRRYTIV A  VFFVGA+LMG ATNY
Sbjct  75   DLKISDVQVELLVGTINIYSLVGSAVAGRTSDWVGRRYTIVFASVVFFVGAILMGIATNY  134

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINF  519
             FLM GRFVAGIGVGYALMIAPVY+AEVAP S RGFLTSFPEVFINF
Sbjct  135  VFLMAGRFVAGIGVGYALMIAPVYAAEVAPASCRGFLTSFPEVFINF  181



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PPKK KRNKYA AC++LASMTSILLGYD GVMSGA+IYIK+DL +SD Q+E L+G I
Sbjct  18   DFDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDEQIEILLGII  77

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GS +AGRTSD IGRRYTIV AG +FFVGA+LMGF+ NY+FLM GRFVAGIG+GY
Sbjct  78   NLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFGRFVAGIGIGY  137

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+L+G+++NY+F+K
Sbjct  138  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILIGYISNYAFSK  182



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP KPK  K+A+AC++LASMTSILLGYD GVMSGAS++IK++L ISDVQVE L GT
Sbjct  20   ADFDPPTKPKTKKFAVACAVLASMTSILLGYDIGVMSGASLFIKENLNISDVQVEVLNGT  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AG+TSD IGRRYTIV+AG +FF+GA+LMGFA NYAFLM GRF+AG+GVG
Sbjct  80   LNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V+N++FAK
Sbjct  140  YALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFAFAK  185



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PPKKPK NKYA+AC+ LAS++SILLGYD GVMSGA IYIK+DL I+DVQVE L+G +
Sbjct  40   DFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAIIYIKKDLHITDVQVEILVGIL  99

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL GSA AGRTSD IGRRYT+VVA  +FF GA+LMGFAT YAFLM GRFVAG+GVGY
Sbjct  100  NVYSLFGSAAAGRTSDWIGRRYTMVVAAGIFFAGALLMGFATTYAFLMFGRFVAGVGVGY  159

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALM+APVY+AEV+P S RGFLTSFPEVFINFG+L+G+V+N +F+K
Sbjct  160  ALMVAPVYTAEVSPASSRGFLTSFPEVFINFGILMGYVSNVAFSK  204



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKK K  K+A+AC +LASMTSILLGYD GVMSGAS++IK++L ISDVQVE L GT
Sbjct  23   ADFDPPKKAKTKKFAIACGVLASMTSILLGYDIGVMSGASLFIKENLKISDVQVEILNGT  82

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA+AGRTSD IGRRYTIV+AG +FF+GA+LMGFA NYAFLM GRFVAG+GVG
Sbjct  83   LNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGALLMGFAPNYAFLMFGRFVAGVGVG  142

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  143  YALMIAPVYTAEISPASYRGFLTSFPEVFVNIGILLGYVSNYAFSK  188



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 150/175 (86%), Gaps = 1/175 (1%)
 Frame = +1

Query  37   PPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISD  216
            P PAT  +P +LGPP KPKRNKYA AC++LASMTSILLGYD GVMSGA IYI++DL I+D
Sbjct  14   PAPATKHVP-ELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIQRDLKITD  72

Query  217  VQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVG  396
            +QV  L G +NIYSL+GS  AG+TSD IGRRYTIV+AG +FF GA+LMGFA NYAFLM G
Sbjct  73   IQVGILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFG  132

Query  397  RFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            RFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G++LG+V+N +F+ 
Sbjct  133  RFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSN  187



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            A  + +P  +T     D  P  KPKRN+YA AC++LASMTSILLGYD GVMSGA+I+IK 
Sbjct  6    AEENGQPTQSTKKAIEDFDPAPKPKRNRYAFACAMLASMTSILLGYDIGVMSGAAIFIKD  65

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            DL ISDVQVE L+G +N+YSL+GSA AGRTSD IGRRYTIV+AG +FF GA+LMGFATNY
Sbjct  66   DLKISDVQVEVLVGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNY  125

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            +FLM GRFVAGIGVGYALMIAPVY+ EV+P S RGFLTSF ++FIN G+LLG+++N++F+
Sbjct  126  SFLMFGRFVAGIGVGYALMIAPVYTVEVSPASSRGFLTSFADMFINAGILLGYISNWAFS  185

Query  559  K  561
            K
Sbjct  186  K  186



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PPKKPK NKYA+ACS LAS+ SILLGYD GVMSGA IYI++DL I+D+QVE L+G +
Sbjct  23   DFDPPKKPKTNKYAIACSFLASLASILLGYDIGVMSGAIIYIQKDLHITDIQVEILVGIL  82

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL GSA AGRTSD IGRRYT+VVA  +FF GA+LMGFAT YAFLMVGRFVAG+GVGY
Sbjct  83   NVYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLMGFATTYAFLMVGRFVAGVGVGY  142

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALM+APVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+N++F++
Sbjct  143  ALMVAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSR  187



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            KKPKRN YA+ C++LASMTSILLGYD GVMSGASIYI++DL ISDV+VE LIG +N+YSL
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQEDLKISDVEVEILIGILNLYSL  78

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GSA AGRTSD IGRRYTIV AG +FF GA+LMGFATNYAFLMVGRFVAGIGVGYALMIA
Sbjct  79   IGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNYAFLMVGRFVAGIGVGYALMIA  138

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            PVY+AEV+P S RG LTSFPEVF+N G+LLG+VANY+F+
Sbjct  139  PVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIY  255
            PPKKPKRNKYA+ACS LAS+ SILLGYD GVMSGA IYIK+DL I+DVQVE L G +N+Y
Sbjct  21   PPKKPKRNKYAVACSFLASLASILLGYDIGVMSGAIIYIKKDLNINDVQVEILAGILNLY  80

Query  256  SLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALM  435
            SL+GSA AGRTSD IGRR T+VVA  +FFVGA+LMGFATNYAFLM GRFVAGIGVGYALM
Sbjct  81   SLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGALLMGFATNYAFLMFGRFVAGIGVGYALM  140

Query  436  IAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            IAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+N++F+K
Sbjct  141  IAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSK  182



>ref|XP_010028575.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=544

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 155/189 (82%), Gaps = 7/189 (4%)
 Frame = +1

Query  16   MASHSAKPPPATSLLPADL-------GPPKKPKRNKYALACSLLASMTSILLGYDTGVMS  174
            MA H A   P +++LP +         P K+P RNKYA AC++LASMTSILLGYD GVMS
Sbjct  1    MAEHKAMSDPKSNVLPREKSLVEDVEAPKKRPPRNKYAFACAILASMTSILLGYDIGVMS  60

Query  175  GASIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgav  354
            GA+I IK+ L ++DV+VE L+G IN+YSL+GSAVAGRTSD +GRRYT+V+AG +FFVGA+
Sbjct  61   GAAIPIKKQLHLNDVEVEVLVGIINLYSLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAI  120

Query  355  LMGFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLG  534
            LM FA NYAFLM GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFGVLLG
Sbjct  121  LMAFAFNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGVLLG  180

Query  535  FVANYSFAK  561
            +V+NY F K
Sbjct  181  YVSNYVFNK  189



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   243 bits (619),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 158/188 (84%), Gaps = 8/188 (4%)
 Frame = +1

Query  16   MASHSAKP------PPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSG  177
            MA+ +A+       P  TS+   D   PKKPK +K+A+AC+LLA  TSILLG+D GVMSG
Sbjct  1    MAARTAEENAVTGGPQNTSI--EDFDHPKKPKTSKFAIACALLACTTSILLGFDIGVMSG  58

Query  178  ASIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavL  357
            AS++IK++L ISDVQVE L GT+NIYSL+GSA+AGRTSD IGR+YTIV+AG +F VGA+L
Sbjct  59   ASLFIKENLKISDVQVEVLAGTLNIYSLLGSALAGRTSDWIGRKYTIVLAGVIFLVGALL  118

Query  358  MGFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGF  537
            MGFATNYAFLMVGRFVAG+GVGY +MIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+
Sbjct  119  MGFATNYAFLMVGRFVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGY  178

Query  538  VANYSFAK  561
            +ANY+FAK
Sbjct  179  IANYAFAK  186



>ref|XP_008791366.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=507

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKKP RNKYALAC+ LASMTSILLGYD  VMSGAS++IK+DL I+D Q+E L G INI+S
Sbjct  4    PKKPPRNKYALACATLASMTSILLGYDIAVMSGASVFIKKDLKINDTQIEILAGIINIFS  63

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            LVGS  AGRTSD IGRRYTI+ A  +FF GA+LMGFATNYAFLMVGRF+AG+GVGYALMI
Sbjct  64   LVGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGFATNYAFLMVGRFIAGVGVGYALMI  123

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFLTSFPEVFIN GVLLG+V+N++FAK
Sbjct  124  APVYTAEVAPTSSRGFLTSFPEVFINSGVLLGYVSNFAFAK  164



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   243 bits (619),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 151/174 (87%), Gaps = 2/174 (1%)
 Frame = +1

Query  40   PPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDV  219
            P  TS+   D  PPKKPK +K+A+AC+LLA  TS+LLGYD GVMSGAS++IK++L ISDV
Sbjct  15   PQNTSI--EDFDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGASLFIKENLKISDV  72

Query  220  QVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGR  399
            QVE L GT+NIYSL+GSA AGRTSD IGR+YTIV+AG +F VGA+LMGFATNYAFLM GR
Sbjct  73   QVEILAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMGFATNYAFLMFGR  132

Query  400  FVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            FVAG+GVGY +MIAPVY+AE++P S RGFLTSFPEVF+N G+LLG++ANY+F+K
Sbjct  133  FVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFSK  186



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   243 bits (619),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = +1

Query  37   PPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISD  216
            P   T  +P +LGPP KPKRNKYA AC++LASMTSILLGYD GVMSGA IYIK+DL ISD
Sbjct  14   PAQGTKHVP-ELGPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISD  72

Query  217  VQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVG  396
            +Q+  L G +NIYSL+GS  AG+TSD IGRRYTIV+AG +FF GA+LMGFA NYAFLM G
Sbjct  73   LQIGILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFG  132

Query  397  RFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            RFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G++LG+V+N +F+K
Sbjct  133  RFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSK  187



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  P KKPKRN YA AC++LASMTSILLGYD GVMSGA+IYI++DL +SDVQ+E L+G I
Sbjct  17   DFDPQKKPKRNMYAFACAMLASMTSILLGYDIGVMSGAAIYIQRDLKVSDVQIEILLGII  76

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            NIYSL+GS +AGRTSD IGRRYTIV AG +FF GA+LMGF+ NY+FLM GRFVAG+G+GY
Sbjct  77   NIYSLIGSCLAGRTSDWIGRRYTIVFAGVIFFAGALLMGFSPNYSFLMFGRFVAGVGIGY  136

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+L+G+++NY+F+K
Sbjct  137  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILVGYISNYAFSK  181



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PPKKPK NKYA+AC+ LAS++SILLGYD GVMSGA +YIK+DL I+DVQVE L+G +
Sbjct  14   DFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAILYIKKDLHITDVQVEILVGIL  73

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL GSA AGRTSD IGRRYT+VVA  +FF GA+LMGFAT YAFLM GRFVAG+GVGY
Sbjct  74   NVYSLFGSAAAGRTSDWIGRRYTMVVAAGIFFAGALLMGFATTYAFLMFGRFVAGVGVGY  133

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALM+APVY+AEV+P S RGFLTSFPEVFINFG+L+G+V+N  F+K
Sbjct  134  ALMVAPVYTAEVSPASSRGFLTSFPEVFINFGILMGYVSNVVFSK  178



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIY  255
            PPKKPKRNKYA ACS LAS+ SILLGYD GVMSGA IYIK+DL I+DVQVE L G +N+Y
Sbjct  21   PPKKPKRNKYATACSFLASLASILLGYDIGVMSGAIIYIKKDLNINDVQVEILAGILNLY  80

Query  256  SLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALM  435
            SL+GSA AGRTSD IGRR T+VVA  +FFVGA+LMGFATNYAFLM GRFVAGIGVGYALM
Sbjct  81   SLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGAILMGFATNYAFLMFGRFVAGIGVGYALM  140

Query  436  IAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            IAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+N++F+K
Sbjct  141  IAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSK  182



>ref|XP_003539021.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=312

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = +1

Query  52   SLLPADLGPP-KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVE  228
            ++L  D  PP KKPKRN YA AC++LA+ TSILLGYD GVMSGA+IYIK+DL +SDVQ+E
Sbjct  15   TILDEDFDPPIKKPKRNTYAFACAMLATTTSILLGYDIGVMSGAAIYIKKDLKVSDVQIE  74

Query  229  FLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVA  408
             LIG  N+YSL+GS +AGRTSD IGRRYTIV AG +FF GA+LMGF+ NYAFLM GRFVA
Sbjct  75   ILIGIFNLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFAGAILMGFSPNYAFLMFGRFVA  134

Query  409  GIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GIG+GY LMIAPVY++EV+P S RGFLTSF EVFIN G+LLG+++NY+F+K
Sbjct  135  GIGMGYGLMIAPVYTSEVSPASSRGFLTSFTEVFINVGILLGYISNYAFSK  185



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKK K  K+A+AC +LASMTSILLGYD GVMSGAS++IK++L ISDVQVE L GT
Sbjct  23   ADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGASLFIKENLKISDVQVEILNGT  82

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA+AGRTSD IGRRYTIV+AG +FF+GA+LMG A NYAFLM GRFVAG+GVG
Sbjct  83   LNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMGLAPNYAFLMFGRFVAGVGVG  142

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  143  YALMIAPVYTAEISPASFRGFLTSFPEVFVNIGILLGYVSNYAFSK  188



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = +1

Query  31   AKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGI  210
            + PPP  +L    L  PKKP RNKYALAC+ LASMTSIL GYD  VMSGAS++I++DL I
Sbjct  12   SDPPPNQTL---ALEKPKKPPRNKYALACATLASMTSILSGYDVAVMSGASVFIQKDLEI  68

Query  211  SDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLM  390
            +D Q+E L G INI+SLVGS  AGRTSD IGRRYTI+ A  +FF GA+LMG ATNYAFLM
Sbjct  69   NDTQIEILAGIINIFSLVGSVAAGRTSDWIGRRYTIIFAAAIFFAGALLMGLATNYAFLM  128

Query  391  VGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGRFVAG+GVGYALMIAPVY+AEVAP S RGFLTSFPEVFIN GVLLG+V+N++FAK
Sbjct  129  VGRFVAGVGVGYALMIAPVYTAEVAPTSSRGFLTSFPEVFINSGVLLGYVSNFAFAK  185



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  P KKPKRNKYA AC++LASMTSILLGYD GVMSGA+IYIK+DL +SD ++E L+G I
Sbjct  17   DFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDGKIEVLLGII  76

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            NIYSL+GS +AGRTSD IGRRYTIV AG +FFVGA+LMGF+ NY FLM GRFVAG+G+GY
Sbjct  77   NIYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYNFLMFGRFVAGVGIGY  136

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++NY+F+K
Sbjct  137  ALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYISNYAFSK  181



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +PA L PP+KPKRNKYA AC++LASMTSILLGYD GVMSGA+++IK DL ISDVQ+E L+
Sbjct  19   IPA-LDPPQKPKRNKYAFACAILASMTSILLGYDGGVMSGAALFIKDDLKISDVQLEVLM  77

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G +++YSL+G   AGRTSD +GRRYTIV+A  +FFVGA+LMGFATNYAFLMVGRFVAGIG
Sbjct  78   GIMSLYSLLGCYAAGRTSDWVGRRYTIVIAAAIFFVGAILMGFATNYAFLMVGRFVAGIG  137

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGYAL+IAPVY+AEV+P + RGFLTSFPEVFIN GVLLG+V+NY+F+K
Sbjct  138  VGYALLIAPVYTAEVSPAASRGFLTSFPEVFINAGVLLGYVSNYAFSK  185



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKK K  K+A+AC +LASMTSILLGYD GVMSGAS++IK++L ISDVQVE L GT
Sbjct  23   ADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGASLFIKENLKISDVQVEILNGT  82

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA+AGRTSD IGRRYTIV+AG +FF+GA+LMG A NYAFLM GRFVAG+GVG
Sbjct  83   LNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMGLAPNYAFLMFGRFVAGVGVG  142

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  143  YALMIAPVYTAEISPASFRGFLTSFPEVFVNIGILLGYVSNYAFSK  188



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PP +P+RNKYA+AC+ LAS TSILLGYD GVMSGA IYIK+DL ISDV+VE L G +
Sbjct  26   DFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKKDLKISDVEVEILTGIL  85

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
             +YSL+GSA+AGRTSD IGRRYTIV+AG +FF GA+LMGFA NYAFLM GRFVAGIGVGY
Sbjct  86   AVYSLLGSAMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIGVGY  145

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++NY+F+K
Sbjct  146  ALMIAPVYTAEVSPASTRGFLTSFPEVFINIGILLGYISNYAFSK  190



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = +1

Query  28   SAKPPPATSLLPADLGPP-KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDL  204
            S +P  A +   AD  P  KKPKRNK+A AC++LAS+TSILLGYD GVMSGA IYI++DL
Sbjct  12   STRPVMADNRSFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQEDL  71

Query  205  GISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAF  384
             I+DVQ E L+G +N+YSLVGS  AGRTSD +GRRYTIV+AG +FF+GA+LMGFAT+YAF
Sbjct  72   KINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYAF  131

Query  385  LMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            LMVGRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  132  LMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSK  190



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = +1

Query  28   SAKPPPATSLLPADLGPP-KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDL  204
            S +P  A +   AD  P  KKPKRNK+A AC++LAS+TSILLGYD GVMSGA IYI++DL
Sbjct  12   STRPVMADNRNFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQEDL  71

Query  205  GISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAF  384
             I+DVQ E L+G +N+YSLVGS  AGRTSD +GRRYTIV+AG +FF+GA+LMGFAT+YAF
Sbjct  72   KINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYAF  131

Query  385  LMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            LMVGRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  132  LMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSK  190



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 151/174 (87%), Gaps = 2/174 (1%)
 Frame = +1

Query  40   PPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDV  219
            P  TS+   D  PP KPK +K+A+AC+LLA  TS+LLGYD GVMSGAS+YI+++L ISDV
Sbjct  15   PQNTSI--EDFDPPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGASLYIQKNLKISDV  72

Query  220  QVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGR  399
            QVE L GT+NIYSL+GSA AGRTSD IGR+YTIV+AG +F VGA+LMGFATNYAFLMVGR
Sbjct  73   QVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMGFATNYAFLMVGR  132

Query  400  FVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            FVAG+GVGY +MIAPVY+AE++P S RGFLTSFPEVF+N G+LLG++ANY+F+K
Sbjct  133  FVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFSK  186



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PPKK KRNKYA AC++LASMTSILLGYD GVMSGA+IYIK+DL +SD Q+E L+G I
Sbjct  18   DFDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDEQIEILLGII  77

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GS +AGRTSD IGRRYTI + G +F VG+ LMGF  +Y+FLM GRFVAGIG+GY
Sbjct  78   NLYSLIGSCLAGRTSDWIGRRYTIGLGGAIFLVGSTLMGFYPHYSFLMCGRFVAGIGIGY  137

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++NY F+K
Sbjct  138  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSK  182



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            +   PKK  RNKYA+AC++LASMTSILLGYD GVMSGA+IYIK+DL ISDV+VE L+G +
Sbjct  21   EFDAPKKKGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKISDVEVEILVGIL  80

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+Y L GSA AGRTSD IGRRYTIV+A  +FF+GA+LMGFATNY FLMVGRFVAGIGVGY
Sbjct  81   NVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGFATNYVFLMVGRFVAGIGVGY  140

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGF+TSFPEVFIN G+L G+++NY+F+K
Sbjct  141  ALMIAPVYAAEVSPASSRGFITSFPEVFINAGILFGYISNYAFSK  185



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  P KKPKRNKYA AC++LASMTSILLGYD GVMSGA+IYIK+DL +SDV++E L+G I
Sbjct  20   DFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDVKIEILLGII  79

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GS +AGRTSD IGRRYTIV AG +FFVGA+LMGF+ NY FLM GRF+AGIG+GY
Sbjct  80   NLYSLIGSGLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYWFLMFGRFIAGIGIGY  139

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++N++F+K
Sbjct  140  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNFAFSK  184



>gb|ACC61047.1| mannitol transporter [Gossypium hirsutum]
Length=392

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = +1

Query  28   SAKPPPATSLLPADLGPP-KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDL  204
            S +P  A +   AD  P  KKPKRNK+A AC++LAS+TSILLGYD GV+SGA IYI++DL
Sbjct  12   STRPVMADNRNFADFEPAVKKPKRNKFASACAILASLTSILLGYDIGVISGAIIYIQEDL  71

Query  205  GISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAF  384
             I+DVQ E L+G +N+YSLVGS  AGRTSD +GRRYTIV+AG +FF+GA+LMGFAT+YAF
Sbjct  72   KINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYAF  131

Query  385  LMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            LMVGRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  132  LMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSK  190



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            +   PKK  RNKYA+AC++LASMTSILLGYD GVMSGA+IYIK+DL ISDV+VE L+G +
Sbjct  21   EFDAPKKNGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKISDVEVEILVGIL  80

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+Y L GSA AGRTSD IGRRYTIV+A  +FF+GA+LMGFATNY FLMVGRFVAGIGVGY
Sbjct  81   NVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGFATNYVFLMVGRFVAGIGVGY  140

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGF+TSFPEVFIN G+L G+++NY+F+K
Sbjct  141  ALMIAPVYAAEVSPASSRGFITSFPEVFINAGILFGYISNYAFSK  185



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            KKPKRN YA+ C++LASMTSILLGYD GVMSGASIYI++DL I+DV+VE LIG +N+YSL
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQEDLKITDVEVEILIGILNLYSL  78

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GSA AGRTSD IGRRYTIV AG +FF GA+LMGFATN+AFLMVGRFVAGIGVGYALMIA
Sbjct  79   IGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNFAFLMVGRFVAGIGVGYALMIA  138

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            PVY+AEV+P S RG LTSFPEVF+N G+LLG+VANY+F+
Sbjct  139  PVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            KKPKRN YA+ C++LASMTSILLGYD GVMSGASIYI++DL I+DV+VE LIG +N+YSL
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQEDLKITDVEVEILIGILNLYSL  78

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GSA AGRTSD IGRRYTIV AG +FF GA+LMGFATN+AFLMVGRFVAGIGVGYALMIA
Sbjct  79   IGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNFAFLMVGRFVAGIGVGYALMIA  138

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            PVY+AEV+P S RG LTSFPEVF+N G+LLG+VANY+F+
Sbjct  139  PVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D    KKPKRNKYA  C++LASMTSILLGYD GVMSGA+IYIK+DL +SDVQ+E L+G I
Sbjct  15   DFNSSKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIKRDLKVSDVQIEILMGII  74

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GS +AGRTSD IGRRYTIV AG +FF GA+LMGF+ NY FLM GRFVAGIG+GY
Sbjct  75   NLYSLIGSCLAGRTSDWIGRRYTIVFAGTIFFAGALLMGFSPNYLFLMFGRFVAGIGIGY  134

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+N++F+K
Sbjct  135  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSK  179



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            KKPKRN YA+ C++LASMTSILLGYD GVMSGASIYI++DL ISDV+VE LIG +N+YSL
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQKDLKISDVEVEILIGILNLYSL  78

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GSA AGRTSD IGRRYTIV AG +FF GA+LMG ATNYAFLMVGRFVAGIGVGYALMIA
Sbjct  79   IGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGLATNYAFLMVGRFVAGIGVGYALMIA  138

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            PVY+AEV+P S RG LTSFPEVF+N G+LLG+VANY+F+
Sbjct  139  PVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD    KKPKRNK+A ACS+LAS+ SILLGYD GVMSGA IYIK DL ISDVQVE L+G 
Sbjct  23   ADFEVSKKPKRNKFAFACSILASLASILLGYDIGVMSGAIIYIKDDLKISDVQVEILVGI  82

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+Y L+G+  AGRTSD IGRRYTIVVA  +FFVGA+LMGFATNYAFLMVGRFVAGIGVG
Sbjct  83   LNLYCLIGAYAAGRTSDWIGRRYTIVVAAAIFFVGALLMGFATNYAFLMVGRFVAGIGVG  142

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +AL+IAPVY+AEV+P S RGFL SFPEVFIN G+LLG+V+NY+F+K
Sbjct  143  FALLIAPVYTAEVSPASSRGFLNSFPEVFINIGLLLGYVSNYAFSK  188



>gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKKPKRNKYA  C++LASM SILLGYD GVMSGA+IYIK+D  I+DVQ E +IG IN+Y+
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFQINDVQEEVMIGVINLYA  73

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+G+A AGRTSD IGRRYT+V+AG +FF+GA+LMGFATNY FLM GRFVAGIGVGYALMI
Sbjct  74   LIGAAAAGRTSDWIGRRYTMVLAGVIFFLGAILMGFATNYEFLMFGRFVAGIGVGYALMI  133

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +PVY+AEV+P S RGFLTSFPEVFINFGVLLG+++N+ F+K
Sbjct  134  SPVYTAEVSPASSRGFLTSFPEVFINFGVLLGYISNFFFSK  174



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPK  K  K+A+AC++LASMTSILLGYD GVMSGAS++IK++L I+DVQVE L GT
Sbjct  20   ADFDPPKAAKTKKFAVACAILASMTSILLGYDIGVMSGASLFIKENLKITDVQVEVLNGT  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA+AGRTSD IGRRYTIV++G +FF GA+LMGFA NYAFLM GRF+AG+GVG
Sbjct  80   LNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAPNYAFLMFGRFIAGVGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V+NY+ AK
Sbjct  140  YALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNYALAK  185



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   SHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQD  201
            + +A  PP    +P  + P K PKRNKYA AC++LASMTSILLGYD GVMSGA IYIK+D
Sbjct  8    NQTAPAPPPVKHVPESVLPAKPPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRD  67

Query  202  LGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYA  381
            L ISD+++  L G++NIYSL+GS  AG+TSDLIGRRYTIV+AG +FF GA+LMG A NYA
Sbjct  68   LKISDLEIGILAGSLNIYSLIGSCAAGKTSDLIGRRYTIVLAGAIFFAGAILMGLAPNYA  127

Query  382  FLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            FLM GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G++LG+V+N +F+K
Sbjct  128  FLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSK  187



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = +1

Query  28   SAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLG  207
            + K   +T  +P +LGP  KPKRNKYA AC++LASMTSILLGYD GVMSGA IYIK+DL 
Sbjct  17   ATKHGDSTKHVP-ELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLK  75

Query  208  ISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFL  387
            ISD+Q+  L G +NIYSL+GS  AGRTSD IGRRYTIV+AG +FF GA+LMGFA NYAFL
Sbjct  76   ISDLQIGILAGILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFL  135

Query  388  MVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            M GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G++LG+V+N +F+K
Sbjct  136  MFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSK  193



>ref|XP_004170410.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=533

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +1

Query  55   LLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFL  234
            +LP D  PPKK KRNK++LAC+ LASMTS+LLGYD GVMSGA+++IK+D  +SD ++E L
Sbjct  19   ILP-DFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRLSDTKIEIL  77

Query  235  IGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGI  414
            +G +N+YSL+GSA AGRTSD IGRRYT+VVA  +FF GA+LMGFAT+Y+FLM GRFVAG+
Sbjct  78   VGILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGALLMGFATSYSFLMFGRFVAGV  137

Query  415  GVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY F+K
Sbjct  138  GVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSK  186



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +1

Query  55   LLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFL  234
            +LP D  PPKK KRNK++LAC+ LASMTS+LLGYD GVMSGA+++IK+D  +SD ++E L
Sbjct  19   ILP-DFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRLSDTKIEIL  77

Query  235  IGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGI  414
            +G +N+YSL+GSA AGRTSD IGRRYT+VVA  +FF GA+LMGFAT+Y+FLM GRFVAG+
Sbjct  78   VGILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGALLMGFATSYSFLMFGRFVAGV  137

Query  415  GVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY F+K
Sbjct  138  GVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSK  186



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = +1

Query  28   SAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLG  207
            + K   +T  +P +LGP  KPKRNKYA AC++LASMTSILLGYD GVMSGA IYIK+DL 
Sbjct  17   ATKHGDSTKHVP-ELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLK  75

Query  208  ISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFL  387
            ISD+Q+  L G +NIYSL+GS  AGRTSD IGRRYTIV+AG +FF GA+LMGFA NYAFL
Sbjct  76   ISDLQIGILAGILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFL  135

Query  388  MVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            M GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G++LG+V+N +F+K
Sbjct  136  MFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSK  193



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +1

Query  13   LMASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYI  192
            L A  +    P      AD  P KKPKRN YA   ++LASMTSILLGYD GVMSGA++YI
Sbjct  5    LGAKSNNNTDPQNQKTLADFDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYI  64

Query  193  KQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFAT  372
            K D  +SD Q+E LIG +NIYSL+GS  AGRTSD IGRRYTIV+AG +FF GA+LMGFAT
Sbjct  65   KDDFKVSDTQIEILIGILNIYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAT  124

Query  373  NYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYS  552
            NYAFLM GRFVAG+GVGYALMIAPVY+AE++P S RGFLTSFPEVFIN G+LLG+V+NY 
Sbjct  125  NYAFLMGGRFVAGVGVGYALMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYG  184

Query  553  FAK  561
            F+K
Sbjct  185  FSK  187



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +1

Query  43   PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            P T    AD  P KKPKRNKYA AC++LAS+ SILLGYD GVMSGA  YI+ DL +SDVQ
Sbjct  16   PTTEKTLADFDPVKKPKRNKYAFACAILASVASILLGYDIGVMSGAKDYIQTDLKLSDVQ  75

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            V  L+GT+N YSLVGSA AG TSD IGRRYTIVVAG VFF GA+LMGF+TNYAFLMV RF
Sbjct  76   VGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFTGALLMGFSTNYAFLMVARF  135

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VAGIGVG+ALMIAPVY+ EV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  136  VAGIGVGFALMIAPVYTTEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSK  188



>ref|XP_004171995.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=516

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKKPKRNKYA  C++LASM SILLGYD GVMSGA+IYIK D  I+DVQ E +IG IN+Y+
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKXDFQINDVQEEVMIGVINLYA  73

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+G+A AGRTSD IGRRYT+V+AG +FF+GA+LMGFATNY FLM GRFVAGIGVGYALMI
Sbjct  74   LIGAAAAGRTSDWIGRRYTMVLAGVIFFLGAILMGFATNYEFLMFGRFVAGIGVGYALMI  133

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +PVY+AEV+P S RGFLTSFPEVFINFGVLLG+++N+ F+K
Sbjct  134  SPVYTAEVSPASSRGFLTSFPEVFINFGVLLGYISNFFFSK  174



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PP +P+RNKYA+AC+ LAS TSILLGYD GVMSGA IYIK+DL ISDV+VE L G +
Sbjct  26   DFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKEDLKISDVEVEILTGIL  85

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
             +YSL+GS +AGRTSD IGRRYTIV+AG +FF GA+LMGFA NYAFLM GRFVAGIGVGY
Sbjct  86   AVYSLLGSPMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIGVGY  145

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFL SFPEVFIN G+LLG+++NY+F+K
Sbjct  146  ALMIAPVYTAEVSPASTRGFLNSFPEVFINIGILLGYISNYAFSK  190



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +1

Query  13   LMASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYI  192
            L A  +    P      AD  P KKPKRN YA   ++LASMTSILLGYD GVMSGA++YI
Sbjct  5    LGAKSNNNTDPQNQKTLADFDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYI  64

Query  193  KQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFAT  372
            K D  +SD Q+E LIG +NIYSL+GS  AGRTSD IGRRYTIV+AG +FF GA+LMGFAT
Sbjct  65   KDDFKVSDTQIEILIGILNIYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAT  124

Query  373  NYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYS  552
            NYAFLM GRFVAG+GVGYALMIAPVY+AE++P S RGFLTSFPEVFIN G+LLG+V+NY 
Sbjct  125  NYAFLMGGRFVAGVGVGYALMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYG  184

Query  553  FAK  561
            F+K
Sbjct  185  FSK  187



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 152/181 (84%), Gaps = 4/181 (2%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            A +     P+   +PA   PP+KPKRNKYALACS LASMTSILLGYD GVMSGA IYI++
Sbjct  7    ARNGVSSAPSHLPIPA-FDPPRKPKRNKYALACSFLASMTSILLGYDIGVMSGAIIYIRK  65

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            ++ ++DVQ E ++G +N+YSL+GSA AGRTSD    RYTI+ AG +FF GA+LMGFAT+Y
Sbjct  66   NIHMTDVQKEVIMGILNLYSLLGSAAAGRTSDC---RYTIIFAGAIFFAGALLMGFATSY  122

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            AFLMVGRFVAGIGVGYALMIAPVY+AEVAP S RGFLTSFPEVFINFG+LLG+V+NY+F+
Sbjct  123  AFLMVGRFVAGIGVGYALMIAPVYTAEVAPASTRGFLTSFPEVFINFGILLGYVSNYAFS  182

Query  559  K  561
            K
Sbjct  183  K  183



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 146/173 (84%), Gaps = 1/173 (1%)
 Frame = +1

Query  43   PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            PAT  +P +LGPP KPKRNKYA AC++LASMTSILLGYD GVMSGA IYIK+D  I+D+Q
Sbjct  16   PATKHVP-ELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDFKITDLQ  74

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            V  L G +NI+SL+GS  AG+TSD IGRR TIV AG +FF GA+LMG A NYAFLM GRF
Sbjct  75   VSILAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILMGLAPNYAFLMFGRF  134

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VAG+GVGYALMIAPVY+AEVAP S RGFLTSFPEVFIN G++LG+V+N +F+K
Sbjct  135  VAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSK  187



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KPKRNK+A+ACS+LA MTSILLGYD GVMSGA+++I+ DL I+DVQ++ L GT
Sbjct  21   ADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTGT  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AGRTSD IGRRYT+V++G +FFVGA+LMG A  Y FLM GRFVAGIGVG
Sbjct  81   LNIYSLIGSALAGRTSDWIGRRYTVVLSGAIFFVGAILMGVAPGYGFLMFGRFVAGIGVG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            Y LMI+PVY+AE+AP   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  141  YGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSK  186



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPK PK  K+A+AC+ LASMTSILLGYD GVMSGAS++IK++L I+DVQVE L GT
Sbjct  20   ADFDPPKAPKTKKFAIACATLASMTSILLGYDIGVMSGASLFIKENLKITDVQVEVLNGT  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA+AGRTSD IGRRYTIV++G +FF GA+LMGFA NYAFLM GRF+AG+GVG
Sbjct  80   LNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAPNYAFLMFGRFIAGVGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            YALMIAPVY+AE++P S RG LTSFPEVF+N G+LLG+V+NY+ +
Sbjct  140  YALMIAPVYTAEISPASFRGLLTSFPEVFVNVGILLGYVSNYALS  184



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 148/171 (87%), Gaps = 6/171 (4%)
 Frame = +1

Query  67   DLGPP------KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVE  228
            D+G P      KKPKRNKYA  C++LASMTS+LLGYD GVMSGA+IYIK  L +SDV++E
Sbjct  17   DVGSPVIFDAVKKPKRNKYAFGCAILASMTSVLLGYDIGVMSGAAIYIKDQLHVSDVKLE  76

Query  229  FLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVA  408
             ++G IN +SLVGSA+AGRTSD IGRRYT+V+AG +FFVGA+LMGFATNY+FLM GRFVA
Sbjct  77   IVVGIINFFSLVGSALAGRTSDWIGRRYTMVLAGAIFFVGAILMGFATNYSFLMFGRFVA  136

Query  409  GIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GIGVGYALMIAPVY+AEV+  S RGFLTSFPEVFIN GVLLG+V+NY+F+K
Sbjct  137  GIGVGYALMIAPVYTAEVSSASSRGFLTSFPEVFINIGVLLGYVSNYAFSK  187



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
             KPK+N YAL  S++ASMTSILLGYDTGVMSGA++YIK+DL I+DVQVE L+G INIYSL
Sbjct  24   NKPKKNMYALLISVMASMTSILLGYDTGVMSGATLYIKKDLKITDVQVEILVGLINIYSL  83

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GSAVAGRTSD +GRR TIV+A  +FFVGA +MG A NYA LMVGRFVAG+GVGYALMIA
Sbjct  84   IGSAVAGRTSDYLGRRITIVIASVIFFVGAAVMGLANNYAVLMVGRFVAGLGVGYALMIA  143

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY+AEVAP S RGFLTSFPEVFINFGVLLG+++NY+FAK
Sbjct  144  PVYAAEVAPASSRGFLTSFPEVFINFGVLLGYLSNYAFAK  183



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KPKRNK+A+ACS+LA MTSILLGYD GVMSGA+++I+ DL I+DVQ++ L GT
Sbjct  21   ADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTGT  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSLVGS +AGRTSD IGRRYT+V++G +FFVGA+LMG A  Y FLM GRFVAGIGVG
Sbjct  81   LNIYSLVGSGLAGRTSDWIGRRYTVVLSGAIFFVGAILMGVAPGYGFLMFGRFVAGIGVG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            Y LMI+PVY+AE+AP   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  141  YGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSK  186



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +1

Query  43   PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            P T    AD  P KKPKRNK+A AC++ AS+ SILLGYD GVMSGA  YI+ DL +SDVQ
Sbjct  16   PTTEKTLADFDPVKKPKRNKFAFACAITASVASILLGYDIGVMSGAKDYIQTDLKLSDVQ  75

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            V  L+GT+N YSLVGSA AG TSD IGRRYTIVVAG VFF GA+LMGF+TNYAFLMV RF
Sbjct  76   VGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAFLMVARF  135

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VAGIGVG+ALMIAPVY+ EV+P S RGFLTSFPEVFIN G+LLG+V+NY+F+K
Sbjct  136  VAGIGVGFALMIAPVYTTEVSPASSRGFLTSFPEVFINVGILLGYVSNYAFSK  188



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   235 bits (599),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  P K PKRNK+A AC++LASMTSILLGYD GVMSGA IYIK+DL ++DVQ+E ++G I
Sbjct  14   DFDPKKAPKRNKFAFACAILASMTSILLGYDVGVMSGAVIYIKRDLKLTDVQIEIVVGII  73

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GS +AGRTSD IGRRYTIV+AG +FF+GA+LMGF+ NY FLM  RFVAG+G+GY
Sbjct  74   NLYSLIGSCLAGRTSDWIGRRYTIVLAGGIFFMGAILMGFSPNYPFLMFARFVAGVGIGY  133

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVF+N G+LLG+++NY F+K
Sbjct  134  ALMIAPVYTAEVSPPSCRGFLTSFPEVFVNGGILLGYISNYGFSK  178



>ref|XP_006856084.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
 gb|ERN17551.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
Length=518

 Score =   235 bits (599),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            +KPKRNKYALAC+ LASMTSILLGYD GVMSGA I+IK+DL ISDV+VE L+G++NIY L
Sbjct  17   EKPKRNKYALACAFLASMTSILLGYDIGVMSGAVIFIKEDLRISDVEVEILVGSLNIYCL  76

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GS  AGRTSD IGRRYTIV A  +FFVGA++MGFA NYAFLM GR VAGIGVGYALMIA
Sbjct  77   IGSFAAGRTSDWIGRRYTIVFASAIFFVGALMMGFAPNYAFLMAGRVVAGIGVGYALMIA  136

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY+AEVAP S RGFLTSFPEVFIN G+L G+V+N++F +
Sbjct  137  PVYTAEVAPASCRGFLTSFPEVFINAGILFGYVSNFAFER  176



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            ++  P KPKRNK+A AC++LASMTSILLGYD GVMSGA IYIK+DL I D +++ L G +
Sbjct  21   EMSMPAKPKRNKFAFACAILASMTSILLGYDIGVMSGAIIYIKRDLKIGDGKIQVLTGIL  80

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            NI+SL+GS  AGRTSD IGRRYTIV+AG +FFVGA+LMGFATNYAFLM GRFVAGIGVGY
Sbjct  81   NIFSLIGSCAAGRTSDWIGRRYTIVLAGAIFFVGAILMGFATNYAFLMFGRFVAGIGVGY  140

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFL SFPEVFIN G+LLG+V+NY+F+K
Sbjct  141  ALMIAPVYTAEVSPASSRGFLNSFPEVFINAGILLGYVSNYAFSK  185



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD    KKPKRNK+A AC++LAS+ SILLGYD GVMSGA +YIK DL ISDVQVE L+G 
Sbjct  23   ADFEVLKKPKRNKFAFACAILASLASILLGYDIGVMSGAILYIKDDLKISDVQVEILVGI  82

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+Y L+G+ VAGRTSD IGRRYTIVVA  +FFVGA+LMGFATNY FLMVGRFV GIGVG
Sbjct  83   LNLYCLIGAYVAGRTSDWIGRRYTIVVAASIFFVGALLMGFATNYTFLMVGRFVTGIGVG  142

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +AL+IAPVY+AEV+P S RGFL SFPEVFIN G+LLG+V+NY+F+K
Sbjct  143  FALLIAPVYTAEVSPASARGFLNSFPEVFINAGLLLGYVSNYAFSK  188



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = +1

Query  43   PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            PAT  +P +LGPP KPKRNKYA AC++LASMTSILLGYD GVMSGA IYIK+D  I+D+Q
Sbjct  16   PATKHVP-ELGPPLKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDFKITDLQ  74

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            V  L G +NI+SL+GS  AG+TSD IGRR TIV AG +FF GA+LMG A NY FLM GRF
Sbjct  75   VSILAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILMGLAPNYDFLMFGRF  134

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VAG+GVGYALMIAPVY+AEVAP S RGFLTSFPEVFIN G++LG+V+N +F+K
Sbjct  135  VAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSK  187



>ref|XP_006856085.1| hypothetical protein AMTR_s00059p00123280 [Amborella trichopoda]
 gb|ERN17552.1| hypothetical protein AMTR_s00059p00123280 [Amborella trichopoda]
Length=513

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            +KP+RNKYALAC+ LASMTSILLGYD GVMSGA ++IK DL I+DV+VE L+G++NI+SL
Sbjct  14   EKPQRNKYALACATLASMTSILLGYDIGVMSGAILFIKDDLHINDVEVEILVGSLNIFSL  73

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GSA AGRTSD IGRRYTIV AG +FFVGA++MGFA NYAFLM GR VAGIGVGYALMIA
Sbjct  74   IGSAAAGRTSDYIGRRYTIVFAGGIFFVGALMMGFAPNYAFLMAGRVVAGIGVGYALMIA  133

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY+AEVAP S RGFLTSFPEVFIN G+LLG+V+NY FA+
Sbjct  134  PVYTAEVAPASSRGFLTSFPEVFINLGILLGYVSNYVFAR  173



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = +1

Query  40   PPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDV  219
            P  TS+   D   P KPK +K+A+AC+LLA  TS+LLGYD GVMSGAS++IK++L ISDV
Sbjct  15   PQNTSI--EDFDRPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGASLFIKENLKISDV  72

Query  220  QVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGR  399
            QVE L GT+NIYSL+GSA AGRTSD IGR+YTIV+AG +FFVGA+LMGFATNYAFLMVGR
Sbjct  73   QVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFFVGALLMGFATNYAFLMVGR  132

Query  400  FVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            FVAG+GVG+ +MIAPVY+AE++P S RGFLTSFPEVF+N G+LLG++ANY+ +K
Sbjct  133  FVAGVGVGFGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYALSK  186



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  PPKK K NKYA  C++LAS T ILLGYD GVM+GA+IYIK+DL +SDVQ+E L+G I
Sbjct  15   DFDPPKKHKTNKYAFGCAILASTTCILLGYDIGVMTGAAIYIKRDLKVSDVQIEILLGII  74

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GS VAGRTSD +GRRYTIV AG +FF GA+LMGF+ NY+FLM GRFVAGIG+GY
Sbjct  75   NLYSLIGSCVAGRTSDWLGRRYTIVFAGTIFFAGALLMGFSPNYSFLMFGRFVAGIGIGY  134

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMI PVYSAEV+P S RGFLTSF EVFIN G+LLG+++NY+F+K
Sbjct  135  ALMIGPVYSAEVSPASYRGFLTSFTEVFINGGILLGYISNYAFSK  179



>ref|XP_010690917.1| PREDICTED: polyol transporter 5 isoform X2 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68029.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=545

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = +1

Query  31   AKPPPAT-SLLPADLGPPKKP-KRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDL  204
            + PPP T S + AD  P KKP KRNK+A AC+ LASMTS+LLGYD GVMSGA IY+K+D 
Sbjct  10   SDPPPTTASKVIADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLKEDW  69

Query  205  GISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAF  384
             ISD Q+  L+G +NIY L GS  AGRTSD IGRRYTIV+AG +FFVGA+LMGFATNYAF
Sbjct  70   HISDTQIGVLVGILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNYAF  129

Query  385  LMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            LMVGRFV GIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++N +F+
Sbjct  130  LMVGRFVTGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAFS  187



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +1

Query  43   PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            P      AD  P KKPKRN YA   ++LASMTSILLGYD GVMSGA++YIK DL +SD +
Sbjct  15   PQNQKTLADFDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTK  74

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            +E L+G +NIYSL+GS  AGRTSD IGRRYTIV+AG +FF GA+LMGFATNYAFLM GRF
Sbjct  75   IEILMGILNIYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRF  134

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
             AGIGVGYALMIAPVY+AE++P S RGFLTSFPEVFIN G+LLG+V+NY F+K
Sbjct  135  GAGIGVGYALMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSK  187



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  31   AKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGI  210
            A+   AT     D  P K P+RNKYA AC++LASMTSILLGYD GVMSGA IYIK+DL +
Sbjct  2    AEGKTATQKSLQDFDPQKTPRRNKYAFACAILASMTSILLGYDVGVMSGAIIYIKRDLKL  61

Query  211  SDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLM  390
            +DVQ+E L+G IN+YSL+GS +AGRTSD IGRRYTIV+AG +FF GA+LMG + NY FLM
Sbjct  62   TDVQIEILVGIINLYSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGAILMGISPNYPFLM  121

Query  391  VGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
              RF+AG+G+GYALMIAPVY+ EV+P S RGFLTSFPEVFIN G+LLG+++NY F+K
Sbjct  122  FARFIAGVGIGYALMIAPVYTTEVSPPSCRGFLTSFPEVFINGGILLGYISNYGFSK  178



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +1

Query  43   PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            P T    AD  P KKPK NK+A AC++LASM SILLGYD GVMSGA  YIK DL +SD Q
Sbjct  16   PTTEKTLADFDPVKKPKGNKFAFACAILASMASILLGYDIGVMSGAKDYIKIDLKLSDTQ  75

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            V  L+GT+N YSLVGSA AG TSD IGRRYTIVVAG VFF GA+LMGF+TNYAFLMV RF
Sbjct  76   VGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAFLMVARF  135

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            V GIGVG+ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+L+G+V+NY+F+K
Sbjct  136  VTGIGVGFALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILIGYVSNYAFSK  188



>ref|XP_009121242.1| PREDICTED: putative polyol transporter 1, partial [Brassica rapa]
Length=247

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  85   KPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLV  264
            +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK+DL +SDVQ+E L+G +NIYSLV
Sbjct  19   RGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLV  78

Query  265  GSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAP  444
            GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MIAP
Sbjct  79   GSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAP  138

Query  445  VYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VY+AEVAP + RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  139  VYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_010690916.1| PREDICTED: polyol transporter 5 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68028.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=549

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = +1

Query  31   AKPPPAT-SLLPADLGPPKKP-KRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDL  204
            + PPP T S + AD  P KKP KRNK+A AC+ LASMTS+LLGYD GVMSGA IY+K+D 
Sbjct  10   SDPPPTTASKVIADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLKEDW  69

Query  205  GISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAF  384
             ISD Q+  L+G +NIY L GS  AGRTSD IGRRYTIV+AG +FFVGA+LMGFATNYAF
Sbjct  70   HISDTQIGVLVGILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNYAF  129

Query  385  LMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            LMVGRFV GIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++N +F+
Sbjct  130  LMVGRFVTGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAFS  187



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPK  K  K+A+AC+ LASMTSILLGYD GVMSGAS++IK++L I+DVQVE L GT
Sbjct  20   ADFDPPKAXKTKKFAIACATLASMTSILLGYDIGVMSGASLFIKENLKITDVQVEVLNGT  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSL+GSA+AGRTSD IGRRYTIV++G +FF GA+LMGFA NYAFLM GRF+AG+GVG
Sbjct  80   LNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAPNYAFLMFGRFIAGVGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            YALMIAPVY+AE++P S RG LTSFPEVF+N G+LLG+V+NY+ +
Sbjct  140  YALMIAPVYTAEISPASFRGLLTSFPEVFVNVGILLGYVSNYALS  184



>gb|ACJ85869.1| unknown [Medicago truncatula]
 gb|AFK48997.1| unknown [Medicago truncatula]
Length=434

 Score =   230 bits (586),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D    KKP+ NK+A AC++LASMTSILLGYD GVMSGA IYIK+DL +S+VQ+E L+G I
Sbjct  15   DFDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGII  74

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N++SL+GS +AGRTSD IGRRYTIV+AG +FF GA+LMGF+ N+AFLM  RF+AGIG+GY
Sbjct  75   NLFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAGIGIGY  134

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++NY F+K
Sbjct  135  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSK  179



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            A+L PP+KPKRNK+A  C++L SMT ILLGYD GVMSGA IYIK+DL ISD Q+E L+G 
Sbjct  13   AELCPPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGI  72

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYS+VG+  AGRTSDLIGRRYTIV+AG +FF GA+LMGFATNYAFLM GRFVAG GVG
Sbjct  73   LNIYSVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVG  132

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +A MIAPVY+AE++P S RGFL SFPEVF+N G+LLG+V+N++F+K
Sbjct  133  FAGMIAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSK  178



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            A+L PP+KPKRNK+A  C++L SMT ILLGYD GVMSGA IYIK+DL ISD Q+E L+G 
Sbjct  13   AELCPPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGI  72

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYS+VG+  AGRTSDLIGRRYTIV+AG +FF GA+LMGFATNYAFLM GRFVAG GVG
Sbjct  73   LNIYSVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVG  132

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +A MIAPVY+AE++P S RGFL SFPEVF+N G+LLG+V+N++F+K
Sbjct  133  FAGMIAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSK  178



>ref|NP_179209.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
 sp|Q9XIH7.1|PLT1_ARATH RecName: Full=Putative polyol transporter 1 [Arabidopsis thaliana]
 gb|AAD26954.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06467.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
Length=511

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R++YA AC++LASMTSI+LGYD GVMSGASI+IK DL +SDVQ+E L+G +NIYS
Sbjct  17   PPRGNRSRYAFACAILASMTSIILGYDIGVMSGASIFIKDDLKLSDVQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            LVGS  AGRTSD +GRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   LVGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFLTSFPE+FIN G+LLG+V+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLTSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            A+L PP+KPKRNK+A  C++L SMT ILLGYD GVMSGA IYIK+DL ISD Q+E L+G 
Sbjct  13   AELCPPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGI  72

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYS+VG+  AGRTSDLIGRRYTIV+AG +FF GA+LMGFATNYAFLM GRFVAG GVG
Sbjct  73   LNIYSVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVG  132

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +A MIAPVY+AE++P S RGFL SFPEVF+N G+LLG+V+N++F+K
Sbjct  133  FAGMIAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSK  178



>gb|KFK41272.1| hypothetical protein AALP_AA2G108500 [Arabis alpina]
Length=444

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G +NIYS
Sbjct  17   PPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            LVGS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   LVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY FAK
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAK  177



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 148/181 (82%), Gaps = 1/181 (1%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            +S SA P  A++ LP  + P KK    ++A AC++LASMTSILLGYD GVMSGAS+YIK+
Sbjct  60   SSSSAPPEMASAALPEAVAPKKK-GNVRFAFACAILASMTSILLGYDIGVMSGASLYIKK  118

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            D  ISD +VE L+G +N+YSL+GS  AGRTSD IGRRYTIV A  +FF GA LMGFA NY
Sbjct  119  DFNISDGKVEVLMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNY  178

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            A LM GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F+
Sbjct  179  AMLMFGRFVAGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFS  238

Query  559  K  561
            +
Sbjct  239  R  239



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            A+L PP+KPKRNK+A  C++L SMT ILLGYD GVMSGA IYIK+DL ISD Q+E L+G 
Sbjct  13   AELCPPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGI  72

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYS+VG+  AGRTSDLIGRRYTIV+AG +FF GA+LMGFATNYAFLM GRFVAG GVG
Sbjct  73   LNIYSVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVG  132

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +A MIAPVY+AE++P S RGFL SFPEVF+N G+LLG+V+N++F+K
Sbjct  133  FAGMIAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSK  178



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = +1

Query  13   LMASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYI  192
            L A  +    P      AD  P KKPKRN YA   ++LASMTSILLGYD GVMSGA++YI
Sbjct  5    LGAKSNNNTDPQNQKTLADFDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYI  64

Query  193  KQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFAT  372
            K D  +SD ++E LIG +NI+SL+GS  AGRTSD IGRRYTIV+AG +FF GA+LMGFAT
Sbjct  65   KDDFKVSDTKIEILIGILNIFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAT  124

Query  373  NYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYS  552
            NYAFLM GRFVAG+GVGYA +IAPVY+AE++P S RGFLTSFPEVFIN G+LLG+V+NY 
Sbjct  125  NYAFLMGGRFVAGVGVGYAALIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYG  184

Query  553  FAK  561
            F+K
Sbjct  185  FSK  187



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   SHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQD  201
            + +A  PP    +P  + P K PKRN YA AC++LASMTSILLGYD GVMSGA IYIK+D
Sbjct  8    NRTAPSPPPVKHVPESVLPAKPPKRNNYAFACAILASMTSILLGYDIGVMSGAMIYIKRD  67

Query  202  LGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYA  381
            L I+D+Q+  L G++NIYSL+GS  AGRTSD IGRRYTIV+AG +FF GA+LMG + NYA
Sbjct  68   LKINDLQIGILAGSLNIYSLIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGLSPNYA  127

Query  382  FLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            FLM GRF+AGIGVGYALMIAPVY+AEV+P S RGFL SFPEVFIN G++LG+V+N +F+ 
Sbjct  128  FLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLNSFPEVFINAGIMLGYVSNLAFSN  187



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = +1

Query  13   LMASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYI  192
            L A  +    P      AD  P KKPKRN YA   ++LASMTSILLGYD GVMSGA++YI
Sbjct  5    LGAKSNNNTDPQNQKTLADFDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYI  64

Query  193  KQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFAT  372
            K D  +SD ++E LIG +NI+SL+GS  AGRTSD IGRRYTIV+AG +FF GA+LMGFAT
Sbjct  65   KDDFKVSDTKIEILIGILNIFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAT  124

Query  373  NYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYS  552
            NYAFLM GRFVAG+GVGYA +IAPVY+AE++P S RGFLTSFPEVFIN G+LLG+V+NY 
Sbjct  125  NYAFLMGGRFVAGVGVGYAALIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYG  184

Query  553  FAK  561
            F+K
Sbjct  185  FSK  187



>ref|XP_007201628.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
 gb|EMJ02827.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
Length=490

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +  D  PP+KPKRNK+A+ACSL+A  TSILLGYD GVMSGA+++I+ DL I+DVQ++ L 
Sbjct  5    IAEDFDPPQKPKRNKFAIACSLMACTTSILLGYDIGVMSGANLFIQDDLKINDVQIQILT  64

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            GT+NIYS++GSA+AGRTSD IGRRYT  ++G +F VGA+LMG A  Y FLM GRFVAGIG
Sbjct  65   GTLNIYSVLGSALAGRTSDWIGRRYTAFLSGAIFSVGAILMGVAQGYTFLMFGRFVAGIG  124

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGY LMI+PVY+AE+AP   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  125  VGYGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSK  172



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 144/172 (84%), Gaps = 1/172 (1%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A++ LP  + P KK    ++A AC++LASMTSILLGYD GVMSGAS+YIK+DLGI+DVQ+
Sbjct  2    ASAALPEAVEPGKK-GNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDLGITDVQL  60

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L+G +N+YSL+GS  AGRTSD IGRRYTIV A  +FF GA LMGFA NY  LM GRFV
Sbjct  61   EILMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYGMLMFGRFV  120

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AG+GVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F+ 
Sbjct  121  AGVGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSH  172



>ref|XP_010516958.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R +YA AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G +NIYS
Sbjct  17   PPRGNRTQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   LIGSGAAGRTSDWIGRRYTIVLAGVFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLGFV+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGFVSNYFFSK  177



>ref|XP_002884156.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60415.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+   R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G 
Sbjct  13   ADSEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGI  71

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVG
Sbjct  72   LNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVG  131

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YA+MIAPVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY FAK
Sbjct  132  YAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAK  177



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D    KKP+ NK+A AC++LASMTSILLGYD GVMSGA IYIK+DL +S+VQ+E L+G I
Sbjct  15   DFDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGII  74

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N++SL+GS +AGRTSD IGRRYTIV+AG +FF GA+LMGF+ N+AFLM  RF+AGIG+GY
Sbjct  75   NLFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAGIGIGY  134

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++NY F+K
Sbjct  135  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSK  179



>gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +1

Query  106  ALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGR  285
            AL C++LASMTSILLGYD GVMSGA+IYIK DL ISD+QVE L+GT+NIYSLVGSA AGR
Sbjct  12   ALGCAVLASMTSILLGYDIGVMSGAAIYIKDDLKISDLQVEVLVGTLNIYSLVGSAAAGR  71

Query  286  TSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVA  465
            TSD IGRRYTIVVAG +FFVGA+LMGFAT YAFLMVGRFVAGIGVGYALMIAPVY+AEV+
Sbjct  72   TSDWIGRRYTIVVAGAIFFVGALLMGFATTYAFLMVGRFVAGIGVGYALMIAPVYTAEVS  131

Query  466  PESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            P S RGFLTSFPEVFIN G+LLG+V+N++F+K
Sbjct  132  PASSRGFLTSFPEVFINGGILLGYVSNFAFSK  163



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A++ LPA + P KK    K+A AC++LASMTSILLGYD GVMSGAS+YIK+DL ISDV++
Sbjct  2    ASAPLPAAIEPGKK-GNVKFAFACAILASMTSILLGYDIGVMSGASLYIKKDLKISDVKL  60

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L+G +N+YSL+GS  AGRTSD IGRRYTIV A  +FF GA LMGFA NY  LM GRFV
Sbjct  61   EILMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYWMLMFGRFV  120

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F++
Sbjct  121  AGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSR  172



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = +1

Query  58   LPADLG-PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFL  234
            +P++LG P K PK+N+YA AC++LASMTSILLGYD GVMSGA IYIK+DL I+D Q+  L
Sbjct  20   VPSELGVPAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLDITDTQIGIL  79

Query  235  IGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGI  414
             G++NIYSL+GS  AG+TSD IGRRYTIV+AG +FF GA+LMG A NYAFLM GRF+AGI
Sbjct  80   AGSLNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAGI  139

Query  415  GVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GVGYALMIAPVY+AEVAP S RGFL SFPEVFIN G++LG+V+N +F+K
Sbjct  140  GVGYALMIAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSK  188



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            + G PKK    ++A AC++LASMTSILLGYD GVMSGAS++IK+DL ISDVQVE L+G +
Sbjct  8    EAGQPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLFIKKDLQISDVQVEVLMGIL  67

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GS  AGRTSD IGRRYTIV A  +FF GA++MGF+ NY  LM GRFVAGIGVGY
Sbjct  68   NVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALVMGFSVNYLMLMFGRFVAGIGVGY  127

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            ALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F++
Sbjct  128  ALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSR  172



>gb|KFK40045.1| hypothetical protein AALP_AA3G322700 [Arabis alpina]
Length=487

 Score =   229 bits (583),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G +NIYS
Sbjct  17   PPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            LVGS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRF+AGIGVGYA+MI
Sbjct  77   LVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFIAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY FAK
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAK  177



>ref|XP_002886203.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62462.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+   R++YA AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G 
Sbjct  13   ADSEPPRG-NRSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGI  71

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GS  AGRTSD IGRR+TIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVG
Sbjct  72   LNIYSLIGSGAAGRTSDWIGRRFTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVG  131

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YA+MIAPVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  132  YAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_010468639.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R++YA AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G +NIYS
Sbjct  17   PPRGNRSQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   LIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_006827104.1| hypothetical protein AMTR_s00010p00243760 [Amborella trichopoda]
 gb|ERM94341.1| hypothetical protein AMTR_s00010p00243760 [Amborella trichopoda]
Length=521

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            KKPKRNKYALAC+ LASM S+LLGYDTGVMSGA+++IK DL I+D+QVE L+G+INIY+L
Sbjct  22   KKPKRNKYALACAFLASMASVLLGYDTGVMSGAAMFIKDDLNINDIQVEILVGSINIYAL  81

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GSA AG TSD IGRR TI  AG +FFVG+V+MGFA NYA L  GR VAGIGVGYALMIA
Sbjct  82   IGSAFAGWTSDWIGRRKTIAFAGAIFFVGSVIMGFAPNYALLTAGRVVAGIGVGYALMIA  141

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY+ EVAP SIRGFLTSFPE+FIN GVLLG+V+N++FA 
Sbjct  142  PVYTTEVAPTSIRGFLTSFPEIFINGGVLLGYVSNFAFAD  181



>ref|XP_010442448.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  RN++A AC++LASMTSI+LGYD GV+SGA+I+IK DL +SDVQ+E L+G +NIYS
Sbjct  17   PPRGNRNRFAFACAILASMTSIILGYDIGVISGAAIFIKDDLKLSDVQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            ++GS VAGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   IIGSGVAGRTSDWIGRRYTIVLAGAFFFCGAILMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_006299557.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
 gb|EOA32455.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
Length=511

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R++YA AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G +NIYS
Sbjct  17   PPRGNRSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD +GRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   LIGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_010435020.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            +L PP+   R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SD+Q+E L+G +
Sbjct  14   ELEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGIL  72

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            NIYSL+GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGY
Sbjct  73   NIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGY  132

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            A+MIAPVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  133  AMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>emb|CDY46217.1| BnaA07g03530D [Brassica napus]
Length=512

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +1

Query  55   LLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFL  234
            ++ A++  P+   R+++A AC++LASMTSI+LGYD GVMSGA+I+IK+DL +SDVQ+E L
Sbjct  11   VVTAEVEAPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEIL  69

Query  235  IGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGI  414
            +G +NIYSLVGS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGI
Sbjct  70   MGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  129

Query  415  GVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GVGYA+MIAPVY+AEVAP + RGFL+SFPE+FIN G+LLG+V+NY FAK
Sbjct  130  GVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFAK  178



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  94   RNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLVGSA  273
            RNKYA  C++LASM SILLGYD GVMSGA+IYIK+D  I+DVQ E +IG IN+Y+L+G+A
Sbjct  19   RNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFEITDVQEEVMIGVINLYALIGAA  78

Query  274  VAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAPVYS  453
             AGRTSD IGRRYT+V+AG +FF+GAVLMGFATNY FLM GRFVAGIGVGYALMI+PVY+
Sbjct  79   AAGRTSDWIGRRYTMVLAGVIFFLGAVLMGFATNYGFLMFGRFVAGIGVGYALMISPVYT  138

Query  454  AEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AEV+P S RGFLTSFPEVFINFGV+LG+++N++F+K
Sbjct  139  AEVSPASSRGFLTSFPEVFINFGVMLGYISNFAFSK  174



>emb|CDY46218.1| BnaA07g03520D [Brassica napus]
Length=511

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  85   KPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLV  264
            +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK+DL +SDVQ+E L+G +NIYSLV
Sbjct  19   RGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLV  78

Query  265  GSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAP  444
            GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MIAP
Sbjct  79   GSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAP  138

Query  445  VYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VY+AEVAP + RGFL+SFPE+FIN G+LLG+V+NY FAK
Sbjct  139  VYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFAK  177



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A++ LP  + P KK    ++A AC++LASMTSILLGYD GVMSGAS+YIK+D  ISD +V
Sbjct  2    ASAALPEAVAPKKK-GNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKV  60

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L+G +N+YSL+GS  AGRTSD IGRRYTIV A  +FF GA LMGFA NYA LM GRFV
Sbjct  61   EVLMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFV  120

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F++
Sbjct  121  AGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSR  172



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A++ LP  + P KK    ++A AC++LASMTSILLGYD GVMSGAS+YIK+D  ISD +V
Sbjct  2    ASAALPEAVAPKKK-GNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKV  60

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L+G +N+YSL+GS  AGRTSD IGRRYTIV A  +FF GA LMGFA NYA LM GRFV
Sbjct  61   EVLMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFV  120

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F++
Sbjct  121  AGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSR  172



>ref|XP_006409469.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
 gb|ESQ50922.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
Length=511

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ E L+G +NIYS
Sbjct  17   PPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQFEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS +AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   LIGSGMAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>emb|CDP02097.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = +1

Query  16   MASHSAKPPPATSLLPA--DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIY  189
            MA     P  A +L  +  D GPP KPKRN  ALAC+LLA M+S+LLGYDTGVMSGA IY
Sbjct  1    MADSLQNPAVAGALESSNPDSGPPPKPKRNTLALACALLACMSSVLLGYDTGVMSGAMIY  60

Query  190  IKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFA  369
            IK+DL ISDV+VE L+GTIN+YSLVGS +AGRT D +GRRYTIV+AG +F  GA LM FA
Sbjct  61   IKRDLKISDVRVEILVGTINVYSLVGSTIAGRTCDWVGRRYTIVIAGVIFLAGAFLMTFA  120

Query  370  TNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANY  549
            T Y+FLM+GRF+AGIGVG+A+MIAPVYSAE++P S RGF+TSF EVFINFGVLLG+V+NY
Sbjct  121  TTYSFLMIGRFIAGIGVGFAMMIAPVYSAEISPRSARGFITSFTEVFINFGVLLGYVSNY  180

Query  550  SFAK  561
             FAK
Sbjct  181  FFAK  184



>emb|CDP17999.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D GPP K  +NKYAL C+ LA M+S+LLGY+ GVMSGA IYI++DL ISDVQ E L G I
Sbjct  19   DFGPPPKATKNKYALGCAFLACMSSVLLGYNAGVMSGAMIYIQRDLKISDVQKEVLGGII  78

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YSL+GSA+AGRT D +GRRYTI +AG +FF GA LM FATNYAFLMVG FVAGIGVGY
Sbjct  79   NVYSLLGSAIAGRTCDWVGRRYTIAMAGVIFFAGAFLMAFATNYAFLMVGLFVAGIGVGY  138

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
             LMIAPVYSAE++P SIRGF+TSF +VF N GVLLG+V+NY FAK
Sbjct  139  GLMIAPVYSAEISPRSIRGFITSFTKVFSNLGVLLGYVSNYFFAK  183



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  67   DLGP-PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            D  P  KKP+ NK+A AC++LASMTSILLGYD GVMSGA IYI++DL +SDVQ+E L+G 
Sbjct  18   DFDPQKKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIRRDLKLSDVQIEILVGI  77

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            IN++SL+GS +AGRTSD IGRRYTIV+AG +FF GA+LMGF+ N+ FLM  RF+AGIG+G
Sbjct  78   INLFSLIGSCLAGRTSDWIGRRYTIVLAGAIFFAGAILMGFSPNFPFLMFARFIAGIGIG  137

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+++NY F+K
Sbjct  138  YALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSK  183



>ref|XP_010484928.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=512

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            +L PP+   R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SD+Q+E L+G +
Sbjct  14   ELEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGIL  72

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            NIYSL+GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGY
Sbjct  73   NIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGY  132

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            A+MIAPVY+AEVAP S RGFL+SFPE+FIN G+LLG+++NY F+K
Sbjct  133  AMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYLSNYFFSK  177



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +1

Query  64   ADLGPPKK-PKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIG  240
            +D G  +K P++NKYA AC++LASMTS+LLGYD GVMSGA I++ ++L I+ V+VE L+G
Sbjct  13   SDAGNQRKSPRKNKYAFACAILASMTSVLLGYDVGVMSGAIIFVVEELKINHVEVEVLMG  72

Query  241  TINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGV  420
             IN+YSLVGSA+AGRTSD IGRRYTIV++G +FF GA+LMG A NYAFLM GRFVAGIGV
Sbjct  73   VINLYSLVGSAMAGRTSDWIGRRYTIVLSGAIFFAGALLMGLAPNYAFLMFGRFVAGIGV  132

Query  421  GYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GY LMIAPVY+AEV+P S RGFLTSFPEVFIN GVLLG+++NY+F+K
Sbjct  133  GYGLMIAPVYTAEVSPVSSRGFLTSFPEVFINLGVLLGYISNYAFSK  179



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P K K  ++A AC++LASMTSILLGYD GVMSGA+I+IK DL ISD QVE L+G +N+YS
Sbjct  17   PAKRKSKRFAFACAMLASMTSILLGYDIGVMSGAAIFIKDDLKISDTQVEILLGILNLYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            LVGS  AG TSD IGRRYTIV A  +FFVGA+LMGFA NYAFLM GRFVAGIGVGYALMI
Sbjct  77   LVGSYAAGFTSDWIGRRYTIVFAAGIFFVGALLMGFAVNYAFLMFGRFVAGIGVGYALMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFLTSFPEVFIN G+LLG+V+NY FA+
Sbjct  137  APVYTAEVAPASSRGFLTSFPEVFINSGILLGYVSNYGFAR  177



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +1

Query  64   ADLG-PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIG  240
            ++LG P K PK+N+YA AC++LASMTSILLGYD GVMSGA IYIK+DL I+D Q+  L G
Sbjct  22   SELGVPAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKITDTQIGILAG  81

Query  241  TINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGV  420
            ++NIYSL+GS  AG+TSD IGRRYTIV+AG +FF GA+LMG A NYAFLM GRF+AGIGV
Sbjct  82   SLNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAGIGV  141

Query  421  GYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GYALMIAPVY+AEVAP S RGFL SFPEVFIN G++LG+V+N +F+K
Sbjct  142  GYALMIAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSK  188



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            AS  A  P   + LPA +  PKK    ++A AC++LASMTSILLGYD GVMSGAS+YI++
Sbjct  24   ASTEASSPMDRAALPAAV-EPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQK  82

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            DL I+D Q+E L+G +N+YSLVGS  AGRTSD IGRR+TIV A  +FF GA++MG + NY
Sbjct  83   DLKINDTQLEVLMGILNVYSLVGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGLSVNY  142

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            A LM GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+N++FA
Sbjct  143  AMLMFGRFVAGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFA  202

Query  559  K  561
            +
Sbjct  203  R  203



>ref|NP_179210.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
 sp|Q9XIH6.1|PLT2_ARATH RecName: Full=Putative polyol transporter 2 [Arabidopsis thaliana]
 gb|AAD26955.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06468.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
Length=511

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G +NIYS
Sbjct  17   PPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   LIGSGAAGRTSDWIGRRYTIVLAGFFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+ EVAP S RGFL+SFPE+FIN G+LLG+V+NY FAK
Sbjct  137  APVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAK  177



>ref|XP_010442571.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=518

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G +NIYS
Sbjct  17   PPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            ++GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   IIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_010472942.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SD+Q+E L+G +NIYS
Sbjct  17   PPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRF+AGIGVGYA+MI
Sbjct  77   LIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_010472919.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SD+Q+E L+G +NIYS
Sbjct  17   PPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRF+AGIGVGYA+MI
Sbjct  77   LIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KPK NK+A+AC++LA  TSILLGYD GVMSGA+I+I+ DL +SD ++  L GT
Sbjct  22   ADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGANIFIQNDLKLSDTEIAVLAGT  81

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AGRTSD IGRRYT+V++G +FFVGA+LMG A  YAFLM GRFVAGIGVG
Sbjct  82   LNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLMGLAPGYAFLMFGRFVAGIGVG  141

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            Y LMIAPVY+ E++P   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  142  YGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYVSNYAFSK  187



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 147/184 (80%), Gaps = 2/184 (1%)
 Frame = +1

Query  16   MASHSAKPPP--ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIY  189
            MA     P    A+  LP  + PP+K    ++A AC++LASMTSILLGYD GVMSGA+++
Sbjct  1    MAEQHKGPTNRVASDGLPDGVAPPRKKSNVRFAFACAILASMTSILLGYDIGVMSGAALF  60

Query  190  IKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFA  369
            IK+DL ISDV+VE L+G +N+YSL+GS  AGRTSD IGRR TI++A  +FFVGA +MGF+
Sbjct  61   IKEDLKISDVEVEVLLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFS  120

Query  370  TNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANY  549
             NY  LM GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY
Sbjct  121  VNYPMLMAGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNY  180

Query  550  SFAK  561
            +F+ 
Sbjct  181  AFSH  184



>ref|XP_009121227.1| PREDICTED: putative polyol transporter 1 [Brassica rapa]
Length=511

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  85   KPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLV  264
            +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK+DL +SDVQ+E L+G +NIYSLV
Sbjct  19   RGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLV  78

Query  265  GSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAP  444
            GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MIAP
Sbjct  79   GSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAP  138

Query  445  VYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VY+AEVAP + RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  139  VYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KPK NK+A+AC++LA  TSILLGYD GVMSGA+I+I+ DL +SD ++  L GT
Sbjct  22   ADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGANIFIQNDLKLSDTEIAVLAGT  81

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AGRTSD IGRRYT+V++G +FFVGA+LMG A  YAFLM GRFVAGIGVG
Sbjct  82   LNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLMGLAPGYAFLMFGRFVAGIGVG  141

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            Y LMIAPVY+ E++P   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  142  YGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYVSNYAFSK  187



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KPK NK+A+AC++LA  TSILLGYD GVMSGA+I+I+ DL +SD ++  L GT
Sbjct  22   ADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGANIFIQNDLKLSDTEIAVLAGT  81

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AGRTSD IGRRYT+V++G +FFVGA+LMG A  YAFLM GRFVAGIGVG
Sbjct  82   LNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLMGLAPGYAFLMFGRFVAGIGVG  141

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            Y LMIAPVY+ E++P   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  142  YGLMIAPVYTVEISPTLSRGFLTSFPEVFVNLGILLGYVSNYAFSK  187



>gb|AAG43998.1|AF215837_1 mannitol transporter [Apium graveolens Dulce Group]
Length=513

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D   PK PKRNKYA AC+LLASM SILLGYDTGV+SGASIYIK+DL  SDVQ+E +IG I
Sbjct  12   DTNKPK-PKRNKYAFACALLASMNSILLGYDTGVLSGASIYIKEDLHFSDVQIEIIIGII  70

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            NIYSL+GSA+AGRTSD IGRRYT+V+AG +FF+GA+ MG ATN+AFLM GRFVAGIGVGY
Sbjct  71   NIYSLLGSAIAGRTSDWIGRRYTMVLAGIIFFLGAIFMGLATNFAFLMFGRFVAGIGVGY  130

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            A+MIAPVY+AEVAP S RGFLTSFPEVFIN GVLLG+V+N++FAK
Sbjct  131  AMMIAPVYTAEVAPSSSRGFLTSFPEVFINSGVLLGYVSNFAFAK  175



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KPK NK+A+AC++LA  TSILLGYD GVMSGA+I+I+ DL +SD ++  L GT
Sbjct  22   ADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGANIFIQNDLKLSDTEIAVLAGT  81

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AGRTSD IGRRYT+V++G +FFVGA+LMG A  YAFLM GRFVAGIGVG
Sbjct  82   LNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLMGLAPGYAFLMFGRFVAGIGVG  141

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            Y LMIAPVY+ E++P   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  142  YGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYVSNYAFSK  187



>ref|XP_010495901.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=511

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SD+Q+E L+G +NIYS
Sbjct  17   PPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILNIYS  76

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD +GRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MI
Sbjct  77   LIGSGAAGRTSDWMGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI  136

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEVAP S RGFL+SFPE+FIN G+LLG+V+NY F+K
Sbjct  137  APVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +1

Query  64   ADLG-PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIG  240
            A+LG P K PK+N+YA AC++LASMTSILLGYD GVMSGA IYIK+DL ISD ++  L G
Sbjct  22   AELGVPGKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDFEIGVLAG  81

Query  241  TINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGV  420
            ++NIYSL+GS  AG+TSD IGRRYTIV+AG +FF GA+LMG A NYAFLM GRF+AGIGV
Sbjct  82   SLNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAGIGV  141

Query  421  GYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GYALMIAPVY+AEVAP S RGFL SFPEVFIN G++LG+V+N +F+K
Sbjct  142  GYALMIAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSK  188



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 148/183 (81%), Gaps = 7/183 (4%)
 Frame = +1

Query  34   KPPPAT---SLLPADLGP----PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYI  192
            + P AT   S +P D  P    P+  ++NKYA  C++LASMTSILLGYD GVMSGA+I+I
Sbjct  4    QKPEATKVASQVPHDSLPEAVAPRPRRKNKYAFGCAMLASMTSILLGYDIGVMSGAAIFI  63

Query  193  KQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFAT  372
            + DL ++D Q+E L+G +N+YSLVGS  AGRTSD IGRRYTIV A  +FFVGA++MG A 
Sbjct  64   QDDLHVTDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLAP  123

Query  373  NYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYS  552
            NYAFLMVGRFVAG+GVGYALMIAPVY+AEVAP S RGFLTSF EVFIN G+LLG+V+N++
Sbjct  124  NYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFAEVFINSGILLGYVSNFA  183

Query  553  FAK  561
            F+K
Sbjct  184  FSK  186



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 148/187 (79%), Gaps = 11/187 (6%)
 Frame = +1

Query  28   SAKPPPATSLLPADLGP---------PKKPKRNKYALACSLLASMTSILLGYDTGVMSGA  180
            S + P AT +  A  GP         P+  +  ++A AC++LASMTSILLGYD GVMSGA
Sbjct  2    SDRKPEATKV--ASQGPSVSLPYAVTPRLRRNKRFAFACAMLASMTSILLGYDIGVMSGA  59

Query  181  SIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLM  360
            +I+IK DL +SD Q+E L+G +N+YSLVGS  AGRTSD IGRRYTIV A  +FF+GA++M
Sbjct  60   AIFIKDDLHVSDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFIGAIMM  119

Query  361  GFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFV  540
            G A NYAFLMVGRFVAG+GVGYALMIAPVY+AEVAP S RGFLTSFPEVFIN G+LLG+V
Sbjct  120  GLAPNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINSGILLGYV  179

Query  541  ANYSFAK  561
            +N++FA+
Sbjct  180  SNFAFAR  186



>ref|XP_010905472.1| PREDICTED: polyol transporter 5-like [Elaeis guineensis]
Length=525

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = +1

Query  34   KPPPATSLLPAD-LGPPK-KPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLG  207
            K P  +  LP   LG  K KP  NKYALAC+ LASMTS LLGYD  VMSGAS++I++DL 
Sbjct  5    KQPAVSDPLPNQTLGLEKPKPPTNKYALACATLASMTSTLLGYDIAVMSGASVFIQKDLK  64

Query  208  ISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFL  387
            +SD Q+E L G IN+YSL+GS  AGRTSD IGRRYTI+ A  +FF GA+LMG A NYA L
Sbjct  65   VSDTQIEILAGVINLYSLIGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGLAPNYAIL  124

Query  388  MVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            MVGRFVAGIGVGYALMIAPVY+AEVAP S RGFLTSFPEVFIN GVLLG+V+N++F+K
Sbjct  125  MVGRFVAGIGVGYALMIAPVYTAEVAPTSARGFLTSFPEVFINSGVLLGYVSNFAFSK  182



>ref|XP_004958137.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=515

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A++ LP  +  PKK    ++A AC++LASMTSILLGYD GVMSGAS+YI++DL I+D ++
Sbjct  2    ASAALPEAV-EPKKKGNTRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKITDKEL  60

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L+G +N+YSL+GS  AGRTSD IGRRYTIV A  +FF GA LMGFA NY  LM GRFV
Sbjct  61   EVLMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAAIFFAGAFLMGFAVNYGMLMFGRFV  120

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AG+GVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F++
Sbjct  121  AGVGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSR  172



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            LPA +  PKK    ++A AC++LASMTSILLGYD GVMSGAS+YI++DL I+D Q+E L+
Sbjct  6    LPAAV-EPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKINDTQLEVLM  64

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G +N+YSL+GS  AGRTSD IGRR+TIV A  +FF GA++MGF+ NYA LM GRFVAGIG
Sbjct  65   GILNVYSLIGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGFSVNYAMLMFGRFVAGIG  124

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+N++FA+
Sbjct  125  VGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFAR  172



>ref|XP_009121388.1| PREDICTED: LOW QUALITY PROTEIN: putative polyol transporter 1 
[Brassica rapa]
Length=511

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +1

Query  85   KPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLV  264
            +  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK+DL +SDVQ+E L+G +NIYSLV
Sbjct  19   RGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLV  78

Query  265  GSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAP  444
            GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+MIAP
Sbjct  79   GSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAP  138

Query  445  VYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VY+AEVAP + RGFL+SFPE+FIN G+LLG+V NY F+K
Sbjct  139  VYTAEVAPATSRGFLSSFPEIFINIGILLGYVXNYFFSK  177



>ref|XP_008668471.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA43976.1| TPA: hypothetical protein ZEAMMB73_311171 [Zea mays]
Length=524

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            AT  +P  + P K+P  NKYA AC+LLASM S+LLGYD  VMSGA +++K+DL I+D Q+
Sbjct  4    ATDAVPVAVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQI  63

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L G INIYSL GS  AG TSD +GRRYT+V+A  +FF GA+LMGFA  Y FLMVGRFV
Sbjct  64   EILAGVINIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGFAPGYGFLMVGRFV  123

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AGIGVG+ALMIAPVY+AEVAP S RGFLTSFPEVF NFG+LLG+V+N++FA+
Sbjct  124  AGIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFAR  175



>ref|XP_008800418.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = +1

Query  31   AKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGI  210
            + PPP  +L    L  PKKP RNKYALAC+ LASMTSILLGYD  VMSGAS++I++ L I
Sbjct  12   SDPPPNQTL---ALEKPKKPPRNKYALACATLASMTSILLGYDGAVMSGASVFIQKYLKI  68

Query  211  SDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLM  390
            +D QVE L G I+ ++LVGS  AGRTSD IGRRYTI+ A  +FF GA+LMG A NYA LM
Sbjct  69   NDTQVEILAGIISPFALVGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGLAPNYAILM  128

Query  391  VGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGR VAG+GVGYALMIAPVY+AE+AP S RGFLTSFPEVFIN GVLLG+V+N++FAK
Sbjct  129  VGRLVAGVGVGYALMIAPVYTAEIAPTSSRGFLTSFPEVFINTGVLLGYVSNFAFAK  185



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D  P  KPKRNK+A+ACSLLA   SILLGYD GVMSGA++ I+ DL I+DVQ++ L GT+
Sbjct  8    DFDPSLKPKRNKFAIACSLLACTPSILLGYDIGVMSGANLSIQDDLKINDVQIQILTGTL  67

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            NIYS++GSA+AGRTSD IGRRYT V++G +FFVGA+LMGFA  YAFLM GRFVAGIGVGY
Sbjct  68   NIYSVIGSALAGRTSDWIGRRYTAVLSGAIFFVGAILMGFAPGYAFLMFGRFVAGIGVGY  127

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
             LMI+PVY+AE+AP   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  128  GLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSK  172



>ref|XP_010445995.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = +1

Query  79   PKKPK--RNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINI  252
            PK P+  R+++A AC++LASMTSI+LGYD GVMSGA+I+IK DL +SDVQ+E L+G +NI
Sbjct  15   PKPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEVLMGILNI  74

Query  253  YSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYAL  432
            YS++GS  AGRTSD IGRRYTIV+AG  FF GA+LMGFATNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSIIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  433  MIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            MIAPVY+AEVAP S RGFL+ FPE+FIN G+LLG+V+NY F+K
Sbjct  135  MIAPVYTAEVAPASSRGFLSFFPEIFINIGILLGYVSNYFFSK  177



>ref|XP_003558585.1| PREDICTED: putative polyol transporter 1 [Brachypodium distachyon]
Length=526

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +P  + P K+P  NKYA AC+LLASM S+LLGYD  VMSGA +++K+DL I+D Q+E L 
Sbjct  13   VPVAVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILA  72

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G INIYSL GS  AG TSD +GRRYT+V+A  +FF GA+LMG A NYAFLM GRFVAGIG
Sbjct  73   GVINIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIG  132

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGYALMIAPVY+AEVAP S RGFLTSFPEVF NFG+LLG+V+N++FA+
Sbjct  133  VGYALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFAR  180



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  73   GPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINI  252
            GPP+  K  ++A AC+LLASMTSILLGYD GVMSGA+++IK DL +SD Q+E L+G +N+
Sbjct  18   GPPRTKKNTRFASACALLASMTSILLGYDIGVMSGAALFIKDDLNVSDTQIEILLGILNL  77

Query  253  YSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYAL  432
            YSL+GS  AGRTSD IGRRYTIV A  +FFVGA++MG + NYAFLMVGRFVAGIGVGYAL
Sbjct  78   YSLLGSFAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLSPNYAFLMVGRFVAGIGVGYAL  137

Query  433  MIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            MIAPVY+AEV+P S RGFLTSFPE+FIN G+LLG+V+N++F
Sbjct  138  MIAPVYTAEVSPASSRGFLTSFPEMFINLGILLGYVSNFAF  178



>gb|KHN25431.1| Polyol transporter 5 [Glycine soja]
Length=518

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIY  255
            P KKP+RNKYA AC++LASMTSILLGYD GVMSGA++YI++DL +SDVQ+E L G IN+Y
Sbjct  15   PEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKVSDVQIEILNGIINLY  74

Query  256  SLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALM  435
            S VGS +AGRTSD IGRRYTIV+AG +FFVGA+LMGF+ NYAFLM GRF AG+G+G+A +
Sbjct  75   SPVGSFIAGRTSDWIGRRYTIVLAGAIFFVGAILMGFSPNYAFLMFGRFFAGVGIGFAFL  134

Query  436  IAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            IAPVY++E++P S RGFLTS PEVF+N G+L+G+++NY F+K
Sbjct  135  IAPVYTSEISPSSSRGFLTSLPEVFLNGGILIGYISNYGFSK  176



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 146/184 (79%), Gaps = 2/184 (1%)
 Frame = +1

Query  16   MASHSAKPP--PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIY  189
            MA     P    A+  LP  + PP+K    ++A AC++LASMTSILLGYD GVMSGA+++
Sbjct  1    MAEQHKNPTNRAASDGLPDGVAPPRKKTNVRFAFACAILASMTSILLGYDIGVMSGAALF  60

Query  190  IKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFA  369
            IK+DL ISDV+VE L+G +N+YSL+GS  AGRTSD IGRR TI++A  +FFVGA +MGF+
Sbjct  61   IKEDLKISDVEVEVLLGILNLYSLLGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFS  120

Query  370  TNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANY  549
             NY  LM GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFIN G+LLG+V+NY
Sbjct  121  VNYPMLMAGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINIGILLGYVSNY  180

Query  550  SFAK  561
            +F+ 
Sbjct  181  AFSH  184



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 139/166 (84%), Gaps = 3/166 (2%)
 Frame = +1

Query  70   LGPPKKPKR--NKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            +GPP  PKR  NKYA  C++LAS+ SILLGYD GVMSGA ++IK DL ++D Q+E L+G 
Sbjct  16   MGPPP-PKRGYNKYATGCAMLASLASILLGYDIGVMSGAELFIKDDLKLNDTQIEILLGV  74

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+YSLVGS  AG TSD IGRRYTIV A  +FF GA+LMGFATNYAFLMVGRFVAGIGVG
Sbjct  75   LNLYSLVGSFAAGFTSDWIGRRYTIVFAATIFFTGALLMGFATNYAFLMVGRFVAGIGVG  134

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAP Y+AEVAP S RGFLTSFPEVFIN G+LLG+V+NY+F+ 
Sbjct  135  YALMIAPTYTAEVAPASSRGFLTSFPEVFINSGILLGYVSNYAFSH  180



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P K +   +A AC++LASM SILLGYD GVMSGA+I+IK DL ISDVQVE L+G +N+YS
Sbjct  65   PAKSRNKMFAFACAVLASMASILLGYDIGVMSGAAIFIKDDLKISDVQVEILLGILNLYS  124

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            LVGS  AG TSD IGRRYTIV A  +FFVGA+LMGFATNYAFLM GRFVAGIGVGYALMI
Sbjct  125  LVGSYAAGFTSDWIGRRYTIVFAAGIFFVGAILMGFATNYAFLMAGRFVAGIGVGYALMI  184

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AE+AP S RGFLTSFPEVFIN G+LLG+V+NY FA 
Sbjct  185  APVYTAEIAPASSRGFLTSFPEVFINSGILLGYVSNYGFAH  225



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   PPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIY  255
            P KKP+RNKYA AC++LASMTSILLGYD GVMSGA++YI++DL +SDVQ+E L G IN+Y
Sbjct  28   PEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKVSDVQIEILNGIINLY  87

Query  256  SLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALM  435
            S VGS +AGRTSD IGRRYTIV+AG +FFVGA+LMGF+ NYAFLM GRF AG+G+G+A +
Sbjct  88   SPVGSFIAGRTSDWIGRRYTIVLAGAIFFVGAILMGFSPNYAFLMFGRFFAGVGIGFAFL  147

Query  436  IAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            IAPVY++E++P S RGFLTS PEVF+N G+L+G+++NY F+K
Sbjct  148  IAPVYTSEISPSSSRGFLTSLPEVFLNGGILIGYISNYGFSK  189



>gb|EMS50618.1| Polyol transporter 5 [Triticum urartu]
Length=311

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +PA   P K+   NKYALAC++LASM SILLGYD  VMSGA I++K+DL I+D Q+E L 
Sbjct  9    IPAGEAPAKRAPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLHITDTQIEVLA  68

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G INI+SLVGS  AGRTSD IGRRYT+V+A  +FF GA++MG A  YA LM+GRFVAG+G
Sbjct  69   GIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPGYAVLMLGRFVAGVG  128

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            VGYALMIAPVY+AEVAP S RG LTSFPEVFIN GVLLG+++NY+F
Sbjct  129  VGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNYAF  174



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 144/172 (84%), Gaps = 1/172 (1%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A++ LP  + P KK    K+A AC++L+SMTSILLGYD GVMSGAS+YIK+DL +SD +V
Sbjct  2    ASAALPEAVAPKKK-GNFKFAFACAILSSMTSILLGYDIGVMSGASLYIKKDLKLSDGKV  60

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L+G +N+YSL+GS  AGRTSD IGRRYTIV A  +FF GA+LMGF+ N+  LM GRFV
Sbjct  61   EVLMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALLMGFSVNFGMLMFGRFV  120

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F++
Sbjct  121  AGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSR  172



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 157/187 (84%), Gaps = 7/187 (4%)
 Frame = +1

Query  16   MASHSAK-----PPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGA  180
            MA   +K       P  S+  AD  PPKKPK  K+A+AC++LASMTSILLGYD GVMSGA
Sbjct  3    MADQKSKNNVVSDQPQNSI--ADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGA  60

Query  181  SIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLM  360
            S++IK++L ISDVQVE L GT+NIYSL+GSA+AG+TSD IGRRYTIV+AG +FF+GA+LM
Sbjct  61   SLFIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLM  120

Query  361  GFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFV  540
            GFA NYAFLM GRF+AG+GVGYALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V
Sbjct  121  GFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYV  180

Query  541  ANYSFAK  561
            +N++ AK
Sbjct  181  SNFALAK  187



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKKPK  K+A+AC++LASMTSILLGYD GVMSGAS++IK++L ISDVQVE L GT
Sbjct  22   ADFDPPKKPKTKKFAIACAVLASMTSILLGYDIGVMSGASLFIKENLNISDVQVEVLNGT  81

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AG+TSD IGRRYTIV+AG +FF+GA+LMGFA NYAFLM GRF+AG+GVG
Sbjct  82   LNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVG  141

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V+N++ AK
Sbjct  142  YALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAK  187



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KP  NK+A+AC+ LA MTSILLGYD GVMSGA+I+IK DL I+DVQVE L GT
Sbjct  24   ADFDPPEKPNANKFAIACATLACMTSILLGYDIGVMSGANIFIKDDLKITDVQVEILAGT  83

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GS +AG TSD IGRRYTIV++G +FFVGA+LMG A  Y  LM GRFVAG+GVG
Sbjct  84   LNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFVGAILMGVAPGYGLLMFGRFVAGVGVG  143

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            Y LMIAPVY+ E++P   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  144  YGLMIAPVYTVEISPALSRGFLTSFPEVFVNVGILLGYVSNYAFSK  189



>dbj|BAJ86526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +P  + P K+P  NKYA AC+LLASM S+LLGYD  VMSGA +++K+DL I+D Q+E L 
Sbjct  8    VPVAMAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILA  67

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G I+IYSL+GS +AG TSD +GRRYT+V+A  +FF GA+LMG A NYAFLM GRFVAGIG
Sbjct  68   GIISIYSLLGSLMAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIG  127

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGYALMIAPVY+AEVAP S RGFLT+FPEVF NFG+LLG+V+N++FA+
Sbjct  128  VGYALMIAPVYTAEVAPTSSRGFLTTFPEVFNNFGILLGYVSNFAFAR  175



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   DLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTI  246
            D GP KK KRNK+A AC++LASMTSILLGYD GVMSGA+IYIK+DL ++DVQ+E L+G I
Sbjct  14   DFGPQKKLKRNKFACACAILASMTSILLGYDIGVMSGAAIYIKRDLKVTDVQIEILLGII  73

Query  247  NIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGY  426
            N+YS +GS +AGR SD IGRRYTIV+AG +FFVGAVLMG + NYAFLM GRF AG+G+G+
Sbjct  74   NLYSPIGSYIAGRLSDWIGRRYTIVLAGLIFFVGAVLMGLSPNYAFLMFGRFFAGVGIGF  133

Query  427  ALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            A +IAPVY++EV+P S RGFLTS PEVF+N G+L+G+++NY F+K
Sbjct  134  AFLIAPVYTSEVSPTSSRGFLTSLPEVFLNGGILVGYISNYGFSK  178



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKKPK  K+A+AC++LASMTSILLGYD GVMSGAS++IK++L ISDVQVE L GT
Sbjct  20   ADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASLFIKENLNISDVQVEVLNGT  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AG+TSD IGRRYTIV+AG +FF+GA+LMGFA NYAFLM GRF+AG+GVG
Sbjct  80   LNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V+N++ AK
Sbjct  140  YALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAK  185



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKKPK  K+A+AC++LASMTSILLGYD GVMSGAS++IK++L ISDVQVE L GT
Sbjct  20   ADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASLFIKENLNISDVQVEVLNGT  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AG+TSD IGRRYTIV+AG +FF+GA+LMGFA NYAFLM GRF+AG+GVG
Sbjct  80   LNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V+N++ AK
Sbjct  140  YALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAK  185



>ref|XP_004985338.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=504

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A+  +PA   P K+   NKYALAC++LASM SILLGYD  VMSGA +++KQDL I+D Q+
Sbjct  6    ASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKITDTQI  65

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L G INIYSLVGS  AGRTSD IGRRYT+V+A  +FF GA++MG A +YA LM+GRFV
Sbjct  66   EILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILMLGRFV  125

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            AG+GVGYALMIAPVY+AEVAP S RG LTSFPEVFIN GVLLG+V+NY+F
Sbjct  126  AGVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYVSNYAF  175



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  85   KPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLV  264
            K K NKYALACS+LASMTSILLGYD GVMSGA IYI++DL I+DVQ E ++G +N+YSL+
Sbjct  5    KAKTNKYALACSILASMTSILLGYDIGVMSGAIIYIQKDLKITDVQTEVVMGILNLYSLI  64

Query  265  GSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAP  444
            GSA AGRTSD IGRRYTIV AG +FF GA+LMGFATNYAFLM GRFVAG+GVG+A+MIAP
Sbjct  65   GSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATNYAFLMAGRFVAGVGVGFAMMIAP  124

Query  445  VYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            VY+AEV+P + RG  TS PEVFIN G+LLG+V+N +F+
Sbjct  125  VYAAEVSPPASRGLFTSLPEVFINIGILLGYVSNVAFS  162



>ref|XP_004985337.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=517

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A+  +PA   P K+   NKYALAC++LASM SILLGYD  VMSGA +++KQDL I+D Q+
Sbjct  6    ASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKITDTQI  65

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L G INIYSLVGS  AGRTSD IGRRYT+V+A  +FF GA++MG A +YA LM+GRFV
Sbjct  66   EILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILMLGRFV  125

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            AG+GVGYALMIAPVY+AEVAP S RG LTSFPEVFIN GVLLG+V+NY+F
Sbjct  126  AGVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYVSNYAF  175



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 156/187 (83%), Gaps = 7/187 (4%)
 Frame = +1

Query  16   MASHSAK-----PPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGA  180
            MA   +K       P  S+  AD  PPKKPK  K+A+AC++LASMTSILLGYD GVMSGA
Sbjct  3    MADQKSKNNVVSDQPQNSI--ADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGA  60

Query  181  SIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLM  360
            S++IK++L ISDVQVE L GT+NIYSL+GSA+AG+TSD IGRRYTIV+AG +FF+GA+LM
Sbjct  61   SLFIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLM  120

Query  361  GFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFV  540
            GFA NYAFLM GRF+AG+GVGYALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V
Sbjct  121  GFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYV  180

Query  541  ANYSFAK  561
            +N+  AK
Sbjct  181  SNFPLAK  187



>dbj|BAJ93158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +PA   P K+P  NKYALAC++LASM SILLGYD  VMSGA I++K+DL I+D Q+E L 
Sbjct  9    IPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITDTQIEILA  68

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G INI+SLVGS  AGRTSD IGRRYT+V+A  +FF GA++MG A +YA LM+GRFVAG+G
Sbjct  69   GIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLGRFVAGVG  128

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            VGYALMIAPVY+AEVAP S RG LTSFPEVFIN GVLLG+++N++F
Sbjct  129  VGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNFAF  174



>dbj|BAJ86116.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +PA   P K+P  NKYALAC++LASM SILLGYD  VMSGA I++K+DL I+D Q+E L 
Sbjct  9    IPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITDTQIEILA  68

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G INI+SLVGS  AGRTSD IGRRYT+V+A  +FF GA++MG A +YA LM+GRFVAG+G
Sbjct  69   GIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLGRFVAGVG  128

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            VGYALMIAPVY+AEVAP S RG LTSFPEVFIN GVLLG+++N++F
Sbjct  129  VGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNFAF  174



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   221 bits (564),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKK    ++A AC++LASMTSILLGYD GVMSGA+++IK+DL ISDV+VE L+G +N+YS
Sbjct  24   PKKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLEISDVEVEILLGILNLYS  83

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRR TI++A  +FFVGA +MGF+ NY  LM GRFVAGIGVGYALMI
Sbjct  84   LIGSFAAGRTSDWIGRRLTIILAAAIFFVGAFIMGFSVNYPMLMAGRFVAGIGVGYALMI  143

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F+ 
Sbjct  144  APVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSH  184



>ref|XP_004958138.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=509

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKK    KYA  C++LASM SI+LGYD GVMSGA++YIK+DL I+DVQ+E L+G +N+YS
Sbjct  12   PKKKSNVKYASFCAILASMASIILGYDIGVMSGAALYIKKDLKITDVQLEILMGILNVYS  71

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRR+T+V A  +FF GA+LMGFA NYA LM GRFVAG+GVGYA+MI
Sbjct  72   LIGSFAAGRTSDWIGRRFTVVFAAAIFFAGALLMGFAVNYAMLMAGRFVAGVGVGYAIMI  131

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AE++P + RGFLTSFPEVFIN G+LLG+V+NY+FA+
Sbjct  132  APVYTAEISPAAARGFLTSFPEVFINIGILLGYVSNYAFAR  172



>ref|XP_004983901.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=535

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKK    ++A AC++LASMTSILLGYD GVMSGA+++IK+DL ISDV+VE L+G +N+YS
Sbjct  24   PKKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLEISDVEVEILLGILNLYS  83

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRR TI++A  +FFVGA +MGF+ NY  LM GRFVAGIGVGYALMI
Sbjct  84   LIGSFAAGRTSDWIGRRLTIILAAAIFFVGAFIMGFSVNYPMLMAGRFVAGIGVGYALMI  143

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+NY+F+ 
Sbjct  144  APVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSH  184



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PP+KP  +K+A+AC+ LA MTSILLGYD GVMSGA+I+IK DL I+DVQVE L GT
Sbjct  21   ADFDPPEKPNASKFAIACATLACMTSILLGYDIGVMSGANIFIKDDLKITDVQVEVLAGT  80

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GS +AG TSD IGRRYTIV++G +FF+GA+LMG A  Y  LM GRFVAGIGVG
Sbjct  81   LNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFIGAILMGVAPGYGLLMFGRFVAGIGVG  140

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            Y LMIAPVY+ E++P   RGFLTSFPEVF+N G+LLG+V+NY+F+K
Sbjct  141  YGLMIAPVYTVEISPALSRGFLTSFPEVFVNVGILLGYVSNYAFSK  186



>ref|NP_001147446.1| sorbitol transporter [Zea mays]
 gb|ACF84429.1| unknown [Zea mays]
 gb|ACG27557.1| sorbitol transporter [Zea mays]
 tpg|DAA43973.1| TPA: Sorbitol transporter [Zea mays]
Length=525

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +PA   P K+P  NKYALAC++LASM SILLGYD  VMSGA +++KQDL I+D Q+E L 
Sbjct  15   IPAPEAPAKRPPLNKYALACAVLASMNSILLGYDVSVMSGAQLFMKQDLKITDTQIEILA  74

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G INIYSLVGS  AGRTSD +GRRYT+V+A  +FF GA++MG A +Y  LM+GRFVAG+G
Sbjct  75   GIINIYSLVGSLAAGRTSDWLGRRYTMVLAAAIFFAGALIMGLAPSYTILMLGRFVAGVG  134

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            VGYALMIAPVY+AEV+P S RG LTSFPEVFIN GVLLG+V+NY+F
Sbjct  135  VGYALMIAPVYTAEVSPTSARGLLTSFPEVFINTGVLLGYVSNYAF  180



>ref|XP_007208924.1| hypothetical protein PRUPE_ppb008257mg [Prunus persica]
 gb|EMJ10123.1| hypothetical protein PRUPE_ppb008257mg [Prunus persica]
Length=270

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            KKPKRN YA+ C++LASMTSILLGYD GVMSGASIYI++DL I+DV+VE LIG +N+YSL
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQEDLKITDVEVEILIGILNLYSL  78

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GSA AGRTSD IGRRYTIV AG +FF GA+LMGFATN+AFLMVGRFVAGIGVGYALMIA
Sbjct  79   IGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNFAFLMVGRFVAGIGVGYALMIA  138

Query  442  PVYSAEVAPESIRGFLTSFPEV  507
            PVY+AEV+P S RG LTSFPEV
Sbjct  139  PVYNAEVSPASSRGALTSFPEV  160



>ref|NP_001049269.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|ABF94464.1| mannitol transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11183.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|EAY88905.1| hypothetical protein OsI_10384 [Oryza sativa Indica Group]
 gb|EAZ25930.1| hypothetical protein OsJ_09774 [Oryza sativa Japonica Group]
 dbj|BAG91937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=517

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +P  + P K+P  NKYA  C+LLASM S+LLGYD  VMSGA I++K+DL I+D Q+E L 
Sbjct  7    VPVAVAPAKRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILA  66

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G INIYSL GS  AG TSD +GRRYT+V+A  +FF GA+LMG A NYAFLM GRFVAGIG
Sbjct  67   GVINIYSLFGSLAAGMTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIG  126

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGYALMIAPVY+AEVAP S RGFLTSFPEVF N G+LLG+V+N++FA+
Sbjct  127  VGYALMIAPVYTAEVAPTSARGFLTSFPEVFNNSGILLGYVSNFAFAR  174



>ref|XP_006297395.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
 gb|EOA30293.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
Length=536

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            K PK NKYA AC++LASMTSILLGYD GVMSGA IYIK+DL ISD ++  L G +NI+SL
Sbjct  27   KPPKMNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLNISDFKIGILAGILNIFSL  86

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            +GS  AG+TSDLIGRRYTIV+AG +FF GA+LMG A NYAFLM GRFVAGIGVGYALMIA
Sbjct  87   IGSCAAGKTSDLIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFVAGIGVGYALMIA  146

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY+AEV+P S RGFLTSFPEVFIN G++LG+V+N +F+ 
Sbjct  147  PVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSN  186



>ref|NP_001150711.1| LOC100284344 [Zea mays]
 gb|ACG40102.1| polyol transporter protein 4 [Zea mays]
 gb|AFW89354.1| polyol transporter protein 4 [Zea mays]
Length=531

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = +1

Query  49   TSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVE  228
            T  +P  + P K+P  NKYA AC+LLASM S+LLGYD  VMSGA +++K+DL I+D Q+E
Sbjct  5    TDAVPVAVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIE  64

Query  229  FLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVA  408
             L G INIYSL GS  AG TSD +GRRYT+V+A  +FF GA+LMG A +Y FLM GRFVA
Sbjct  65   ILAGVINIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYGFLMAGRFVA  124

Query  409  GIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            GIGVG+ALMIAPVY+AEVAP S RGFLTSFPEVF NFG+LLG+V+N++FA+
Sbjct  125  GIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFAR  175



>ref|XP_009407903.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +1

Query  70   LGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTIN  249
            +  P+KPKRN YAL CS LASMTSI+ GYD  VMSGA+++IK DL I D ++E L G IN
Sbjct  1    MAQPEKPKRNMYALGCSCLASMTSIVSGYDVAVMSGANLFIKNDLKIDDTKIEILAGIIN  60

Query  250  IYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYA  429
            +YS++GS  AGRTSD IGRRYT+++A  +FF GA++M  A NYA LM GRFVAG+GVGYA
Sbjct  61   VYSIIGSIAAGRTSDWIGRRYTMILACAIFFTGALVMALAPNYAILMAGRFVAGVGVGYA  120

Query  430  LMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
             MIAPVY+AEVAP S RGFLTSFPEVFINFGVLLG+V+N++FA
Sbjct  121  FMIAPVYAAEVAPASSRGFLTSFPEVFINFGVLLGYVSNFAFA  163



>gb|ABX71752.1| mannitol transporter [Apium graveolens]
Length=524

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 147/172 (85%), Gaps = 5/172 (3%)
 Frame = +1

Query  61   PADLGPP-----KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            P +L  P     KKPK NKYA ACS+LASMTSILLGYDTGVMSGA+IYIK+DL  +DVQ+
Sbjct  15   PKNLSSPLFDAEKKPKNNKYAFACSILASMTSILLGYDTGVMSGAAIYIKKDLRFTDVQI  74

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E ++G INI+SL+GS +AGRTSD IGRRYT+V+AG +FF GA LMG ATN+ FLMVGRFV
Sbjct  75   EIIVGIINIFSLLGSFLAGRTSDWIGRRYTMVLAGGIFFAGAFLMGCATNFEFLMVGRFV  134

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AGIGVGYA+MIAPVY+ EVAP S RGFLTSFPEVFIN GV+LG+V+N++FAK
Sbjct  135  AGIGVGYAMMIAPVYTTEVAPASSRGFLTSFPEVFINAGVMLGYVSNFAFAK  186



>ref|XP_009375838.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=528

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  103  YALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAG  282
            +A+AC++LASMTSILLGYD GVMSGAS++IK++L ISDVQVE L GT+NIYSL+GSA+AG
Sbjct  34   FAVACAILASMTSILLGYDIGVMSGASLFIKENLNISDVQVEVLNGTLNIYSLIGSALAG  93

Query  283  RTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEV  462
            +TSD IGRRYTIV+AG +FF+GA+LMGFA NYAFLM GRF+AG+GVGYALMIAPV +AE+
Sbjct  94   KTSDWIGRRYTIVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVSTAEI  153

Query  463  APESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +P S RGFLTSFPEVF+N G+LLG+V+N++ AK
Sbjct  154  SPASFRGFLTSFPEVFVNVGILLGYVSNFALAK  186



>ref|XP_003562818.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=514

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = +1

Query  49   TSLLPADLGPPKKPKRN--KYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            +S+  A L    +PK++  KYA  CS+LASM +I+LGYD GVMSGAS+YIK+DL I+DVQ
Sbjct  4    SSMASASLPEAVEPKKSNFKYAFTCSILASMATIVLGYDVGVMSGASLYIKKDLQITDVQ  63

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            VE LIG +++Y+LVGS  A RTSD IGRR T+V A  +FF G++LMGFA NYA LMVGRF
Sbjct  64   VEILIGILSLYALVGSFAASRTSDWIGRRVTVVFAATIFFTGSLLMGFAVNYAMLMVGRF  123

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            V GIGVGYA+M+APVY+AEV+P S RGFLTSF EVFINFG+LLG+V+NY+FA+
Sbjct  124  VTGIGVGYAIMVAPVYTAEVSPASARGFLTSFTEVFINFGILLGYVSNYAFAR  176



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = +1

Query  31   AKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGI  210
            A+  P  +    D   P KP RNK+A ACS LASMTS+LLGYD GVMSGA IYI++DL I
Sbjct  2    AEEKPENNAAFFDPAAPPKPTRNKFATACSFLASMTSVLLGYDVGVMSGAIIYIQRDLQI  61

Query  211  SDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLM  390
            +DVQ E ++G   +Y+L+GSA+AGR SD +GRR TIV AG +FF GA+ MG ATNYAFLM
Sbjct  62   TDVQKEVIMGIFGLYALIGSAIAGRISDRVGRRLTIVFAGAIFFFGALFMGLATNYAFLM  121

Query  391  VGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGRFVAGIGVG+ALMIAPVY+AEVAP S RG L SFPE+FIN G+LLG+V+N +F+K
Sbjct  122  VGRFVAGIGVGHALMIAPVYTAEVAPASCRGLLLSFPELFINIGILLGYVSNLAFSK  178



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  73   GPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINI  252
            G P K +  ++A+AC+ +ASM SILLGYD GVMSGA I+IK +L I+D QVE L+G  ++
Sbjct  16   GTPAKRQNKRFAMACATIASMVSILLGYDIGVMSGAVIFIKDNLHITDTQVEILVGVFHL  75

Query  253  YSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYAL  432
            YSL+GS  AGRTSD IGRR TI+ A  +FFVGA++MG A NYAFLMVGRFVAGIGVGYAL
Sbjct  76   YSLIGSTAAGRTSDWIGRRCTIIFAAVIFFVGALMMGLAPNYAFLMVGRFVAGIGVGYAL  135

Query  433  MIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            MIAPVY+AEVAP S RGFLTSFPEVFIN G+LLG+V+NY+FA
Sbjct  136  MIAPVYTAEVAPTSCRGFLTSFPEVFINGGILLGYVSNYAFA  177



>ref|NP_001142160.1| hypothetical protein [Zea mays]
 gb|ACF87781.1| unknown [Zea mays]
 tpg|DAA43977.1| TPA: hypothetical protein ZEAMMB73_311171 [Zea mays]
Length=510

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 129/172 (75%), Gaps = 14/172 (8%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            AT  +P  + P K+P  NKYA AC+LLASM S+LLGYD  VMSGA +++K+DL I+D Q+
Sbjct  4    ATDAVPVAVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQI  63

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
            E L G INIYSL GS  AG TSD +GRRYT              MGFA  Y FLMVGRFV
Sbjct  64   EILAGVINIYSLFGSLAAGLTSDWLGRRYT--------------MGFAPGYGFLMVGRFV  109

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AGIGVG+ALMIAPVY+AEVAP S RGFLTSFPEVF NFG+LLG+V+N++FA+
Sbjct  110  AGIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFAR  161



>ref|XP_008795606.1| PREDICTED: polyol transporter 5-like isoform X1 [Phoenix dactylifera]
Length=522

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            A+  A   P  SLL A    P+  KR  YA AC++LASMTSILLGYD GVMSGA++++K 
Sbjct  8    ATKVAPQVPHDSLLEAVAPRPRHNKR--YAFACAMLASMTSILLGYDIGVMSGAALFMKD  65

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            DL ++D Q+E L+G +N++S+VGS  AGRTSD IGRRYTIV A  +FFVGA++MG A NY
Sbjct  66   DLHVNDTQIEILLGILNLFSIVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLAPNY  125

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            AFLMVGRFVAG+GVGYAL+IAPVY+ E+AP S RGFLTSFPEVFIN G+LLG+V+N++F+
Sbjct  126  AFLMVGRFVAGVGVGYALVIAPVYTTELAPASSRGFLTSFPEVFINSGILLGYVSNFAFS  185

Query  559  K  561
            K
Sbjct  186  K  186



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKKPK  K+A+AC++LASMTSILLGYD GVMS AS++IK++L ISDVQVE L GT
Sbjct  20   ADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSXASLFIKENLNISDVQVEVLNGT  79

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
             NIYSL+GSA+AG+TSD IGRRYTIV+A  +FF+GA+LMGFA NYAFLM GRF+AG+GVG
Sbjct  80   XNIYSLIGSALAGKTSDWIGRRYTIVLAETIFFIGALLMGFAPNYAFLMFGRFIAGVGVG  139

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGFLTSFPEVF+N G+LLG+V+N++ A+
Sbjct  140  YALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAE  185



>dbj|BAC83311.1| putative sorbitol transporter [Oryza sativa Japonica Group]
Length=511

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = +1

Query  43   PATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQ  222
            P ++ L A    PKK K   YA  C++LASM SI+LGYD GVMSGAS+YIK+DL I+DVQ
Sbjct  2    PESTKLTAMAVDPKK-KNASYAFTCAILASMASIILGYDIGVMSGASLYIKKDLKITDVQ  60

Query  223  VEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRF  402
            VE L+G +NIYSLVGS  AGRT+D IGRR+T+V A   FF  A+LMGF+ +YA LMVGRF
Sbjct  61   VEILMGILNIYSLVGSFAAGRTADWIGRRFTVVFAAAFFFARALLMGFSGDYATLMVGRF  120

Query  403  VAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VAG+GVGYA+MIAPVY+AE++P S RGFLTSFPEV IN G+LLG+V+NY+FA+
Sbjct  121  VAGVGVGYAIMIAPVYTAEISPASSRGFLTSFPEVSINLGILLGYVSNYAFAR  173



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  PPKKPK  K+A+AC++LASMTSILLGYD GVMSGAS++IK++L ISDVQVE L GT
Sbjct  22   ADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASLFIKENLNISDVQVEVLNGT  81

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +NIYSL+GSA+AG+TSD IGRRYTIV+AG +FF+GA+LMGFA NYAFLM GRF+AG+GVG
Sbjct  82   LNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVG  141

Query  424  YALMIAPVYSAEVAPESIRGF-LTSFPEVFINFGVLLGFVANYSFAK  561
            YALMIAPVY+AE++P S RGF LTSFPEVF+N G+LLG+V+N++ AK
Sbjct  142  YALMIAPVYTAEISPASFRGFLLTSFPEVFVNVGILLGYVSNFALAK  188



>gb|EMT15230.1| Polyol transporter 5 [Aegilops tauschii]
Length=524

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 143/177 (81%), Gaps = 10/177 (6%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYD---------TGVMSGASIYIKQDLGI  210
            LPA +  PKK    ++A AC++LASMTSILLGYD          GVMSGAS+YI++DL I
Sbjct  6    LPAAV-EPKKKGNVRFAFACAILASMTSILLGYDHFAGSVAYDIGVMSGASLYIQKDLKI  64

Query  211  SDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLM  390
            +D Q+E L+G +N+YSL+GS  AGRTSD IGRR+TIV A  +FF GA++MGF+ NYA LM
Sbjct  65   NDTQLEVLMGILNVYSLIGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGFSVNYAMLM  124

Query  391  VGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
             GRFVAGIGVGYALMIAPVY+AEV+P S RGFLTSFPEVFINFG+LLG+V+N++FA+
Sbjct  125  FGRFVAGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFAR  181



>ref|XP_008800420.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=526

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 3/177 (2%)
 Frame = +1

Query  31   AKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGI  210
            + PPP  +L    L  PKKP RNKYALAC+ LASM SIL GYD  VMSGAS++I++ L I
Sbjct  12   SDPPPNQTL---ALEKPKKPPRNKYALACATLASMISILSGYDGAVMSGASVFIQKYLKI  68

Query  211  SDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLM  390
            +D QVE L G IN ++LVGS  AGRTSD IGRRYTI+ A  +F  GA+LMG A NYA LM
Sbjct  69   NDTQVEILAGIINPFALVGSIAAGRTSDWIGRRYTIIFAAAIFLAGALLMGLAPNYAILM  128

Query  391  VGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGR VAG+G+GYALMIAPVY+AE+AP S RGFLTSFP +FIN G+LLG+V+N +FAK
Sbjct  129  VGRLVAGVGIGYALMIAPVYTAEIAPTSSRGFLTSFPALFINAGILLGYVSNLAFAK  185



>ref|XP_010527168.1| PREDICTED: putative polyol transporter 1 [Tarenaya hassleriana]
Length=362

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = +1

Query  82   KKPKRNK--YALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIY  255
            ++P R++  YA AC++LASM+SI+LGYD GV+SGASI+I+ DL +SD+Q+E  +G +N+Y
Sbjct  14   QQPDRSRRLYATACAVLASMSSIVLGYDIGVVSGASIFIQDDLKLSDLQLEIFMGILNLY  73

Query  256  SLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALM  435
            S+VGS +AGRTSD IGRRYTIV+AGC F  GA+LMGFATNY F+MVGRFVAGIGVGY +M
Sbjct  74   SIVGSGLAGRTSDWIGRRYTIVLAGCFFIAGALLMGFATNYPFIMVGRFVAGIGVGYGMM  133

Query  436  IAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            IAPVY+ EVAP S RGFL+SFPE+FIN G+LLG+V+N+ FA+
Sbjct  134  IAPVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNFFFAQ  175



>ref|XP_002463086.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
 gb|EER99607.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
Length=505

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            P+K    KYA  C++LASM  I++GYD GVMSGA+IYIK+DL I+DVQ+E ++G +NIYS
Sbjct  7    PRKKSNVKYASMCAILASMAVIIVGYDIGVMSGAAIYIKKDLNITDVQLEIVMGILNIYS  66

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRR+T+V A  +FF G++LMGFA NYA LM GRFVAG+GVGYA+MI
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVFAAVIFFAGSLLMGFAVNYAMLMAGRFVAGVGVGYAIMI  126

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AE++P ++RGFLTSFPEVFIN G+LLG+V+N++FA+
Sbjct  127  APVYTAEISPAAVRGFLTSFPEVFINVGILLGYVSNFAFAR  167



>ref|NP_001060109.2| Os07g0582500 [Oryza sativa Japonica Group]
 gb|EAZ40439.1| hypothetical protein OsJ_24894 [Oryza sativa Japonica Group]
 dbj|BAF22023.2| Os07g0582500 [Oryza sativa Japonica Group]
Length=502

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKK K   YA  C++LASM SI+LGYD GVMSGAS+YIK+DL I+DVQVE L+G +NIYS
Sbjct  5    PKK-KNASYAFTCAILASMASIILGYDIGVMSGASLYIKKDLKITDVQVEILMGILNIYS  63

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            LVGS  AGRT+D IGRR+T+V A   FF  A+LMGF+ +YA LMVGRFVAG+GVGYA+MI
Sbjct  64   LVGSFAAGRTADWIGRRFTVVFAAAFFFARALLMGFSGDYATLMVGRFVAGVGVGYAIMI  123

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AE++P S RGFLTSFPEV IN G+LLG+V+NY+FA+
Sbjct  124  APVYTAEISPASSRGFLTSFPEVSINLGILLGYVSNYAFAR  164



>ref|XP_004148312.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
Length=492

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +1

Query  115  CSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSD  294
            C++LASM SILLGYD GVMSGA+IYIK+D  I+DVQ E +IG IN+Y+L+G+A AGRTSD
Sbjct  2    CAILASMASILLGYDVGVMSGAAIYIKKDFQINDVQEEVMIGVINLYALIGAAAAGRTSD  61

Query  295  LIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPES  474
             IGRRYT+V+AG +FF+GA+LMGFATNY FLM GRFVAGIGVGYALMI+PVY+AEV+P S
Sbjct  62   WIGRRYTMVLAGVIFFLGAILMGFATNYEFLMFGRFVAGIGVGYALMISPVYTAEVSPAS  121

Query  475  IRGFLTSFPEVFINFGVLLGFVANYSFAK  561
             RGFLTSFPEVFINFGVLLG+++N+ F+K
Sbjct  122  SRGFLTSFPEVFINFGVLLGYISNFFFSK  150



>gb|EAZ04481.1| hypothetical protein OsI_26630 [Oryza sativa Indica Group]
Length=502

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKK K   YA  C++LASM SI+LGYD GVMSGAS+YIK+DL I+DVQVE L+G +NIYS
Sbjct  5    PKK-KNASYAFTCAILASMASIILGYDIGVMSGASLYIKKDLKITDVQVEILMGILNIYS  63

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            LVGS  AGRT+D IGRR+T+V A   FF GA+LMGF+ +YA LMVGRFVAG+GVGYA+MI
Sbjct  64   LVGSFAAGRTADWIGRRFTVVFAAAFFFAGALLMGFSGDYATLMVGRFVAGVGVGYAIMI  123

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AE++P S RGFLTSFPEV IN G+LLG+V+NY+FA+
Sbjct  124  APVYTAEISPASSRGFLTSFPEVSINLGILLGYVSNYAFAR  164



>ref|XP_007131852.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
 gb|ESW03846.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
Length=519

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            K  K N Y  AC++LAS+TSILLGYD GVMSGA+IYIK+DL +SDV++E L+G  N+YSL
Sbjct  18   KNLKLNNYTFACAILASITSILLGYDIGVMSGAAIYIKRDLKLSDVKIEILVGIFNLYSL  77

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            VGS +AGRTSD IGRRYTIV AG +FFVGA+LMGF+ NYAFLM GRFVAG+G+GYALMIA
Sbjct  78   VGSCLAGRTSDWIGRRYTIVFAGAIFFVGAILMGFSPNYAFLMFGRFVAGVGMGYALMIA  137

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY+AE++P S RGFLTSF +VFIN G+LLG+++NY+ +K
Sbjct  138  PVYTAELSPPSSRGFLTSFTDVFINVGILLGYISNYALSK  177



>ref|XP_008795604.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   216 bits (550),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 145/181 (80%), Gaps = 2/181 (1%)
 Frame = +1

Query  19   ASHSAKPPPATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQ  198
            A+  A   P  SL  A +  P+  KR  YA AC++LASMTSI+LGYD GVMSGA+++I+ 
Sbjct  8    ATKVASQGPHDSLAEAVIPRPRHNKR--YACACAMLASMTSIILGYDIGVMSGAALFIED  65

Query  199  DLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNY  378
            DL ++D Q+E L+G +N+YS+VGS  AGRTSD IGRRYTIV A  +FFVGA++MG A NY
Sbjct  66   DLHVNDTQIEILLGILNLYSIVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLAPNY  125

Query  379  AFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFA  558
            AFLMVGRFVAG+GVGYA +IA VY+AEVAP S RGFLTSFPEVFIN G+LLG+V+N++F+
Sbjct  126  AFLMVGRFVAGVGVGYAAVIAAVYTAEVAPASSRGFLTSFPEVFINCGILLGYVSNFAFS  185

Query  559  K  561
            K
Sbjct  186  K  186



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            +  D  PP+KPK NK+A+ACSL+A  TSIL GYD GVMSGA ++IK DL I+D+Q++   
Sbjct  5    IAEDFDPPQKPKINKFAIACSLMACTTSILHGYDIGVMSGAYLFIKDDLKINDLQIQIFT  64

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            GT+NIYS++GSA+AGRTSD IGR+YT V++G +FFVGA+LMG A  YAFLM GRFVAGIG
Sbjct  65   GTLNIYSVIGSALAGRTSDWIGRQYTAVLSGAIFFVGAILMGVAPGYAFLMFGRFVAGIG  124

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGY LMI+PVY+AE+AP   RGFLTSFPEVF+N G+LLG+V+N  F+K
Sbjct  125  VGYGLMISPVYTAEIAPTLSRGFLTSFPEVFLNIGILLGYVSNCVFSK  172



>gb|EAY88906.1| hypothetical protein OsI_10385 [Oryza sativa Indica Group]
Length=521

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +1

Query  49   TSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVE  228
            +S +PA   P K+   NKYALAC++LASM SILLGYD  VMSGA  ++K+DL ISD +VE
Sbjct  6    SSDVPAAEAPAKRAPLNKYALACAILASMNSILLGYDISVMSGAQKFMKKDLNISDAKVE  65

Query  229  FLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVA  408
             L G INIYSLVGS  AGRTSD IGRRYT+V+A  +FF GA++MG A +YA +M+GRFVA
Sbjct  66   VLAGIINIYSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAIVMLGRFVA  125

Query  409  GIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            G+GVGYALMIAPVY+AEVAP S RG LTSFPEVFIN GVLLG+V+N++F +
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINAGVLLGYVSNFAFYR  176



>gb|EEE58504.1| hypothetical protein OsJ_09775 [Oryza sativa Japonica Group]
Length=521

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +1

Query  49   TSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVE  228
            +S +PA   P K+   NKYALAC++LASM SILLGYD  VMSGA  ++K+DL ISD +VE
Sbjct  6    SSDVPAAEAPAKRAPLNKYALACAILASMNSILLGYDISVMSGAQKFMKKDLNISDAKVE  65

Query  229  FLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVA  408
             L G INIYSLVGS  AGRTSD IGRRYT+V+A  +FF GA++MG A +YA +M+GRFVA
Sbjct  66   VLAGIINIYSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAIVMLGRFVA  125

Query  409  GIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            G+GVGYALMIAPVY+AEVAP S RG LTSFPEVFIN GVLLG+V+N++F +
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINAGVLLGYVSNFAFYR  176



>ref|XP_006649563.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=521

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            K+P  NKYA  C+LLASM S+LLGYD  VMSGA I++K+DL I+D Q+E L G INIYSL
Sbjct  16   KRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILAGVINIYSL  75

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
             GS  AG TSD +GRRYT+V+A  +FF GA+LMG A NYAFLM GRFVAGIGVGYALMIA
Sbjct  76   FGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGYALMIA  135

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY+AEVAP S RGFLTSFPEVF N G+LLG+V+N++FA+
Sbjct  136  PVYTAEVAPTSARGFLTSFPEVFNNSGILLGYVSNFAFAR  175



>ref|XP_010527595.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=334

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            ++PKRN++   C++L SM  ILLGYD GVMSGA IYIK+D+ +SDVQ+E L+G ++IYSL
Sbjct  8    ERPKRNRFPFVCAILVSMILILLGYDIGVMSGAIIYIKRDMKLSDVQIEILVGILSIYSL  67

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            VGS++AGRTSD IGRRYTIV+AG +FF GA+LMGFAT+YAFLM GRFVAG  +G+A MIA
Sbjct  68   VGSSLAGRTSDWIGRRYTIVLAGGIFFAGALLMGFATDYAFLMFGRFVAGFSIGFAGMIA  127

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY AE++P S RGFLTSFPEV +N G+LLG+V+NY+F++
Sbjct  128  PVYIAEISPASSRGFLTSFPEVSVNVGILLGYVSNYAFSR  167



>ref|XP_006658740.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=496

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  58   LPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLI  237
            LPA    PKK K  KYA  C++LASM SI+LGYD GVMSGAS+YIK+DL ISDVQVE L+
Sbjct  8    LPAMSVEPKK-KNVKYAFTCTILASMASIVLGYDIGVMSGASLYIKKDLKISDVQVEILM  66

Query  238  GTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIG  417
            G +NIYSL GS  AGRT+D IGRR+T+V A   FF GA+LM FA +YA LM GRFVAGIG
Sbjct  67   GILNIYSLAGSFAAGRTADWIGRRFTVVFAASFFFAGALLMCFAGDYATLMAGRFVAGIG  126

Query  418  VGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            VGYALMIAPVY+AE++P + RGFLT+FPEV IN G+LLG+V+NY+FA+
Sbjct  127  VGYALMIAPVYTAEISPATSRGFLTTFPEVSINLGILLGYVSNYAFAR  174



>ref|XP_006649564.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=518

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +1

Query  46   ATSLLPADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQV  225
            A+  +PA   P K+   NKYALAC++LASM SILLGYD  VMSGA  ++K+DL ISD ++
Sbjct  5    ASDEIPAAEAPAKRAPLNKYALACAVLASMNSILLGYDISVMSGAQKFMKEDLNISDTKI  64

Query  226  EFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFV  405
              L G INIYSLVGS  AGRTSD IGRRYT+V+A  +FF GA++MG A +YA LM+GRFV
Sbjct  65   AILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAVIFFAGALIMGLAPSYAILMLGRFV  124

Query  406  AGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            AG+GVGYALMIAPVY+AEVAP S RG LTSFPEVFIN GVLLG+V+N++F +
Sbjct  125  AGVGVGYALMIAPVYTAEVAPASARGLLTSFPEVFINTGVLLGYVSNFAFYR  176



>emb|CBI32562.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  133  MTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRY  312
            MTSILLGYD GVMSGA+IYIK+DL ISDV+VE L+G +N+Y L GSA AGRTSD IGRRY
Sbjct  1    MTSILLGYDIGVMSGAAIYIKKDLKISDVEVEILVGILNVYCLFGSAAAGRTSDWIGRRY  60

Query  313  TIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLT  492
            TIV+A  +FF+GA+LMGFATNY FLMVGRFVAGIGVGYALMIAPVY+AEV+P S RGF+T
Sbjct  61   TIVLASVIFFLGALLMGFATNYVFLMVGRFVAGIGVGYALMIAPVYAAEVSPASSRGFIT  120

Query  493  SFPEVFINFGVLLGFVANYSFAK  561
            SFPEVFIN G+L G+++NY+F+K
Sbjct  121  SFPEVFINAGILFGYISNYAFSK  143



>gb|KJB12318.1| hypothetical protein B456_002G011700 [Gossypium raimondii]
Length=525

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 144/182 (79%), Gaps = 4/182 (2%)
 Frame = +1

Query  28   SAKPPPATSLLPAD----LGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIK  195
            S     A S+ PAD        KKPK++K+AL C++LAS+TS+LLGYD GVMSGA I+IK
Sbjct  4    SGHENGAVSIRPADNLAVFEVSKKPKKSKFALGCAMLASLTSMLLGYDIGVMSGAIIFIK  63

Query  196  QDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATN  375
            +DL ISD Q+E L+G +N+Y LVGS VAG  +D IGRRYTI++A  + FVG++ MGF+ N
Sbjct  64   KDLKISDGQIEILVGILNLYCLVGSIVAGTIADWIGRRYTILLANVIIFVGSLFMGFSVN  123

Query  376  YAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            YAFLMVGRF+AGIGVG+A+M A +Y+AE++P S RGFLTSFPEV IN G+LLG+V+NY+F
Sbjct  124  YAFLMVGRFIAGIGVGFAIMGAVLYNAEISPASSRGFLTSFPEVCINVGILLGYVSNYAF  183

Query  556  AK  561
            +K
Sbjct  184  SK  185



>ref|XP_002468337.1| hypothetical protein SORBIDRAFT_01g044010 [Sorghum bicolor]
 gb|EER95335.1| hypothetical protein SORBIDRAFT_01g044010 [Sorghum bicolor]
Length=524

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            K+P  NKYA AC+LLASM S+LLGYD  VMSGA +++K+DL I+D Q+E L G INIYSL
Sbjct  16   KRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVINIYSL  75

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
             GS  AG TSD +GRRYT+V+A  +FF GA+LMG A +Y  LMVGRFVAGIGVG+ALMIA
Sbjct  76   FGSLAAGFTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYGLLMVGRFVAGIGVGFALMIA  135

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            PVY+AEVAP S RGFLTSFPEVF NFG+LLG+V+N++FA+
Sbjct  136  PVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFAR  175



>ref|XP_003558586.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=521

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +1

Query  82   KKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSL  261
            K+   NKYALAC++LASM SILLGYD  VMSGA I+IK+DL ++D  +E L G INI+SL
Sbjct  19   KRAPLNKYALACAVLASMNSILLGYDVSVMSGAQIFIKKDLKVTDTDIEILAGIINIFSL  78

Query  262  VGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIA  441
            VGS  AGRTSD IGRRYT+V+A  +FF GA++MG A +YA LMVGRFVAG+GVGYALMIA
Sbjct  79   VGSLAAGRTSDWIGRRYTMVLAAVIFFAGALIMGLAPSYAVLMVGRFVAGVGVGYALMIA  138

Query  442  PVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSF  555
            PVY+AEVAP S RG LTSFPEVFIN GVLLG+++NY+F
Sbjct  139  PVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNYAF  176



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  64   ADLGPPKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGT  243
            AD  P  KPKRN +A AC++LAS+T+ILLGYD GVMSGA I+IK+DL I+DVQVE L+G 
Sbjct  22   ADFEPANKPKRNLFAFACAVLASLTTILLGYDIGVMSGAIIFIKKDLKINDVQVEILVGI  81

Query  244  INIYSLVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVG  423
            +N+  LVGS  AGRTSD IGRRYTIV+A  +FFVGA+LM FATNYA LM GRF+ GIG G
Sbjct  82   LNLCCLVGSFAAGRTSDWIGRRYTIVLANAIFFVGALLMAFATNYALLMFGRFIGGIGAG  141

Query  424  YALMIAPVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            +A+MIA VY+AE++P S RGFLTSF EV IN G+LLG+V+NY+F+K
Sbjct  142  FAIMIALVYTAELSPASSRGFLTSFTEVSINGGILLGYVSNYAFSK  187



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  133  MTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYSLVGSAVAGRTSDLIGRRY  312
            MTSILLGYD GVMSGAS++IK++L ISDVQVE + GT+N+YSL+GSA+AGRTSD IGRRY
Sbjct  1    MTSILLGYDIGVMSGASLFIKENLKISDVQVEIMNGTLNLYSLIGSALAGRTSDWIGRRY  60

Query  313  TIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMIAPVYSAEVAPESIRGFLT  492
            TIV+AG +FF+GA+LMGFA NYAFLM GRFVAG+GVGYALMIAPVY+AE++P S RGFLT
Sbjct  61   TIVLAGTIFFIGALLMGFAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPASFRGFLT  120

Query  493  SFPEVFINFGVLLGFVANYSFAK  561
            SFPEVF+N G+LLG+V+NY+F+K
Sbjct  121  SFPEVFVNIGILLGYVSNYAFSK  143



>ref|XP_004958139.1| PREDICTED: putative polyol transporter 1-like [Setaria italica]
Length=508

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   PKKPKRNKYALACSLLASMTSILLGYDTGVMSGASIYIKQDLGISDVQVEFLIGTINIYS  258
            PKK     YA  CS+LASM SI+LGYD GVMSGA++YIK+DL I+DVQ+E L+G +N YS
Sbjct  7    PKKKSNVTYAFICSILASMASIILGYDIGVMSGAALYIKKDLKITDVQLEILMGILNFYS  66

Query  259  LVGSAVAGRTSDLIGRRYTIvvagcvffvgavLMGFATNYAFLMVGRFVAGIGVGYALMI  438
            L+GS  AGRTSD IGRR+T+VVA   FF GA+LMG A +YA LM GRFVAG+GVGY LMI
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVVAAAFFFSGALLMGLAGDYATLMFGRFVAGVGVGYGLMI  126

Query  439  APVYSAEVAPESIRGFLTSFPEVFINFGVLLGFVANYSFAK  561
            APVY+AEV+P S RGFLTSF EVFIN G+LLG+V+NY+FA+
Sbjct  127  APVYTAEVSPASARGFLTSFSEVFINIGILLGYVSNYAFAR  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880