BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J16

Length=527
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010648365.1|  PREDICTED: probable protein phosphatase 2C 53    57.0    2e-06   
emb|CBI20679.3|  unnamed protein product                              56.6    2e-06   Vitis vinifera
ref|XP_008220516.1|  PREDICTED: probable protein phosphatase 2C 6     54.7    8e-06   
ref|XP_010262014.1|  PREDICTED: protein phosphatase 2C 16-like        54.7    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_007223074.1|  hypothetical protein PRUPE_ppa003748mg           54.3    1e-05   Prunus persica
ref|XP_009601902.1|  PREDICTED: probable protein phosphatase 2C 5...  54.3    1e-05   Nicotiana tomentosiformis
ref|XP_009798001.1|  PREDICTED: probable protein phosphatase 2C 6...  53.1    3e-05   Nicotiana sylvestris
ref|XP_008445513.1|  PREDICTED: protein phosphatase 2C 77-like is...  52.8    4e-05   Cucumis melo [Oriental melon]
ref|XP_004144202.1|  PREDICTED: protein phosphatase 2C 16-like        52.4    6e-05   Cucumis sativus [cucumbers]
ref|XP_008445517.1|  PREDICTED: protein phosphatase 2C 16-like is...  52.0    6e-05   
ref|XP_004167207.1|  PREDICTED: protein phosphatase 2C 16-like        52.0    6e-05   
ref|XP_009362332.1|  PREDICTED: probable protein phosphatase 2C 50    50.8    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_010247361.1|  PREDICTED: probable protein phosphatase 2C 53    50.8    2e-04   
ref|XP_006371857.1|  hypothetical protein POPTR_0018s04570g           50.4    2e-04   
ref|XP_009334717.1|  PREDICTED: probable protein phosphatase 2C 50    50.4    2e-04   
ref|XP_002324741.2|  hypothetical protein POPTR_0018s04570g           50.4    2e-04   
ref|XP_002516100.1|  protein phosphatase 2c, putative                 50.1    3e-04   Ricinus communis
ref|XP_008351947.1|  PREDICTED: probable protein phosphatase 2C 53    49.7    3e-04   
ref|XP_010094964.1|  Protein phosphatase 2C 16                        49.7    4e-04   Morus notabilis
ref|XP_004498842.1|  PREDICTED: protein phosphatase 2C 16-like is...  49.7    4e-04   
gb|AFL56849.1|  protein phosphatase 2C                                48.9    8e-04   Cucumis sativus [cucumbers]
ref|XP_011013159.1|  PREDICTED: probable protein phosphatase 2C 53    48.5    0.001   Populus euphratica



>ref|XP_010648365.1| PREDICTED: probable protein phosphatase 2C 53 [Vitis vinifera]
 ref|XP_010648366.1| PREDICTED: probable protein phosphatase 2C 53 [Vitis vinifera]
Length=551

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AV VPFRLGN +CDN    +HMDVTR K M D  + SL SD
Sbjct  1    MEEMSPAVAVPFRLGNSVCDNPTVASHMDVTRFKLMTD--ATSLLSD  45



>emb|CBI20679.3| unnamed protein product [Vitis vinifera]
Length=505

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AV VPFRLGN +CDN    +HMDVTR K M D  + SL SD
Sbjct  1    MEEMSPAVAVPFRLGNSVCDNPTVASHMDVTRFKLMTD--ATSLLSD  45



>ref|XP_008220516.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
 ref|XP_008220517.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
 ref|XP_008220518.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
 ref|XP_008220519.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
 ref|XP_008220521.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
Length=551

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AV VPFR+GN +CDN     HMDVTRLK M DT    L SD
Sbjct  1    MEEMSPAVTVPFRVGNSVCDNPNIATHMDVTRLKLMTDT--AGLLSD  45



>ref|XP_010262014.1| PREDICTED: protein phosphatase 2C 16-like [Nelumbo nucifera]
Length=568

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AV VPFRLGN ICDN     HM++TRLK + D  + SL SD
Sbjct  1    MEEMSPAVAVPFRLGNTICDNSAIATHMEITRLKLLTD--AASLLSD  45



>ref|XP_007223074.1| hypothetical protein PRUPE_ppa003748mg [Prunus persica]
 gb|EMJ24273.1| hypothetical protein PRUPE_ppa003748mg [Prunus persica]
Length=551

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AV VPFR+GN +CDN     HMDVTRLK M DT    L SD
Sbjct  1    MEEMSPAVTVPFRVGNSVCDNPNIATHMDVTRLKLMTDT--AGLLSD  45



>ref|XP_009601902.1| PREDICTED: probable protein phosphatase 2C 53 isoform X1 [Nicotiana 
tomentosiformis]
Length=540

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPS  500
            M+EMY+AV VPF  GN IC N   G+++D TRLK M DT S
Sbjct  3    MEEMYRAVAVPFVFGNLICHNPSLGSYLDFTRLKSMDDTTS  43



>ref|XP_009798001.1| PREDICTED: probable protein phosphatase 2C 6 isoform X1 [Nicotiana 
sylvestris]
Length=538

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPS  500
            M EMY AV VPF  GN IC N   G++MD TRLK M DT S
Sbjct  1    MKEMYPAVAVPFIFGNLICHNPSLGSYMDFTRLKSMDDTAS  41



>ref|XP_008445513.1| PREDICTED: protein phosphatase 2C 77-like isoform X1 [Cucumis 
melo]
 ref|XP_008445514.1| PREDICTED: protein phosphatase 2C 77-like isoform X1 [Cucumis 
melo]
 ref|XP_008445515.1| PREDICTED: protein phosphatase 2C 77-like isoform X1 [Cucumis 
melo]
 ref|XP_008445516.1| PREDICTED: protein phosphatase 2C 77-like isoform X1 [Cucumis 
melo]
Length=553

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AVVVPFR+GN +CDN      MD+TRLK M DT    L SD
Sbjct  1    MEEMSPAVVVPFRVGNSVCDNPNMATPMDITRLKLMADT--AGLLSD  45



>ref|XP_004144202.1| PREDICTED: protein phosphatase 2C 16-like [Cucumis sativus]
 gb|KGN47603.1| hypothetical protein Csa_6G363590 [Cucumis sativus]
Length=553

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AVVVPFR+GN +CDN      MD+TRLK M DT    L SD
Sbjct  1    MEEMSPAVVVPFRVGNSVCDNPNMATPMDITRLKLMADT--AGLLSD  45



>ref|XP_008445517.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Cucumis 
melo]
Length=447

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AVVVPFR+GN +CDN      MD+TRLK M DT    L SD
Sbjct  1    MEEMSPAVVVPFRVGNSVCDNPNMATPMDITRLKLMADT--AGLLSD  45



>ref|XP_004167207.1| PREDICTED: protein phosphatase 2C 16-like [Cucumis sativus]
Length=553

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AVVVPFR+GN +CDN      MD+TRLK M DT    L SD
Sbjct  1    MEEMSPAVVVPFRVGNSVCDNPNMATPMDITRLKLMADT--AGLLSD  45



>ref|XP_009362332.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
 ref|XP_009362340.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
Length=552

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM   V VPFR+GN +CDN     HMD+TRLK M +T    L SD
Sbjct  1    MEEMSPPVAVPFRVGNSVCDNPTIAVHMDITRLKLMTNT--AGLLSD  45



>ref|XP_010247361.1| PREDICTED: probable protein phosphatase 2C 53 [Nelumbo nucifera]
 ref|XP_010247362.1| PREDICTED: probable protein phosphatase 2C 53 [Nelumbo nucifera]
 ref|XP_010247363.1| PREDICTED: probable protein phosphatase 2C 53 [Nelumbo nucifera]
 ref|XP_010247364.1| PREDICTED: probable protein phosphatase 2C 53 [Nelumbo nucifera]
Length=566

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AV VPFRL + ICDN     HM++TRLK + DT   SL SD
Sbjct  1    MEEMSPAVAVPFRLDSSICDNSAVAPHMEITRLKLITDT--ASLLSD  45



>ref|XP_006371857.1| hypothetical protein POPTR_0018s04570g [Populus trichocarpa]
 gb|ERP49654.1| hypothetical protein POPTR_0018s04570g [Populus trichocarpa]
Length=578

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EMY+AV VPFR+GN +C++     HMD+TRL  M DT   SL SD
Sbjct  1    MEEMYRAVAVPFRVGNSVCESPSLDTHMDITRLL-MADT--ASLLSD  44



>ref|XP_009334717.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
 ref|XP_009334718.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
 ref|XP_009334719.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
 ref|XP_009334720.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
Length=552

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDT  494
            M++M  AV +PFR+GN +CDN    AH+D+TRLK M +T
Sbjct  1    MEDMSPAVALPFRVGNSVCDNPTIAAHIDITRLKLMKNT  39



>ref|XP_002324741.2| hypothetical protein POPTR_0018s04570g [Populus trichocarpa]
 gb|EEF03306.2| hypothetical protein POPTR_0018s04570g [Populus trichocarpa]
Length=551

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EMY+AV VPFR+GN +C++     HMD+TRL  M DT   SL SD
Sbjct  1    MEEMYRAVAVPFRVGNSVCESPSLDTHMDITRLL-MADT--ASLLSD  44



>ref|XP_002516100.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF46102.1| protein phosphatase 2c, putative [Ricinus communis]
Length=550

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+E++  V VPFR+GN IC+N     H+++TRLK M DT +  L SD
Sbjct  1    MEEIFLTVAVPFRVGNSICENPTIDTHLEITRLKFMADT-AAGLLSD  46



>ref|XP_008351947.1| PREDICTED: probable protein phosphatase 2C 53 [Malus domestica]
Length=552

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 2/47 (4%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M++M   V VPFR+GN +CDN     HMD+TRLK M +T    L SD
Sbjct  1    MEDMSTPVAVPFRVGNSVCDNPTIAVHMDITRLKLMTNT--AGLLSD  45



>ref|XP_010094964.1| Protein phosphatase 2C 16 [Morus notabilis]
 gb|EXB57657.1| Protein phosphatase 2C 16 [Morus notabilis]
Length=548

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDN-QIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EM  AV VPF +GN +CDN  IA  H+D+TRLK M DT    L SD
Sbjct  1    MEEMSPAVAVPFGVGNSVCDNPTIANNHLDITRLKLMTDT--AGLLSD  46



>ref|XP_004498842.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Cicer arietinum]
 ref|XP_004498843.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Cicer arietinum]
 ref|XP_004498844.1| PREDICTED: protein phosphatase 2C 16-like isoform X3 [Cicer arietinum]
 ref|XP_004498845.1| PREDICTED: protein phosphatase 2C 16-like isoform X4 [Cicer arietinum]
Length=546

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPS  506
            M+E+   V VP  +GN +CDN I   HMDV+R K M DT S S
Sbjct  1    MEEVLYVVTVPLIVGNIVCDNSIIATHMDVSRFKVMADTGSLS  43



>gb|AFL56849.1| protein phosphatase 2C [Cucumis sativus]
Length=670

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 28/44 (64%), Gaps = 2/44 (5%)
 Frame = +3

Query  387  MYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M  AVVVPFR+GN +CDN      MD+TRLK M DT    L SD
Sbjct  1    MSPAVVVPFRVGNSVCDNPNMATPMDITRLKLMADT--AGLLSD  42



>ref|XP_011013159.1| PREDICTED: probable protein phosphatase 2C 53 [Populus euphratica]
 ref|XP_011013161.1| PREDICTED: probable protein phosphatase 2C 53 [Populus euphratica]
 ref|XP_011013162.1| PREDICTED: probable protein phosphatase 2C 53 [Populus euphratica]
 ref|XP_011013163.1| PREDICTED: probable protein phosphatase 2C 53 [Populus euphratica]
Length=546

 Score = 48.5 bits (114),  Expect = 0.001, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +3

Query  378  MDEMYQAVVVPFRLGNFICDNQIAGAHMDVTRLKEMGDTPSPSLFSD  518
            M+EMY+AV VPFR+GN +C +     HMD+TRL  M DT   SL SD
Sbjct  1    MEEMYRAVAVPFRVGNSVCGSPSLDTHMDMTRLL-MADT--ASLLSD  44



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600