BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J15

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011085427.1|  PREDICTED: regulatory protein NPR3-like            233   1e-69   
ref|XP_009786055.1|  PREDICTED: regulatory protein NPR3-like isof...    213   4e-62   Nicotiana sylvestris
ref|XP_009786050.1|  PREDICTED: regulatory protein NPR3-like isof...    213   6e-62   Nicotiana sylvestris
ref|XP_009777172.1|  PREDICTED: regulatory protein NPR3-like isof...    209   3e-61   Nicotiana sylvestris
gb|ABA60140.1|  NPR1-like protein                                       202   3e-61   Platanus x hispanica [London plane tree]
gb|ABA60139.1|  NPR1-like protein                                       201   5e-61   Platanus x hispanica [London plane tree]
gb|ABA38916.1|  NPR1-like protein                                       201   6e-61   Prunus avium [gean]
gb|ABA60144.1|  NPR1-like protein                                       202   6e-61   Platanus x hispanica [London plane tree]
gb|ABA60145.1|  NPR1-like protein                                       201   7e-61   Platanus x hispanica [London plane tree]
gb|ABA41258.1|  NPR1-like protein                                       201   8e-61   Platanus x hispanica [London plane tree]
gb|ABA60146.1|  NPR1-like protein                                       201   1e-60   Platanus x hispanica [London plane tree]
gb|ABA38912.1|  NPR1-like protein                                       201   1e-60   Prunus avium [gean]
ref|XP_009777160.1|  PREDICTED: regulatory protein NPR3-like isof...    209   1e-60   Nicotiana sylvestris
ref|XP_003545296.1|  PREDICTED: regulatory protein NPR3-like            209   2e-60   
emb|CDP17457.1|  unnamed protein product                                209   3e-60   Coffea canephora [robusta coffee]
gb|ABA60143.1|  NPR1-like protein                                       200   3e-60   Platanus x hispanica [London plane tree]
gb|ABA41270.1|  NPR1-like protein                                       200   3e-60   Prunus laurocerasus [English laurel]
gb|KHN11992.1|  Regulatory protein NPR3                                 208   4e-60   Glycine soja [wild soybean]
ref|XP_006644769.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    209   4e-60   Oryza brachyantha
gb|KHN38349.1|  Regulatory protein NPR3                                 206   4e-60   Glycine soja [wild soybean]
gb|ABA38917.1|  NPR1-like protein                                       199   4e-60   Prunus avium [gean]
ref|XP_010092646.1|  Regulatory protein                                 207   5e-60   Morus notabilis
gb|ABA38918.1|  NPR1-like protein                                       199   5e-60   Prunus serrulata
gb|ABA41273.1|  NPR1-like protein                                       199   5e-60   Prunus laurocerasus [English laurel]
gb|ABB59685.1|  NPR1-like protein                                       199   7e-60   Prunus serrulata
gb|ABA38915.1|  NPR1-like protein                                       198   1e-59   Prunus avium [gean]
gb|ABA38914.1|  NPR1-like protein                                       198   1e-59   Prunus avium [gean]
gb|ABA41268.1|  NPR1-like protein                                       197   2e-59   Prunus laurocerasus [English laurel]
gb|ABA38911.1|  NPR1-like protein                                       200   2e-59   Prunus avium [gean]
gb|ABA41265.1|  NPR1-like protein                                       198   2e-59   Prunus laurocerasus [English laurel]
ref|XP_003519533.1|  PREDICTED: regulatory protein NPR3-like isof...    206   2e-59   Glycine max [soybeans]
ref|XP_004303897.1|  PREDICTED: regulatory protein NPR3-like            206   3e-59   Fragaria vesca subsp. vesca
gb|ABB59684.1|  NPR1-like protein                                       197   5e-59   Prunus serrulata
gb|ABA41259.1|  NPR1-like protein                                       196   7e-59   Platanus x hispanica [London plane tree]
gb|ABA41271.1|  NPR1-like protein                                       196   8e-59   Prunus laurocerasus [English laurel]
gb|ABA41267.1|  NPR1-like protein                                       196   8e-59   Prunus laurocerasus [English laurel]
gb|ABA41272.1|  NPR1-like protein                                       196   2e-58   Prunus laurocerasus [English laurel]
gb|KDO44757.1|  hypothetical protein CISIN_1g007550mg                   202   2e-58   Citrus sinensis [apfelsine]
emb|CBI29072.3|  unnamed protein product                                200   2e-58   Vitis vinifera
ref|XP_006366625.1|  PREDICTED: regulatory protein NPR3-like            203   2e-58   Solanum tuberosum [potatoes]
gb|ABA38913.1|  NPR1-like protein                                       195   3e-58   Prunus avium [gean]
gb|AGI38063.1|  nonexpressor of pathogenesis-related protein 1          200   5e-58   Arachis appressipila [amendoim bravo]
gb|AGI38060.1|  nonexpressor of pathogenesis-related protein 1          200   5e-58   Arachis hypogaea [goober]
ref|XP_007214958.1|  hypothetical protein PRUPE_ppa003232mg             202   6e-58   Prunus persica
ref|XP_011040366.1|  PREDICTED: regulatory protein NPR3-like isof...    202   6e-58   Populus euphratica
ref|XP_004491374.1|  PREDICTED: regulatory protein NPR3-like            202   7e-58   
ref|XP_009629505.1|  PREDICTED: regulatory protein NPR3-like            202   7e-58   
gb|KDO44756.1|  hypothetical protein CISIN_1g007550mg                   202   7e-58   Citrus sinensis [apfelsine]
ref|XP_011040365.1|  PREDICTED: regulatory protein NPR3-like isof...    202   7e-58   Populus euphratica
ref|XP_009621669.1|  PREDICTED: regulatory protein NPR3-like            202   7e-58   
ref|XP_002322351.2|  ankyrin repeat family protein                      202   7e-58   Populus trichocarpa [western balsam poplar]
ref|XP_006437091.1|  hypothetical protein CICLE_v10031020mg             202   8e-58   Citrus clementina [clementine]
gb|KDO44755.1|  hypothetical protein CISIN_1g007550mg                   202   9e-58   Citrus sinensis [apfelsine]
gb|AGI38077.1|  nonexpressor of pathogenesis-related protein 1          199   9e-58   Arachis rigonii
ref|XP_010655930.1|  PREDICTED: regulatory protein NPR3 isoform X2      199   1e-57   Vitis vinifera
ref|XP_007214668.1|  hypothetical protein PRUPE_ppa003290mg             201   1e-57   Prunus persica
gb|ABA38910.1|  NPR1-like protein                                       196   1e-57   Prunus avium [gean]
gb|AGI38074.1|  nonexpressor of pathogenesis-related protein 1          199   1e-57   Arachis pusilla [amendoim de caracar]
ref|XP_009356589.1|  PREDICTED: regulatory protein NPR3-like            201   2e-57   Pyrus x bretschneideri [bai li]
gb|ABA41263.1|  NPR1-like protein                                       193   2e-57   Prunus laurocerasus [English laurel]
gb|AGI38069.1|  nonexpressor of pathogenesis-related protein 1          199   2e-57   Arachis hypogaea [goober]
gb|EEC71545.1|  hypothetical protein OsI_03882                          201   2e-57   Oryza sativa Indica Group [Indian rice]
gb|AGI38075.1|  nonexpressor of pathogenesis-related protein 1          199   2e-57   Arachis appressipila [amendoim bravo]
gb|AGI38064.1|  nonexpressor of pathogenesis-related protein 1          199   2e-57   Arachis triseminata
gb|AIM54370.1|  nonexpressor of pathogenesis-related protein 1          201   2e-57   Gladiolus hybrid cultivar
gb|AGI38062.1|  nonexpressor of pathogenesis-related protein 1          199   2e-57   Arachis glabrata [amendoim-bravo]
gb|ABF48718.1|  ankyrin repeat BTB/POZ domain-containing protein        202   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_008225741.1|  PREDICTED: regulatory protein NPR3-like            200   4e-57   Prunus mume [ume]
ref|XP_010908601.1|  PREDICTED: regulatory protein NPR3-like            200   4e-57   Elaeis guineensis
gb|AGI38059.1|  nonexpressor of pathogenesis-related protein 1          198   4e-57   Arachis hypogaea [goober]
gb|EYU42809.1|  hypothetical protein MIMGU_mgv1a003347mg                200   4e-57   Erythranthe guttata [common monkey flower]
ref|NP_001044363.1|  Os01g0767900                                       201   4e-57   
gb|AGI38061.1|  nonexpressor of pathogenesis-related protein 1          197   5e-57   Arachis hypogaea [goober]
gb|ABA41254.1|  NPR1-like protein                                       191   5e-57   Cydonia oblonga [wen po]
gb|AGI38065.1|  nonexpressor of pathogenesis-related protein 1          197   5e-57   Arachis hypogaea [goober]
dbj|BAD53355.1|  putative NPR1                                          200   5e-57   Oryza sativa Japonica Group [Japonica rice]
gb|AGI38066.1|  nonexpressor of pathogenesis-related protein 1          197   5e-57   Arachis hypogaea [goober]
gb|ABA41289.1|  NPR1-like protein                                       191   5e-57   Cydonia oblonga [wen po]
ref|XP_002274045.1|  PREDICTED: regulatory protein NPR3 isoform X1      199   8e-57   Vitis vinifera
ref|XP_010272311.1|  PREDICTED: regulatory protein NPR3 isoform X1      199   8e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010272312.1|  PREDICTED: regulatory protein NPR3 isoform X2      199   9e-57   Nelumbo nucifera [Indian lotus]
gb|ABA38908.1|  NPR1-like protein                                       191   9e-57   Pyrus communis
ref|XP_008229582.1|  PREDICTED: regulatory protein NPR3-like            199   9e-57   Prunus mume [ume]
gb|AGI38068.1|  nonexpressor of pathogenesis-related protein 1          197   1e-56   Arachis hypogaea [goober]
gb|ABA38920.1|  NPR1-like protein                                       191   1e-56   Cydonia oblonga [wen po]
gb|ABA38904.1|  NPR1-like protein                                       191   1e-56   Pyrus communis
ref|XP_008806697.1|  PREDICTED: regulatory protein NPR3-like            199   1e-56   
ref|XP_007213800.1|  hypothetical protein PRUPE_ppa003221mg             199   1e-56   Prunus persica
gb|ABA38907.1|  NPR1-like protein                                       190   2e-56   Pyrus communis
gb|AEE81755.1|  regulatory protein NPR2                                 197   4e-56   Populus deltoides
ref|XP_008380174.1|  PREDICTED: regulatory protein NPR3-like            193   4e-56   
gb|KJB69916.1|  hypothetical protein B456_011G050200                    195   4e-56   Gossypium raimondii
gb|AGI38071.1|  nonexpressor of pathogenesis-related protein 1          195   5e-56   Arachis hypogaea [goober]
ref|XP_010942675.1|  PREDICTED: regulatory protein NPR3-like            197   5e-56   Elaeis guineensis
ref|NP_001233844.1|  NIM1-like protein 2                                196   1e-55   Solanum lycopersicum
ref|XP_008225738.1|  PREDICTED: regulatory protein NPR3-like            196   1e-55   Prunus mume [ume]
gb|ACJ45014.1|  NPR1-2 protein                                          194   1e-55   Glycine max [soybeans]
gb|ABA38909.1|  NPR1-like protein                                       187   2e-55   Pyrus communis
gb|AGL61506.1|  NPR1                                                    196   2e-55   Morus alba var. multicaulis
gb|KJB69919.1|  hypothetical protein B456_011G050200                    195   2e-55   Gossypium raimondii
gb|ABA38902.1|  NPR1-like protein                                       190   2e-55   Pyrus communis
gb|KDO77445.1|  hypothetical protein CISIN_1g007849mg                   194   2e-55   Citrus sinensis [apfelsine]
ref|XP_008348376.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    195   2e-55   
gb|ABA38906.1|  NPR1-like protein                                       187   3e-55   Pyrus communis
gb|ABA41252.1|  NPR1-like protein                                       186   4e-55   Pyrus communis
gb|ABA38905.1|  NPR1-like protein                                       186   4e-55   Pyrus communis
gb|KJB69920.1|  hypothetical protein B456_011G050200                    195   4e-55   Gossypium raimondii
gb|KDO77446.1|  hypothetical protein CISIN_1g007849mg                   194   4e-55   Citrus sinensis [apfelsine]
ref|XP_007141442.1|  hypothetical protein PHAVU_008G195900g             194   5e-55   Phaseolus vulgaris [French bean]
gb|ADP95762.1|  npr1 protein                                            194   5e-55   Malus hupehensis
gb|KHG00475.1|  Regulatory NPR3 -like protein                           194   7e-55   Gossypium arboreum [tree cotton]
ref|NP_001238674.1|  NPR1-2 protein                                     194   7e-55   Glycine max [soybeans]
gb|KHN14362.1|  Regulatory protein NPR3                                 194   8e-55   Glycine soja [wild soybean]
gb|KDO77444.1|  hypothetical protein CISIN_1g007849mg                   194   9e-55   Citrus sinensis [apfelsine]
gb|ABA41255.1|  NPR1-like protein                                       185   1e-54   Cydonia oblonga [wen po]
ref|XP_004970097.1|  PREDICTED: regulatory protein NPR3-like            193   2e-54   Setaria italica
ref|XP_006468441.1|  PREDICTED: regulatory protein NPR3-like            192   2e-54   Citrus sinensis [apfelsine]
gb|ACC77697.1|  NPR1-like protein                                       192   3e-54   Malus domestica [apple tree]
ref|NP_001280793.1|  regulatory protein NPR3-like                       192   3e-54   Malus domestica [apple tree]
gb|ACJ45012.1|  NPR1-1 protein                                          191   3e-54   Glycine max [soybeans]
gb|KEH28396.1|  NPR1/NIM1-like regulatory protein, putative             190   3e-54   Medicago truncatula
gb|ABK62792.1|  NPR-1                                                   192   3e-54   Pyrus pyrifolia [sha li]
ref|NP_001289241.1|  uncharacterized protein LOC103945128               192   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_004486434.1|  PREDICTED: regulatory protein NPR3-like isof...    192   3e-54   Cicer arietinum [garbanzo]
ref|XP_008787319.1|  PREDICTED: regulatory protein NPR3-like            192   3e-54   
ref|XP_008342333.1|  PREDICTED: regulatory protein NPR3-like            192   4e-54   
ref|XP_004486433.1|  PREDICTED: regulatory protein NPR3-like isof...    192   4e-54   Cicer arietinum [garbanzo]
ref|XP_008451832.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    192   4e-54   
ref|XP_007024872.1|  NPR1-like protein 4                                192   5e-54   Theobroma cacao [chocolate]
gb|KEH37013.1|  regulatory protein NPR1                                 190   5e-54   Medicago truncatula
gb|ABA41253.1|  NPR1-like protein                                       183   7e-54   Cydonia oblonga [wen po]
gb|AFO10948.1|  non-expressor of PR1-like protein                       190   9e-54   Gossypium barbadense [Egyptian cotton]
ref|NP_001238658.1|  NPR1-1 protein                                     191   1e-53   Glycine max [soybeans]
ref|XP_004497710.1|  PREDICTED: regulatory protein NPR3-like            191   1e-53   Cicer arietinum [garbanzo]
gb|KDP22628.1|  hypothetical protein JCGZ_02854                         191   1e-53   Jatropha curcas
gb|AFW84951.1|  regulatory protein NPR1                                 191   1e-53   
gb|AGC39275.1|  NPR1-like3 protein                                      191   1e-53   Theobroma cacao [chocolate]
ref|NP_001147587.1|  regulatory protein NPR1                            191   1e-53   
gb|KJB34938.1|  hypothetical protein B456_006G091900                    187   2e-53   Gossypium raimondii
ref|XP_003594464.1|  NPR1-1 protein                                     190   2e-53   Medicago truncatula
ref|XP_003569900.1|  PREDICTED: regulatory protein NPR3-like            190   3e-53   Brachypodium distachyon [annual false brome]
ref|XP_002520549.1|  Regulatory protein NPR1, putative                  189   3e-53   
gb|AHF20181.1|  ankyrin-repeat protein                                  189   3e-53   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009399066.1|  PREDICTED: regulatory protein NPR3-like isof...    189   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA38903.1|  NPR1-like protein                                       184   4e-53   Pyrus communis
ref|XP_003617362.1|  NPR1-1 protein                                     189   4e-53   Medicago truncatula
ref|XP_002300863.2|  hypothetical protein POPTR_0002s05740g             186   5e-53   
gb|ACU78081.1|  NPR1-like protein                                       189   7e-53   Malus hupehensis
ref|XP_007048936.1|  NPR1-like protein 3, putative                      188   7e-53   
ref|XP_009357279.1|  PREDICTED: regulatory protein NPR3-like            188   9e-53   Pyrus x bretschneideri [bai li]
emb|CDP17620.1|  unnamed protein product                                188   1e-52   Coffea canephora [robusta coffee]
ref|XP_011096773.1|  PREDICTED: regulatory protein NPR3-like            188   1e-52   Sesamum indicum [beniseed]
gb|KHG09335.1|  Regulatory NPR3 -like protein                           188   1e-52   Gossypium arboreum [tree cotton]
gb|ACJ04030.1|  NPR1-like protein                                       187   2e-52   Musa ABB Group [cooking banana]
ref|XP_009399065.1|  PREDICTED: regulatory protein NPR3-like isof...    187   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006376994.1|  hypothetical protein POPTR_0012s11900g             187   2e-52   
gb|KJB34937.1|  hypothetical protein B456_006G091900                    187   2e-52   Gossypium raimondii
ref|XP_007147518.1|  hypothetical protein PHAVU_006G131400g             187   2e-52   Phaseolus vulgaris [French bean]
gb|EMS60174.1|  Regulatory protein NPR4                                 184   4e-52   Triticum urartu
ref|XP_004293734.1|  PREDICTED: regulatory protein NPR3-like            186   5e-52   Fragaria vesca subsp. vesca
ref|XP_008371834.1|  PREDICTED: regulatory protein NPR3 isoform X1      186   6e-52   
ref|XP_009397343.1|  PREDICTED: regulatory protein NPR3-like            186   6e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004303898.1|  PREDICTED: regulatory protein NPR3-like            186   7e-52   Fragaria vesca subsp. vesca
ref|XP_009357280.1|  PREDICTED: regulatory protein NPR3-like isof...    186   8e-52   Pyrus x bretschneideri [bai li]
ref|XP_011001309.1|  PREDICTED: regulatory protein NPR3-like            186   9e-52   Populus euphratica
ref|XP_009341186.1|  PREDICTED: regulatory protein NPR3-like isof...    185   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_010056640.1|  PREDICTED: regulatory protein NPR3-like            185   1e-51   Eucalyptus grandis [rose gum]
gb|EYU43699.1|  hypothetical protein MIMGU_mgv1a003483mg                185   2e-51   Erythranthe guttata [common monkey flower]
gb|ACE86413.1|  NPR1-like protein                                       184   2e-51   Musa ABB Group [cooking banana]
ref|XP_011026213.1|  PREDICTED: regulatory protein NPR3-like            184   3e-51   Populus euphratica
gb|AHF20180.1|  ankyrin-repeat protein                                  184   4e-51   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009377037.1|  PREDICTED: regulatory protein NPR3-like            184   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_004147747.1|  PREDICTED: regulatory protein NPR3-like            183   6e-51   
emb|CAN67078.1|  hypothetical protein VITISV_004499                     184   7e-51   Vitis vinifera
ref|XP_004169978.1|  PREDICTED: regulatory protein NPR3-like            183   8e-51   
ref|XP_009602190.1|  PREDICTED: regulatory protein NPR3-like            183   8e-51   Nicotiana tomentosiformis
ref|NP_001234562.1|  NIM1-like protein 1                                182   2e-50   Solanum lycopersicum
dbj|BAJ94508.1|  predicted protein                                      182   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT27088.1|  hypothetical protein F775_31940                         180   2e-50   
gb|ABN45747.1|  nonexpressor of pathogenesis-related genes 3            182   2e-50   Nicotiana glutinosa
ref|XP_008383328.1|  PREDICTED: regulatory protein NPR3-like            180   7e-50   Malus domestica [apple tree]
ref|XP_008371836.1|  PREDICTED: regulatory protein NPR3 isoform X2      180   9e-50   
ref|XP_009357282.1|  PREDICTED: regulatory protein NPR3-like isof...    180   1e-49   Pyrus x bretschneideri [bai li]
emb|CDM84353.1|  unnamed protein product                                180   1e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009341187.1|  PREDICTED: regulatory protein NPR3-like isof...    179   1e-49   Pyrus x bretschneideri [bai li]
gb|AHA43769.1|  NPR3                                                    179   2e-49   Morus alba var. multicaulis
ref|XP_006353069.1|  PREDICTED: regulatory protein NPR3-like            178   4e-49   Solanum tuberosum [potatoes]
ref|XP_010093184.1|  Regulatory protein                                 178   7e-49   Morus notabilis
ref|XP_010536418.1|  PREDICTED: regulatory protein NPR3-like isof...    176   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_010536434.1|  PREDICTED: regulatory protein NPR3-like isof...    175   4e-48   Tarenaya hassleriana [spider flower]
gb|KCW89778.1|  hypothetical protein EUGRSUZ_A02033                     173   4e-48   Eucalyptus grandis [rose gum]
gb|KDO39256.1|  hypothetical protein CISIN_1g045501mg                   172   4e-48   Citrus sinensis [apfelsine]
gb|KFK41854.1|  hypothetical protein AALP_AA2G179400                    175   7e-48   Arabis alpina [alpine rockcress]
ref|XP_006280229.1|  hypothetical protein CARUB_v10026146mg             174   1e-47   Capsella rubella
gb|KCW89777.1|  hypothetical protein EUGRSUZ_A02033                     172   1e-47   Eucalyptus grandis [rose gum]
gb|AGI38070.1|  nonexpressor of pathogenesis-related protein 1          172   2e-47   Arachis hypogaea [goober]
gb|KJB33389.1|  hypothetical protein B456_006G009000                    173   2e-47   Gossypium raimondii
ref|XP_002307566.2|  hypothetical protein POPTR_0005s22770g             173   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010054033.1|  PREDICTED: regulatory protein NPR3-like            173   3e-47   Eucalyptus grandis [rose gum]
ref|XP_010439666.1|  PREDICTED: regulatory protein NPR4-like            173   3e-47   
ref|XP_010434372.1|  PREDICTED: regulatory protein NPR4                 173   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006437092.1|  hypothetical protein CICLE_v10031432mg             171   5e-47   
ref|XP_006437111.1|  hypothetical protein CICLE_v10031749mg             169   5e-47   
ref|NP_193701.2|  NPR1-like protein 4                                   172   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456404.1|  hypothetical protein SORBIDRAFT_03g035720          172   6e-47   Sorghum bicolor [broomcorn]
emb|CAA19683.1|  putative protein                                       172   7e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011032773.1|  PREDICTED: regulatory protein NPR3-like            172   7e-47   Populus euphratica
ref|XP_006485155.1|  PREDICTED: regulatory protein NPR4-like            172   8e-47   
gb|KDO39140.1|  hypothetical protein CISIN_1g0469551mg                  169   1e-46   Citrus sinensis [apfelsine]
ref|XP_006398160.1|  hypothetical protein EUTSA_v10000824mg             171   1e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010449314.1|  PREDICTED: regulatory protein NPR4-like            171   1e-46   Camelina sativa [gold-of-pleasure]
emb|CDY26398.1|  BnaA02g23720D                                          171   1e-46   Brassica napus [oilseed rape]
ref|XP_006437109.1|  hypothetical protein CICLE_v10031627mg             169   2e-46   
ref|XP_010538609.1|  PREDICTED: regulatory protein NPR3-like            171   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_009776511.1|  PREDICTED: regulatory protein NPR3-like isof...    171   2e-46   Nicotiana sylvestris
ref|XP_009776515.1|  PREDICTED: regulatory protein NPR3-like isof...    171   2e-46   Nicotiana sylvestris
gb|AAT57641.1|  NIM1-like protein 1                                     171   2e-46   Nicotiana tabacum [American tobacco]
gb|KGN53513.1|  hypothetical protein Csa_4G063470                       167   3e-46   Cucumis sativus [cucumbers]
ref|XP_008459083.1|  PREDICTED: regulatory protein NPR3-like            171   3e-46   
ref|XP_006413942.1|  hypothetical protein EUTSA_v10024752mg             168   3e-46   
ref|XP_010441782.1|  PREDICTED: regulatory protein NPR3                 170   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009128768.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    170   4e-46   
dbj|BAB09496.1|  regulatory protein NPR1-like; transcription fact...    169   6e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199324.2|  NPR1-like protein 3                                   169   7e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99350.1|  BnaC01g12020D                                          169   1e-45   
gb|KDO40807.1|  hypothetical protein CISIN_1g014994mg                   166   1e-45   Citrus sinensis [apfelsine]
emb|CDX78955.1|  BnaA01g10220D                                          169   1e-45   
gb|AAT57642.1|  NIM1-like protein 1                                     169   1e-45   Helianthus annuus
gb|KDO39136.1|  hypothetical protein CISIN_1g0389552mg                  162   2e-45   Citrus sinensis [apfelsine]
ref|XP_006413943.1|  hypothetical protein EUTSA_v10024752mg             168   2e-45   
ref|XP_006484991.1|  PREDICTED: regulatory protein NPR4-like isof...    168   2e-45   
ref|XP_006437106.1|  hypothetical protein CICLE_v10030929mg             168   3e-45   Citrus clementina [clementine]
ref|XP_002865280.1|  hypothetical protein ARALYDRAFT_494469             167   4e-45   
ref|XP_006437103.1|  hypothetical protein CICLE_v10031115mg             166   6e-45   
ref|XP_010481651.1|  PREDICTED: regulatory protein NPR3-like            166   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009133120.1|  PREDICTED: regulatory protein NPR4                 165   2e-44   Brassica rapa
ref|XP_010494583.1|  PREDICTED: regulatory protein NPR3                 165   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002867926.1|  predicted protein                                  164   5e-44   Arabidopsis lyrata subsp. lyrata
gb|KDO40806.1|  hypothetical protein CISIN_1g007758mg                   161   1e-43   Citrus sinensis [apfelsine]
ref|XP_006285143.1|  hypothetical protein CARUB_v10006486mg             163   1e-43   Capsella rubella
ref|XP_006437094.1|  hypothetical protein CICLE_v10031258mg             162   2e-43   
ref|XP_006484994.1|  PREDICTED: regulatory protein NPR4-like isof...    161   2e-43   
ref|XP_006484993.1|  PREDICTED: regulatory protein NPR4-like isof...    161   3e-43   
ref|XP_006484992.1|  PREDICTED: regulatory protein NPR4-like isof...    161   5e-43   
ref|XP_009101624.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    158   9e-42   Brassica rapa
ref|XP_006853358.1|  hypothetical protein AMTR_s00032p00112510          157   1e-41   
ref|XP_006437101.1|  hypothetical protein CICLE_v10031310mg             156   2e-41   
ref|XP_006484986.1|  PREDICTED: regulatory protein NPR4-like isof...    155   5e-41   
gb|EEE55442.1|  hypothetical protein OsJ_03589                          152   6e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006484985.1|  PREDICTED: regulatory protein NPR4-like isof...    155   9e-41   
ref|XP_006484984.1|  PREDICTED: regulatory protein NPR4-like isof...    155   1e-40   
ref|XP_006437097.1|  hypothetical protein CICLE_v10031343mg             153   2e-40   
ref|XP_006492802.1|  PREDICTED: regulatory protein NPR3-like            149   2e-39   
gb|ABA41262.1|  NPR1-like protein                                       143   2e-39   Prunus armeniaca
gb|KDO39823.1|  hypothetical protein CISIN_1g008204mg                   150   4e-39   Citrus sinensis [apfelsine]
ref|XP_006437099.1|  hypothetical protein CICLE_v100337992mg            149   5e-39   
gb|ABA41257.1|  NPR1-like protein                                       141   9e-39   Prunus persica
ref|NP_001050850.1|  Os03g0667100                                       148   3e-38   
gb|AAR87167.1|  expressed protein (with alternative splicing)           148   3e-38   Oryza sativa Japonica Group [Japonica rice]
gb|AAR87166.1|  expressed protein (with alternative splicing)           148   3e-38   Oryza sativa Japonica Group [Japonica rice]
gb|ABA60153.1|  NPR1-like protein                                       140   4e-38   Prunus domestica subsp. insititia [damson plum]
gb|EAY91301.1|  hypothetical protein OsI_12918                          148   7e-38   Oryza sativa Indica Group [Indian rice]
gb|ABA60149.1|  NPR1-like protein                                       139   8e-38   Prunus domestica subsp. insititia [damson plum]
gb|ABA60151.1|  NPR1-like protein                                       139   9e-38   Prunus domestica subsp. insititia [damson plum]
ref|XP_006651667.1|  PREDICTED: regulatory protein NPR4-like            146   1e-37   
gb|ABA60154.1|  NPR1-like protein                                       138   2e-37   Prunus domestica subsp. insititia [damson plum]
gb|ABA41260.1|  NPR1-like protein                                       138   2e-37   Prunus armeniaca
gb|ABA41261.1|  NPR1-like protein                                       138   2e-37   Prunus armeniaca
gb|AAU21298.1|  NPR1-like protein                                       140   2e-37   Solanum tuberosum [potatoes]
gb|ABA60148.1|  NPR1-like protein                                       138   2e-37   Prunus domestica subsp. insititia [damson plum]
gb|ABA41283.1|  NPR1-like protein                                       137   5e-37   Cydonia oblonga [wen po]
gb|ABA41256.1|  NPR1-like protein                                       137   6e-37   Cydonia oblonga [wen po]
gb|ABA41276.1|  NPR1-like protein                                       137   6e-37   Prunus laurocerasus [English laurel]
gb|ABA41269.1|  NPR1-like protein                                       136   8e-37   Prunus laurocerasus [English laurel]
gb|ABA60152.1|  NPR1-like protein                                       136   1e-36   Prunus domestica subsp. insititia [damson plum]
gb|ABA41266.1|  NPR1-like protein                                       135   2e-36   Prunus laurocerasus [English laurel]
gb|ABA60155.1|  NPR1-like protein                                       135   3e-36   Prunus domestica subsp. insititia [damson plum]
ref|XP_004982222.1|  PREDICTED: regulatory protein NPR3-like            142   4e-36   Setaria italica
ref|XP_003561461.1|  PREDICTED: regulatory protein NPR3-like            142   4e-36   Brachypodium distachyon [annual false brome]
gb|ABA41286.1|  NPR1-like protein                                       134   5e-36   
gb|ABA41285.1|  NPR1-like protein                                       134   7e-36   
gb|ABA41279.1|  NPR1-like protein                                       133   2e-35   
gb|ABA41281.1|  NPR1-like protein                                       132   2e-35   
gb|ABA41282.1|  NPR1-like protein                                       132   3e-35   
ref|XP_006437095.1|  hypothetical protein CICLE_v10033533mg             139   4e-35   
gb|ABA41264.1|  NPR1-like protein                                       132   5e-35   
ref|XP_006437110.1|  hypothetical protein CICLE_v10033908mg             137   5e-35   
tpg|DAA52628.1|  TPA: hypothetical protein ZEAMMB73_148488              139   7e-35   
gb|KDO39255.1|  hypothetical protein CISIN_1g043128mg                   137   7e-35   
ref|XP_002464110.1|  hypothetical protein SORBIDRAFT_01g012450          138   1e-34   
gb|ABA41280.1|  NPR1-like protein                                       130   2e-34   
ref|XP_008782513.1|  PREDICTED: regulatory protein NPR1                 137   2e-34   
gb|ABA41278.1|  NPR1-like protein                                       130   3e-34   
ref|XP_010924981.1|  PREDICTED: regulatory protein NPR1-like isof...    136   4e-34   
ref|XP_010924982.1|  PREDICTED: regulatory protein NPR1-like isof...    136   4e-34   
ref|XP_010924980.1|  PREDICTED: regulatory protein NPR1-like isof...    135   6e-34   
gb|EMT31331.1|  hypothetical protein F775_00946                         135   9e-34   
gb|KDP33858.1|  hypothetical protein JCGZ_07429                         135   1e-33   
gb|ABA41277.1|  NPR1-like protein                                       128   2e-33   
emb|CDX82577.1|  BnaC07g02890D                                          134   3e-33   
gb|EEC70102.1|  hypothetical protein OsI_00749                          134   4e-33   
ref|XP_010915287.1|  PREDICTED: regulatory protein NPR1-like isof...    133   4e-33   
gb|AAX18700.1|  NPR1-like 1                                             134   4e-33   
ref|NP_001042286.1|  Os01g0194300                                       133   5e-33   
ref|XP_010915286.1|  PREDICTED: regulatory protein NPR1-like isof...    133   6e-33   
gb|AHF20183.1|  non-expressor of pr1                                    133   8e-33   
gb|KJB69918.1|  hypothetical protein B456_011G050200                    132   8e-33   
emb|CDM81616.1|  unnamed protein product                                135   1e-32   
emb|CDY39410.1|  BnaAnng05410D                                          132   1e-32   
gb|ABL63913.1|  NPR1-like protein                                       132   1e-32   
gb|EMT27860.1|  Regulatory protein NPR1                                 132   1e-32   
ref|XP_006645596.1|  PREDICTED: regulatory protein NPR1-like            131   2e-32   
emb|CDM81617.1|  unnamed protein product                                131   2e-32   
gb|EAZ10881.1|  hypothetical protein OsJ_00725                          133   2e-32   
ref|XP_008793215.1|  PREDICTED: regulatory protein NPR1-like            130   3e-32   
gb|EMS58650.1|  Regulatory protein NPR2                                 130   3e-32   
ref|XP_008807141.1|  PREDICTED: regulatory protein NPR1-like            131   3e-32   
ref|XP_009402935.1|  PREDICTED: regulatory protein NPR1-like            131   4e-32   
ref|XP_006448743.1|  hypothetical protein CICLE_v10017873mg             130   4e-32   
gb|EMS49421.1|  Regulatory protein NPR3                                 130   5e-32   
gb|AHG52897.1|  putative regulatory protein NPR1                        129   7e-32   
ref|XP_010925463.1|  PREDICTED: regulatory protein NPR1-like            130   8e-32   
gb|AAP92751.1|  NPR1-like protein                                       130   8e-32   
ref|XP_002308281.1|  Regulatory protein NPR1                            130   9e-32   
ref|XP_002514127.1|  Regulatory protein NPR1, putative                  130   1e-31   
ref|XP_011003334.1|  PREDICTED: regulatory protein NPR1                 129   1e-31   
ref|XP_008242373.1|  PREDICTED: regulatory protein NPR1                 129   1e-31   
gb|AEY99652.1|  NPR1-1                                                  129   2e-31   
emb|CAJ19095.1|  NPR1-like 1 protein                                    129   2e-31   
dbj|BAJ91588.1|  predicted protein                                      128   3e-31   
dbj|BAJ87143.1|  predicted protein                                      128   3e-31   
ref|XP_007202872.1|  hypothetical protein PRUPE_ppa015728mg             128   4e-31   
dbj|BAJ90272.1|  predicted protein                                      128   4e-31   
ref|XP_009388569.1|  PREDICTED: regulatory protein NPR1-like            128   4e-31   
ref|XP_007012791.1|  Regulatory protein isoform 2                       127   4e-31   
ref|XP_010049459.1|  PREDICTED: regulatory protein NPR1-like isof...    128   5e-31   
gb|AGH18701.1|  NPR1-like 1 protein                                     128   5e-31   
ref|XP_010049461.1|  PREDICTED: regulatory protein NPR1-like isof...    128   5e-31   
ref|XP_010262064.1|  PREDICTED: regulatory protein NPR1-like            127   6e-31   
emb|CDP03145.1|  unnamed protein product                                128   6e-31   
gb|AIK01833.1|  NPR1                                                    124   8e-31   
ref|XP_010230579.1|  PREDICTED: regulatory protein NPR1 isoform X3      127   8e-31   
ref|XP_007012790.1|  Regulatory protein isoform 1                       127   1e-30   
gb|KCW82057.1|  hypothetical protein EUGRSUZ_C03423                     128   1e-30   
ref|XP_003564857.1|  PREDICTED: regulatory protein NPR1 isoform X2      126   2e-30   
gb|ABZ03476.1|  NPR1-like protein 3                                     119   2e-30   
gb|ABZ03511.1|  NPR1-like protein 3                                     119   2e-30   
ref|XP_009412232.1|  PREDICTED: regulatory protein NPR1-like            126   2e-30   
gb|KHG24206.1|  Regulatory NPR1 -like protein                           126   2e-30   
gb|AHF20182.1|  non-expressor of pr1                                    126   2e-30   
ref|XP_004288961.2|  PREDICTED: regulatory protein NPR1-like            126   3e-30   
ref|XP_010230578.1|  PREDICTED: regulatory protein NPR1 isoform X1      125   3e-30   
gb|ADI24348.1|  non-expressor of PR1                                    125   4e-30   
ref|XP_002281475.1|  PREDICTED: regulatory protein NPR1                 125   4e-30   
gb|KJB27198.1|  hypothetical protein B456_004G284300                    125   4e-30   
ref|XP_009408867.1|  PREDICTED: regulatory protein NPR1-like            125   5e-30   
gb|ABI93182.1|  NPR1-like protein                                       125   6e-30   
gb|ABC54558.1|  nonexpresser of pathogenesis-related 1                  125   7e-30   
gb|ABZ03494.1|  NPR1-like protein 3                                     117   9e-30   
ref|XP_006451499.1|  hypothetical protein CICLE_v10007832mg             124   1e-29   
gb|ABZ03475.1|  NPR1-like protein 3                                     117   1e-29   
gb|ABM64782.1|  regulatory protein NPR1                                 124   1e-29   
ref|XP_006451500.1|  hypothetical protein CICLE_v10007832mg             124   1e-29   
gb|ABZ03481.1|  NPR1-like protein 3                                     117   1e-29   
gb|EMS46234.1|  Regulatory protein NPR1                                 125   2e-29   
ref|XP_010090069.1|  Regulatory protein                                 123   2e-29   
ref|XP_006357709.1|  PREDICTED: regulatory protein NPR1-like            123   3e-29   
ref|XP_009802447.1|  PREDICTED: regulatory protein NPR1                 123   3e-29   
emb|CAP12787.1|  NPR1 protein                                           122   4e-29   
gb|ABZ03565.1|  NPR1-like protein 3                                     115   4e-29   
gb|ABZ03489.1|  NPR1-like protein 3                                     115   5e-29   
gb|ABZ03484.1|  NPR1-like protein 3                                     115   5e-29   
gb|ABZ03483.1|  NPR1-like protein 3                                     115   5e-29   
gb|ABZ03563.1|  NPR1-like protein 3                                     115   5e-29   
ref|XP_002455011.1|  hypothetical protein SORBIDRAFT_03g002980          122   6e-29   
gb|ABZ03477.1|  NPR1-like protein 3                                     115   6e-29   
gb|AEP68016.1|  NPR1                                                    122   6e-29   
gb|ABZ03478.1|  NPR1-like protein 3                                     115   6e-29   
ref|XP_009606361.1|  PREDICTED: regulatory protein NPR1                 122   7e-29   
ref|XP_009385600.1|  PREDICTED: regulatory protein NPR1-like isof...    121   8e-29   
gb|ABG38308.1|  NPR1                                                    122   9e-29   
gb|ABX71071.1|  NPR1                                                    121   1e-28   
gb|AAM62410.1|AF480488_1  NPR1                                          121   1e-28   
ref|XP_004968514.1|  PREDICTED: regulatory protein NPR1-like            121   1e-28   
gb|ABZ03524.1|  NPR1-like protein 3                                     115   1e-28   
gb|ABR23001.1|  NPR1                                                    121   1e-28   
ref|XP_003534926.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    121   1e-28   
ref|NP_001234558.1|  non-inducible immunity 1                           121   1e-28   
ref|NP_001152107.1|  LOC100285744                                       120   2e-28   
ref|XP_009385599.1|  PREDICTED: regulatory protein NPR1-like isof...    121   2e-28   
ref|XP_010696528.1|  PREDICTED: regulatory protein NPR1-like            121   2e-28   
ref|XP_011078001.1|  PREDICTED: regulatory protein NPR1-like isof...    121   2e-28   
gb|KHN35859.1|  Regulatory protein NPR1                                 119   2e-28   
gb|EYU28391.1|  hypothetical protein MIMGU_mgv1a003409mg                120   2e-28   
ref|XP_010242246.1|  PREDICTED: regulatory protein NPR1-like            120   3e-28   
ref|XP_010323608.1|  PREDICTED: non-inducible immunity 1 isoform X1     119   4e-28   
tpg|DAA52994.1|  TPA: regulatory protein NPR1                           119   5e-28   
ref|XP_006437096.1|  hypothetical protein CICLE_v10031343mg             118   7e-28   
gb|AAS57869.1|  NPR1                                                    118   8e-28   
ref|XP_011078003.1|  PREDICTED: regulatory protein NPR1-like isof...    118   1e-27   
gb|AES65476.2|  regulatory protein NPR1                                 118   2e-27   
gb|AAS55117.1|  NPR1                                                    117   2e-27   
ref|XP_003595225.1|  NPR1                                               118   2e-27   
ref|XP_010047548.1|  PREDICTED: regulatory protein NPR1 isoform X2      117   2e-27   
ref|XP_009361630.1|  PREDICTED: regulatory protein NPR1                 117   3e-27   
ref|XP_008356687.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    114   4e-27   
ref|XP_010047547.1|  PREDICTED: regulatory protein NPR1 isoform X1      117   4e-27   
gb|ADP68616.1|  NPR disease resistance protein                          114   1e-26   
ref|XP_006437107.1|  hypothetical protein CICLE_v10033569mg             114   1e-26   
ref|XP_006853864.1|  hypothetical protein AMTR_s00036p00114630          115   1e-26   
ref|XP_008391028.1|  PREDICTED: regulatory protein NPR1                 115   2e-26   
ref|XP_009392990.1|  PREDICTED: regulatory protein NPR1-like isof...    115   3e-26   
ref|XP_009392989.1|  PREDICTED: regulatory protein NPR1-like isof...    115   3e-26   
ref|XP_010418483.1|  PREDICTED: regulatory protein NPR1-like            115   3e-26   
ref|XP_010473687.1|  PREDICTED: regulatory protein NPR1-like            115   4e-26   
ref|XP_010430550.1|  PREDICTED: regulatory protein NPR1 isoform X1      113   1e-25   
ref|XP_010430551.1|  PREDICTED: regulatory protein NPR1 isoform X2      113   1e-25   
ref|XP_010430552.1|  PREDICTED: regulatory protein NPR1 isoform X3      113   1e-25   
gb|EMT25266.1|  Regulatory protein NPR1                                 113   5e-25   
ref|XP_006391648.1|  hypothetical protein EUTSA_v10023365mg             111   6e-25   
ref|XP_002969487.1|  hypothetical protein SELMODRAFT_91240              108   2e-24   
gb|KFK36581.1|  hypothetical protein AALP_AA4G142100                    109   2e-24   
ref|XP_002961253.1|  hypothetical protein SELMODRAFT_74877              107   2e-24   
ref|XP_010545358.1|  PREDICTED: regulatory protein NPR1                 109   3e-24   
gb|ABR46023.1|  non-expressor of PR1                                    109   3e-24   
gb|AAM65726.1|  Regulatory protein NPR1 (Nonexpresser of PR genes...    109   3e-24   
gb|ABR46016.1|  non-expressor of PR1                                    109   4e-24   
ref|NP_176610.1|  Regulatory protein NPR1                               109   4e-24   
gb|ABR46015.1|  non-expressor of PR1                                    109   4e-24   
gb|ABR46021.1|  non-expressor of PR1                                    109   4e-24   
gb|ABR46012.1|  non-expressor of PR1                                    109   4e-24   
gb|ABR46014.1|  non-expressor of PR1                                    108   4e-24   
ref|XP_002986952.1|  hypothetical protein SELMODRAFT_125007             107   4e-24   
ref|XP_002977926.1|  hypothetical protein SELMODRAFT_107813             107   5e-24   
gb|ABR46027.1|  non-expressor of PR1                                    108   5e-24   
gb|ABR46031.1|  non-expressor of PR1                                    108   6e-24   
ref|NP_194342.1|  regulatory protein NPR2                               108   9e-24   
ref|XP_006283373.1|  hypothetical protein CARUB_v10004416mg             107   1e-23   
emb|CDY34413.1|  BnaA09g11550D                                          107   2e-23   
ref|XP_010433548.1|  PREDICTED: regulatory protein NPR2-like isof...    106   3e-23   
ref|XP_006302049.1|  hypothetical protein CARUB_v10020031mg             106   3e-23   
ref|XP_010433547.1|  PREDICTED: regulatory protein NPR2-like isof...    106   3e-23   
gb|ABR46032.1|  non-expressor of PR1                                    106   4e-23   
ref|XP_002886354.1|  non-expressor of PR1                               106   4e-23   
ref|XP_010448322.1|  PREDICTED: regulatory protein NPR2-like            106   4e-23   
ref|XP_006413224.1|  hypothetical protein EUTSA_v10024746mg             105   6e-23   
ref|XP_002869627.1|  ankyrin repeat family protein                      105   1e-22   
ref|XP_010438799.1|  PREDICTED: regulatory protein NPR2-like            105   1e-22   
emb|CDY25575.1|  BnaC09g12000D                                          104   1e-22   
gb|ABB77196.1|  NPR1-like protein                                     98.2    1e-22   
gb|ABB77195.1|  NPR1-like protein                                     98.2    1e-22   
ref|XP_009112889.1|  PREDICTED: regulatory protein NPR1                 102   1e-21   
gb|ABB77197.1|  NPR1-like protein                                     95.5    2e-21   
ref|XP_009139916.1|  PREDICTED: regulatory protein NPR2                 100   4e-21   
emb|CDX89362.1|  BnaA01g15310D                                        99.8    8e-21   
ref|XP_010505917.1|  PREDICTED: regulatory protein NPR5-like          98.6    1e-20   
emb|CDX94371.1|  BnaC01g18130D                                        99.4    1e-20   
ref|NP_191272.1|  protein BLADE ON PETIOLE 1                          97.8    2e-20   
ref|XP_006402903.1|  hypothetical protein EUTSA_v10005948mg           97.4    2e-20   
ref|XP_010427578.1|  PREDICTED: regulatory protein NPR6               97.4    2e-20   
ref|XP_010516320.1|  PREDICTED: regulatory protein NPR6-like          97.4    2e-20   
ref|XP_006413228.1|  hypothetical protein EUTSA_v10024745mg           98.2    3e-20   
emb|CBI30078.3|  unnamed protein product                              96.3    3e-20   
gb|KJB35920.1|  hypothetical protein B456_006G133600                  96.3    3e-20   
gb|AAM88865.2|AF527176_1  putative NPR1                               97.8    4e-20   
gb|KFK34952.1|  hypothetical protein AALP_AA5G215400                  96.7    5e-20   
ref|XP_002876399.1|  hypothetical protein ARALYDRAFT_324222           96.7    5e-20   
ref|XP_004493408.1|  PREDICTED: regulatory protein NPR5-like          97.1    5e-20   
gb|ACN33605.1|  unknown                                               95.5    5e-20   
gb|AAO22795.1|  unknown protein                                       97.1    5e-20   
emb|CDX94376.1|  BnaC01g18080D                                        97.4    5e-20   
ref|XP_002881770.1|  hypothetical protein ARALYDRAFT_903451           97.1    5e-20   
ref|NP_181668.1|  NPR1 like protein BOP2                              97.1    5e-20   
ref|XP_006292732.1|  hypothetical protein CARUB_v10018976mg           96.7    5e-20   
ref|XP_010504634.1|  PREDICTED: regulatory protein NPR6-like          96.3    6e-20   
emb|CDY50004.1|  BnaC08g12110D                                        97.4    6e-20   
gb|KJB35921.1|  hypothetical protein B456_006G133600                  96.3    8e-20   
gb|KHG10935.1|  Regulatory NPR5 -like protein                         96.3    8e-20   
emb|CAN80112.1|  hypothetical protein VITISV_010389                   96.3    9e-20   
emb|CDY23854.1|  BnaC04g01830D                                        95.9    9e-20   
ref|XP_002275980.1|  PREDICTED: regulatory protein NPR5               95.9    1e-19   
gb|KFK36987.1|  hypothetical protein AALP_AA4G197800                  95.9    1e-19   
ref|XP_001784176.1|  predicted protein                                94.0    1e-19   
ref|XP_010036340.1|  PREDICTED: regulatory protein NPR5-like          95.5    2e-19   
gb|ABR21207.1|  putative NPR1                                         95.9    2e-19   
ref|XP_002531503.1|  aberrant large forked product, putative          95.1    2e-19   
ref|XP_010508725.1|  PREDICTED: regulatory protein NPR5               95.1    2e-19   
emb|CDX89364.1|  BnaA01g15290D                                        95.9    2e-19   
ref|XP_006364431.1|  PREDICTED: regulatory protein NPR5-like          94.4    3e-19   
ref|XP_009386838.1|  PREDICTED: regulatory protein NPR6 isoform X1    94.7    3e-19   
gb|EPS72362.1|  hypothetical protein M569_02396                       93.6    3e-19   
gb|AAV52267.1|  putative NPR1 transcriptional factor                  95.1    3e-19   
gb|KFK29121.1|  hypothetical protein AALP_AA7G091600                  95.1    4e-19   
ref|XP_006605205.1|  PREDICTED: regulatory protein NPR5-like          93.6    4e-19   
emb|CDY06929.1|  BnaA04g23860D                                        94.0    5e-19   
ref|XP_007145550.1|  hypothetical protein PHAVU_007G248000g           94.0    5e-19   
emb|CDY14765.1|  BnaC04g47620D                                        94.0    5e-19   
ref|XP_004237330.1|  PREDICTED: regulatory protein NPR5-like          93.6    6e-19   
ref|XP_009609217.1|  PREDICTED: regulatory protein NPR5-like          93.6    6e-19   
ref|XP_006411403.1|  hypothetical protein EUTSA_v10016568mg           93.6    7e-19   



>ref|XP_011085427.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
 ref|XP_011085428.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
Length=587

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL N+VEKA +EDVIPILMVA+  EL QLL  CVQR+ RSDLD+ T+EKELP E
Sbjct  178  VMVVQRRLLNYVEKAFVEDVIPILMVAFRSELKQLLSHCVQRIARSDLDDITIEKELPHE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   +K+ R+K +++ E D+VQVDSL EK IRRI RALDS+DVELVKLLLDES ++LD A
Sbjct  238  VLDGVKSLRIKSKQDEEHDSVQVDSLNEKSIRRIHRALDSDDVELVKLLLDESNISLDAA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYCN K+VNEVL+LG AD NL N+RGYT LH+AARRKDPSI++GLLN GASV+
Sbjct  298  YALHYATAYCNPKIVNEVLNLGNADVNLRNSRGYTVLHVAARRKDPSIVVGLLNQGASVS  357

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  358  DTTGDGQ  364



>ref|XP_009786055.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Nicotiana 
sylvestris]
Length=579

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            +  V+RRL NF++KA  EDVIPIL+VA+HC  +QLLE C+QRVTRSDLDN TLEKELP E
Sbjct  170  IMVVERRLVNFIDKATPEDVIPILLVAFHCSSNQLLEHCIQRVTRSDLDNATLEKELPHE  229

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK  RLK ++ LE D+++VDSL EKRIRRIL+AL+S+D+EL+KLLL+ES VTLDDA
Sbjct  230  VLTDIKTRRLKSRQELEHDSIEVDSLSEKRIRRILKALESDDIELLKLLLEESNVTLDDA  289

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYCNSK+VNEVL+L +AD NL N+RGY  LHIAARRK+PSII+GLL  GASV 
Sbjct  290  CALHYAAAYCNSKVVNEVLELDLADVNLQNSRGYNVLHIAARRKEPSIIMGLLEKGASVL  349

Query  546  DLASNG  563
            +   +G
Sbjct  350  NTTRDG  355



>ref|XP_009786050.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786051.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786052.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786054.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
Length=587

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            +  V+RRL NF++KA  EDVIPIL+VA+HC  +QLLE C+QRVTRSDLDN TLEKELP E
Sbjct  170  IMVVERRLVNFIDKATPEDVIPILLVAFHCSSNQLLEHCIQRVTRSDLDNATLEKELPHE  229

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK  RLK ++ LE D+++VDSL EKRIRRIL+AL+S+D+EL+KLLL+ES VTLDDA
Sbjct  230  VLTDIKTRRLKSRQELEHDSIEVDSLSEKRIRRILKALESDDIELLKLLLEESNVTLDDA  289

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYCNSK+VNEVL+L +AD NL N+RGY  LHIAARRK+PSII+GLL  GASV 
Sbjct  290  CALHYAAAYCNSKVVNEVLELDLADVNLQNSRGYNVLHIAARRKEPSIIMGLLEKGASVL  349

Query  546  DLASNG  563
            +   +G
Sbjct  350  NTTRDG  355



>ref|XP_009777172.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Nicotiana 
sylvestris]
Length=503

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQR L N V++A ++DVIPIL+VA+HC L  LLE CVQ+V RSDLD FTLEKELP +
Sbjct  171  VMAVQRHLVNLVDEATVDDVIPILLVAFHCSLDLLLERCVQKVERSDLDIFTLEKELPSK  230

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIKA RLK Q  +E DT++  SL EKRIR+IL+AL+S+D+EL+KLLL ES VTL+DA
Sbjct  231  VLTDIKARRLKSQIVIEQDTMEGGSLHEKRIRKILKALESDDIELLKLLLGESNVTLNDA  290

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYCNSK+VNEVL +G+AD NL N+RGYT LH+ ARR +PSII+ LL+ GAS  
Sbjct  291  CALHYAAAYCNSKVVNEVLKMGIADVNLRNSRGYTVLHVGARRMEPSIIMSLLDKGASAL  350

Query  546  DLASNG  563
            D   +G
Sbjct  351  DTTLDG  356



>gb|ABA60140.1| NPR1-like protein, partial [Platanus x acerifolia]
 gb|ABA60141.1| NPR1-like protein, partial [Platanus x acerifolia]
Length=244

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA +EDVIPIL VA+HC L+QLL  CVQRV RSDLDN +LEKELP E
Sbjct  41   VSLFQRRLLNFVEKAFVEDVIPILQVAFHCHLNQLLVQCVQRVARSDLDNISLEKELPYE  100

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTldd  362
            V  +IK+ R + Q + EP  + +D++ EKRIRRI +ALDS+DVELVKLLL ES  +TLDD
Sbjct  101  VAENIKSLRHQSQPDDEPVVMAMDAVHEKRIRRIHKALDSDDVELVKLLLSESAGITLDD  160

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K++ EVLDLG+A+ NL NARGYT LH+AA RK+PS+I+ LL  GA  
Sbjct  161  ANALHYAAAYCDPKVLAEVLDLGLANVNLRNARGYTVLHLAAMRKEPSVIVALLTKGACA  220

Query  543  ADLASNGQ  566
            ++   +GQ
Sbjct  221  SETTVDGQ  228



>gb|ABA60139.1| NPR1-like protein, partial [Platanus x acerifolia]
 gb|ABA60142.1| NPR1-like protein, partial [Platanus x acerifolia]
Length=244

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA +EDVIPIL VA+HC L+QLL  CVQRV RSDLDN +LEKELP E
Sbjct  41   VSLFQRRLLNFVEKAFVEDVIPILQVAFHCHLNQLLAQCVQRVARSDLDNISLEKELPYE  100

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTldd  362
            V  +IK+ R + Q + EP  + +D + EKRIRRI +ALDS+DVELVKLLL ES  +TLDD
Sbjct  101  VAENIKSLRHQSQPDDEPVVMAMDPVHEKRIRRIHKALDSDDVELVKLLLSESAGITLDD  160

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K++ EVLDLG+A+ NL NARGYT LH+AA RK+PS+I+ LL  GA  
Sbjct  161  ANALHYAAAYCDPKVLAEVLDLGLANVNLRNARGYTVLHLAAMRKEPSVIVALLTKGACA  220

Query  543  ADLASNGQ  566
            ++   +GQ
Sbjct  221  SETTVDGQ  228



>gb|ABA38916.1| NPR1-like protein, partial [Prunus avium]
 gb|ABA38919.1| NPR1-like protein, partial [Prunus serrulata]
Length=245

 Score =   201 bits (511),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP E
Sbjct  21   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VIEKIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>gb|ABA60144.1| NPR1-like protein, partial [Platanus x acerifolia]
Length=262

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA +EDVIPIL VA+HC L+QLL  CVQRV RSDLDN +LEKELP E
Sbjct  37   VSLFQRRLLNFVEKAFVEDVIPILQVAFHCHLNQLLVQCVQRVARSDLDNISLEKELPYE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTldd  362
            V  +IK+ R + Q + EP  + +D++ EKRIRRI +ALDS+DVELVKLLL ES  +TLDD
Sbjct  97   VAENIKSLRHQSQPDDEPVVMAMDAVHEKRIRRIHKALDSDDVELVKLLLSESAGITLDD  156

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K++ EVLDLG+A+ NL NARGYT LH+AA RK+PS+I+ LL  GA  
Sbjct  157  ANALHYAAAYCDPKVLAEVLDLGLANVNLRNARGYTVLHLAAMRKEPSVIVALLTKGACA  216

Query  543  ADLASNGQ  566
            ++   +GQ
Sbjct  217  SETTVDGQ  224



>gb|ABA60145.1| NPR1-like protein, partial [Platanus x acerifolia]
Length=262

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA +EDVIPIL VA+HC L+QLL  CVQRV RSDLDN +LEKELP E
Sbjct  37   VSLFQRRLLNFVEKAFVEDVIPILQVAFHCHLNQLLAQCVQRVARSDLDNISLEKELPYE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTldd  362
            V  +IK+ R + Q + EP  + +D + EKRIRRI +ALDS+DVELVKLLL ES  +TLDD
Sbjct  97   VAENIKSLRHQSQPDDEPVVMAMDPVHEKRIRRIHKALDSDDVELVKLLLSESAGITLDD  156

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K++ EVLDLG+A+ NL NARGYT LH+AA RK+PS+I+ LL  GA  
Sbjct  157  ANALHYAAAYCDPKVLAEVLDLGLANVNLRNARGYTVLHLAAMRKEPSVIVALLTKGACA  216

Query  543  ADLASNGQ  566
            ++   +GQ
Sbjct  217  SETTVDGQ  224



>gb|ABA41258.1| NPR1-like protein, partial [Platanus x acerifolia]
Length=262

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA +EDVIPIL VA+HC L+QLL  CVQRV RSDLDN +LEKELP E
Sbjct  37   VSLFQRRLLNFVEKAFVEDVIPILQVAFHCHLNQLLAQCVQRVARSDLDNISLEKELPYE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTldd  362
            V  +IK+ R + Q + EP  + +D + EKRIRRI +ALDS+DVELVKLLL ES  +TLDD
Sbjct  97   VAENIKSLRHQSQPDDEPVVMAMDPVHEKRIRRIHKALDSDDVELVKLLLSESAGITLDD  156

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K++ EVLDLG+A+ NL NARGYT LH+AA RK+PS+I+ LL  GA  
Sbjct  157  ANALHYAAAYCDPKVLAEVLDLGLANVNLRNARGYTVLHLAAMRKEPSVIVALLTKGACA  216

Query  543  ADLASNGQ  566
            ++   +GQ
Sbjct  217  SETTVDGQ  224



>gb|ABA60146.1| NPR1-like protein, partial [Platanus x acerifolia]
Length=262

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA +EDVIPIL VA+HC L+QLL  CVQRV RSDLDN +LEKELP E
Sbjct  37   VSLFQRRLLNFVEKAFVEDVIPILQVAFHCHLNQLLAQCVQRVARSDLDNISLEKELPYE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTldd  362
            V  +IK+ R + Q + EP  + +D + EKRIRRI +ALDS+DVELVKLLL ES  +TLDD
Sbjct  97   VAENIKSLRHQSQPDDEPVVMAMDPVHEKRIRRIHKALDSDDVELVKLLLSESAGITLDD  156

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K++ EVLDLG+A+ NL NARGYT LH+AA RK+PS+I+ LL  GA  
Sbjct  157  ANALHYAAAYCDPKVLAEVLDLGLANVNLRNARGYTVLHLAAMRKEPSVIVALLTKGACA  216

Query  543  ADLASNGQ  566
            ++   +GQ
Sbjct  217  SETTVDGQ  224



>gb|ABA38912.1| NPR1-like protein, partial [Prunus avium]
Length=261

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP E
Sbjct  37   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLEKGLPDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VIEKIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  157  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  216

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  217  ELTSDGQ  223



>ref|XP_009777160.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777161.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777162.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777163.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777164.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777165.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777166.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777167.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777168.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777170.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777171.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
Length=574

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQR L N V++A ++DVIPIL+VA+HC L  LLE CVQ+V RSDLD FTLEKELP +
Sbjct  171  VMAVQRHLVNLVDEATVDDVIPILLVAFHCSLDLLLERCVQKVERSDLDIFTLEKELPSK  230

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIKA RLK Q  +E DT++  SL EKRIR+IL+AL+S+D+EL+KLLL ES VTL+DA
Sbjct  231  VLTDIKARRLKSQIVIEQDTMEGGSLHEKRIRKILKALESDDIELLKLLLGESNVTLNDA  290

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYCNSK+VNEVL +G+AD NL N+RGYT LH+ ARR +PSII+ LL+ GAS  
Sbjct  291  CALHYAAAYCNSKVVNEVLKMGIADVNLRNSRGYTVLHVGARRMEPSIIMSLLDKGASAL  350

Query  546  DLASNG  563
            D   +G
Sbjct  351  DTTLDG  356



>ref|XP_003545296.1| PREDICTED: regulatory protein NPR3-like [Glycine max]
Length=590

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QR L NFVEKAL+EDVIPILM A++C+L QLL  C+QRV RSD DN +LEKELP E
Sbjct  178  VLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSRCIQRVARSDFDNTSLEKELPHE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V ++IK+ RL FQ    P+ ++ +SL EK IRRI +ALDS+DVEL+KLLL+ES VTLDDA
Sbjct  238  VLTEIKSLRLSFQPESTPNAMEAESLNEKSIRRIHKALDSDDVELLKLLLNESSVTLDDA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL LGMAD    N+RGYT LH+AARRKDPSI++ LLN GA  +
Sbjct  298  YALHYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVALLNKGARAS  357

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  358  DTTPDGQ  364



>emb|CDP17457.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFV+KA +EDVIPI +VA+HC+L+QLL   +QR+ RSDLD+ TLEKELP E
Sbjct  178  VLVVQRRLLNFVDKAFVEDVIPITIVAFHCKLNQLLSHSIQRIARSDLDDLTLEKELPHE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK+ R ++ ++L+ D  +V+ + +KRIRRI +ALDS+DVEL++LLL ES +TLD A
Sbjct  238  VLTDIKSFRKQYDQDLQHDNGEVNFITDKRIRRIHKALDSDDVELLRLLLAESDITLDAA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            + LHYAAAYCN K+V EVL LG A+ NL N+RGYT LH+AARRKDPS+I+GLL+ GA V+
Sbjct  298  FGLHYAAAYCNPKVVTEVLSLGNANLNLRNSRGYTVLHVAARRKDPSVIVGLLSKGACVS  357

Query  546  DLASNGQ  566
            D   +G+
Sbjct  358  DSTDDGR  364



>gb|ABA60143.1| NPR1-like protein, partial [Platanus x acerifolia]
Length=262

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA +EDVIPIL VA+HC L+QLL  CVQRV RSDLDN +LEKELP +
Sbjct  37   VSLFQRRLLNFVEKAFVEDVIPILQVAFHCHLNQLLVQCVQRVARSDLDNISLEKELPYK  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTldd  362
            V  +IK+ R + Q + EP  + +D++ EKRIRRI +ALDS+DVELVKLLL ES  +TLDD
Sbjct  97   VAENIKSLRHQSQPDDEPVVMAMDAVHEKRIRRIHKALDSDDVELVKLLLSESAGITLDD  156

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K++ EVLDLG+A+ NL NARGYT LH+AA RK+PS+I+ LL  GA  
Sbjct  157  ANALHYAAAYCDPKVLAEVLDLGLANVNLRNARGYTVLHLAAMRKEPSVIVALLTKGACA  216

Query  543  ADLASNGQ  566
            ++   +GQ
Sbjct  217  SETTVDGQ  224



>gb|ABA41270.1| NPR1-like protein, partial [Prunus laurocerasus]
Length=261

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP E
Sbjct  37   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLITQCIERVARSDIDSISLEKGLPDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q+  +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VIEKIKILRRNSQQGCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  R++PSII+ LL  GA  +
Sbjct  157  NALHYAAAYCDPKVVTEVLSLGLADVNLRNSRGYTVLHIAVMRREPSIIVLLLTKGARAS  216

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  217  ELTSDGQ  223



>gb|KHN11992.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QR L NFVEKAL+EDVIPILM A++C+L QLL  C+QRV RSD DN +LEKELP E
Sbjct  178  VLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSRCIQRVARSDFDNTSLEKELPHE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V ++IK+ RL FQ    P+ ++ +SL EK IRRI +ALDS+DVEL+KLLL+ES VTLDDA
Sbjct  238  VLTEIKSLRLPFQPESTPNAMEAESLNEKSIRRIHKALDSDDVELLKLLLNESSVTLDDA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYA AY +SK++ EVL LGMAD    N+RGYT LH+AARRKDPSI++ LLN GA  +
Sbjct  298  HALHYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVALLNKGARAS  357

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  358  DTTPDGQ  364



>ref|XP_006644769.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like 
[Oryza brachyantha]
Length=626

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            +   QRRL NFV+K ++EDV+PIL+VA+H EL+ +LE CV+R+ RSDLDN +L+KELPPE
Sbjct  221  ISMFQRRLLNFVDKTMVEDVLPILLVAFHSELTPVLERCVRRIARSDLDNISLDKELPPE  280

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K Q N E DTV  D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA
Sbjct  281  VSVQIKETRQKSQTN-EGDTVISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDA  339

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+SK+V E+LDLG+A+ NL N+RGYTALH+AA R++P+II+ LLN GA+V+
Sbjct  340  NALHYAAAYCDSKVVTELLDLGLANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGAAVS  399

Query  546  DLASNGQ  566
             L ++GQ
Sbjct  400  QLTADGQ  406



>gb|KHN38349.1| Regulatory protein NPR3 [Glycine soja]
Length=492

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QR L NFVEKAL+EDVIPILM A++C+L QLL  C++RV RSD DN +LEKELP E
Sbjct  70   VLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSQCIRRVARSDFDNTSLEKELPRE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V ++IK  RL FQ    P+ ++V+SL EK IRRI +ALDS+DVEL+KLLL+ES VTLDDA
Sbjct  130  VVTEIKLLRLPFQPESTPNAMEVESLNEKSIRRIHKALDSDDVELLKLLLNESSVTLDDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYA AY +SK++ EVL LGMAD    N+RGYT LH+AARRKDPSI++ LLN GA  +
Sbjct  190  HALHYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVALLNKGACAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>gb|ABA38917.1| NPR1-like protein, partial [Prunus avium]
Length=245

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP E
Sbjct  21   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIARCIERVARSDIDSISLEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VIEKIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V +VL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTKVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>ref|XP_010092646.1| Regulatory protein [Morus notabilis]
 gb|EXB51897.1| Regulatory protein [Morus notabilis]
Length=582

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFV KAL+EDVIPIL+VA+HC+LSQL   CV RV RSDL+  +LEKELP EV  +
Sbjct  177  QRRLLNFVGKALVEDVIPILVVAFHCQLSQLFAQCVDRVARSDLEIVSLEKELPHEVVEN  236

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R K Q + + +T  VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLDDA ALH
Sbjct  237  IKVLRGKSQCSDKDNTESVDPLREKRIRRIHKALDSDDVELVKLLLTESEITLDDANALH  296

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAAAYC+ K+VNEVL LG+AD NL N+RGYT LHIAA RK+PSII+ LL  GA  +DL S
Sbjct  297  YAAAYCDPKVVNEVLGLGLADVNLQNSRGYTVLHIAAMRKEPSIIVSLLTKGACASDLTS  356

Query  558  NGQ  566
            +GQ
Sbjct  357  DGQ  359



>gb|ABA38918.1| NPR1-like protein, partial [Prunus serrulata]
 gb|ABB59683.1| NPR1-like protein, partial [Prunus serrulata]
Length=261

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV KAL +DVIPIL+V +HC+LSQL++ C++RV RSDLD+ +LEKELP E
Sbjct  37   VSILQRRLINFVGKALADDVIPILVVGFHCKLSQLIDQCIERVARSDLDSISLEKELPDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VVEKIKIIRHNSQQDCDPNIAAVDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EV+ LG+ D NL N+RGYT LHIA  RK+PSII+ LL  GA V+
Sbjct  157  NALHYAAAYCDPKVVTEVIGLGLVDVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARVS  216

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  217  ELTLDGE  223



>gb|ABA41273.1| NPR1-like protein, partial [Prunus laurocerasus]
Length=245

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP E
Sbjct  21   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VIEKIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESDITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  R++PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRREPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>gb|ABB59685.1| NPR1-like protein, partial [Prunus serrulata]
Length=261

 Score =   199 bits (506),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV +SD+D+ +LEKELP E
Sbjct  37   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVAQSDIDSISLEKELPDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VVEKIKIIRHNSQQDCDPNIAAVDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EV+ LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA V+
Sbjct  157  NALHYAAAYCDPKVVTEVIGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARVS  216

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  217  ELTLDGE  223



>gb|ABA38915.1| NPR1-like protein, partial [Prunus avium]
Length=261

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP E
Sbjct  37   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLEKGLPDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   V  L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VIEKIKILRRNSQQDCDPNMPAVGPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  157  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  216

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  217  ELTSDGQ  223



>gb|ABA38914.1| NPR1-like protein, partial [Prunus avium]
Length=261

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP  
Sbjct  37   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLEKGLPDG  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VIEKIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  157  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  216

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  217  ELTSDGQ  223



>gb|ABA41268.1| NPR1-like protein, partial [Prunus laurocerasus]
Length=245

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK L  E
Sbjct  21   VSITQRRLLNFVGKALADDVIPILVVAFHCQLSQLITQCIERVARSDIDSISLEKGLTDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q+  +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VIEKIKILRRNSQQGCDPNMTAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  R++PSII+ LL  GA   
Sbjct  141  NALHYAAAYCDPKVVTEVLSLGLADVNLRNSRGYTVLHIAVMRREPSIIVLLLTKGARAP  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>gb|ABA38911.1| NPR1-like protein, partial [Prunus avium]
Length=336

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP E
Sbjct  112  VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLEKGLPDE  171

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  172  VIEKIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  231

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  232  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  291

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  292  ELTSDGQ  298



>gb|ABA41265.1| NPR1-like protein, partial [Prunus laurocerasus]
Length=261

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK L  E
Sbjct  37   VSIIQRRLLNFVGKALADDVIPILVVAFHCQLSQLITQCIERVARSDIDSISLEKGLTDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q+  +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VIEKIKILRRNSQQGCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  R++PSII+ LL  GA  +
Sbjct  157  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRREPSIIVLLLTKGARAS  216

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  217  ELTSDGQ  223



>ref|XP_003519533.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Glycine max]
 ref|XP_006575639.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Glycine max]
 ref|XP_006575640.1| PREDICTED: regulatory protein NPR3-like isoform X3 [Glycine max]
Length=590

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QR L NFVEKAL+EDVIPILM A++C+L QLL  C++RV RSD DN +LEKELP E
Sbjct  178  VLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSQCIRRVARSDFDNTSLEKELPRE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V ++IK  RL FQ    P+ ++V+SL EK IRRI +ALDS+DVEL+KLLL+ES VTLDDA
Sbjct  238  VVTEIKLLRLPFQPESTPNAMEVESLNEKSIRRIHKALDSDDVELLKLLLNESSVTLDDA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYA AY +SK++ EVL LGMAD    N+RGYT LH+AARRKDPSI++ LLN GA  +
Sbjct  298  HALHYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVALLNKGACAS  357

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  358  DTTPDGQ  364



>ref|XP_004303897.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 150/191 (79%), Gaps = 4/191 (2%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL+NFV+KAL+EDVIPIL+ A+HC+LSQLL  CVQRV+RSDLDN  LEKELP E
Sbjct  180  VQVVQRRLWNFVDKALVEDVIPILVAAFHCQLSQLLSHCVQRVSRSDLDNVALEKELPHE  239

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKR---IRRILRALDSNDVELVKLLLDES-MVT  353
            VF DIK+ RLK Q   E   ++ +  ++KR   IRRI RALDS+DVELV LLL+ES  +T
Sbjct  240  VFDDIKSLRLKSQEKDESVMLEQEPREDKRLKSIRRIHRALDSDDVELVTLLLNESDSIT  299

Query  354  lddayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNG  533
            LDDA+ALHYA AYC+ K+V EVL LG+AD NL NAR +T LH+AARRK+PS+I+ LLN G
Sbjct  300  LDDAHALHYAVAYCDPKIVKEVLGLGLADVNLRNAREHTVLHVAARRKEPSVIVHLLNKG  359

Query  534  ASVADLASNGQ  566
            AS  +  S+GQ
Sbjct  360  ASALETTSDGQ  370



>gb|ABB59684.1| NPR1-like protein, partial [Prunus serrulata]
Length=261

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV KAL +DVIPIL+V +HC+LSQL++ C++RV RSDLD+ +LEKELP E
Sbjct  37   VSILQRRLINFVGKALADDVIPILVVGFHCKLSQLIDQCIERVARSDLDSISLEKELPDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VVEKIKIIRHNSQQDCDPNIAAVDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EV+ LG+ D NL N+ GYT LHIA  RK+PSII+ LL  GA V+
Sbjct  157  NALHYAAAYCDPKVVTEVIGLGLVDVNLRNSWGYTVLHIAVMRKEPSIIVLLLTKGARVS  216

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  217  ELTLDGE  223



>gb|ABA41259.1| NPR1-like protein, partial [Platanus x acerifolia]
Length=243

 Score =   196 bits (498),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL+NFV+KA +ED++PIL VA+HC+L+QLL  CV R+  SDLD+ +LEKELP E
Sbjct  41   VSLFQRRLFNFVDKAFVEDIVPILQVAFHCQLNQLLTHCVHRIACSDLDSISLEKELPYE  100

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK+ R K Q + E D   +D+++EKRIRRI +ALDS+DVELVKLLL ES +TLDDA
Sbjct  101  VVESIKSLRPKSQLDDESDLTAMDTVREKRIRRIHKALDSDDVELVKLLLTESRITLDDA  160

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V +VL LG AD NL NARGYT LH+AA RK+PS+I+ LL  GA   
Sbjct  161  NALHYAAAYCDPKVVADVLGLGQADVNLKNARGYTVLHLAAMRKEPSVIVSLLTKGACAL  220

Query  546  DLASNGQ  566
            +   +G 
Sbjct  221  ETTLDGH  227



>gb|ABA41271.1| NPR1-like protein, partial [Prunus laurocerasus]
Length=261

 Score =   196 bits (499),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP E
Sbjct  37   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLEKGLPDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK      Q+  +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VIEKIKILCRNSQQGCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  R++PSII+ LL  GA  +
Sbjct  157  NALHYAAAYCDPKVVTEVLSLGLADVNLRNSRGYTVLHIAVMRREPSIIVLLLTKGARAS  216

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  217  ELTSDGQ  223



>gb|ABA41267.1| NPR1-like protein, partial [Prunus laurocerasus]
Length=245

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LS L+  C++RV RSD+D+ +LEK LP E
Sbjct  21   VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSPLITQCIERVARSDIDSISLEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VIEKIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESDITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  R++PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRREPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>gb|ABA41272.1| NPR1-like protein, partial [Prunus laurocerasus]
Length=261

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV KA  +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK L  E
Sbjct  37   VSIIQRRLLNFVGKAPADDVIPILVVAFHCQLSQLITQCIERVARSDIDSISLEKGLTDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q+  +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VIEKIKILRRNSQQGCDPNMTVVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  R++PSII+ LL  GA  +
Sbjct  157  NALHYAAAYCDPKVVTEVLSLGLADVNLRNSRGYTVLHIAVMRREPSIIVLLLTKGARAS  216

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  217  ELTSDGQ  223



>gb|KDO44757.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=513

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+EDVIPIL+ A+HC+L+QL   CVQRV RS+LD+  LEKELP E
Sbjct  184  VLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDE  243

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R+K     E +  +VD +  KR+RRI +ALDS+DVEL+KLLLDES VTLDDA
Sbjct  244  VSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDA  303

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYCN K+  EVL++G+AD NL NARG+T LH+AARRK+P++++ LL+ GA  +
Sbjct  304  YALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACAS  363

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  364  ETTSDGQ  370



>emb|CBI29072.3| unnamed protein product [Vitis vinifera]
Length=421

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KAL+EDVIPIL+VAYHC+ S L+  CV RV RSDLD+ +LEK+LP E
Sbjct  13   VSLFQRRLTNFIGKALLEDVIPILVVAYHCKSSVLVNQCVDRVARSDLDSISLEKDLPYE  72

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  RLK Q + E +TV VD + EKR+RRIL+ALDS+DVELVKLLL ES +TLD+A
Sbjct  73   VAESIKLLRLKSQPDDECNTVPVDPVHEKRVRRILKALDSDDVELVKLLLSESGITLDEA  132

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+ K+V+EVL LG+AD N  N RGYT LH+AA RK+PSII+ LL  GA  +
Sbjct  133  YALHYAAAYCDPKVVSEVLSLGLADVNRHNPRGYTVLHVAAMRKEPSIIVSLLTKGAHAS  192

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  193  ERTSDGQ  199



>ref|XP_006366625.1| PREDICTED: regulatory protein NPR3-like [Solanum tuberosum]
Length=575

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  V+R L NFV+KA  EDVIPIL+VA+HC+ +QLLE C+QRV RSDLDN TLEKELP E
Sbjct  165  VMVVERYLDNFVDKATPEDVIPILLVAFHCKSNQLLEHCIQRVARSDLDNATLEKELPHE  224

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK+ RLK ++  E ++++ DSL EKRIRRIL+AL+S+D+EL+ LLL+ES VTL+DA
Sbjct  225  VLTDIKSRRLKSRQGTEQESLEEDSLSEKRIRRILKALESDDIELLTLLLEESNVTLNDA  284

Query  366  yalhyaaayCNSKLVNEVLDLGM-ADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
             ALHYAAAYCNSK+VNEVL+LG+ AD NL N+RGY  LH+AARRK+PSII+GLL  GASV
Sbjct  285  CALHYAAAYCNSKVVNEVLELGLGADVNLQNSRGYNVLHVAARRKEPSIIMGLLAKGASV  344

Query  543  ADLASNGQ  566
             D   +G 
Sbjct  345  LDTTRDGH  352



>gb|ABA38913.1| NPR1-like protein, partial [Prunus avium]
Length=261

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV KAL +DVIPIL+V +HC+LSQL++ C++RV RSDLD+ +LEKELP E
Sbjct  37   VSILQRRLINFVGKALADDVIPILVVGFHCKLSQLIDQCIERVARSDLDSISLEKELPDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ + +   +D L+EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VVEKIKIIRHNSQQDCDSNIAAMDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EV+ LG+ D NL N+RGYT LHIA  RK+PSII+ LL  GA V+
Sbjct  157  NALHYAAAYCDPKVVTEVIGLGLVDVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARVS  216

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  217  ELTLDGE  223



>gb|AGI38063.1| nonexpressor of pathogenesis-related protein 1 [Arachis appressipila]
 gb|AGI38080.1| nonexpressor of pathogenesis-related protein 1 [Arachis appressipila]
Length=481

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P+ ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPEEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGYT LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>gb|AGI38060.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P+ ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPEEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGYT LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>ref|XP_007214958.1| hypothetical protein PRUPE_ppa003232mg [Prunus persica]
 gb|EMJ16157.1| hypothetical protein PRUPE_ppa003232mg [Prunus persica]
Length=590

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFVEKA IEDVIPIL+VA+HC+LSQLL  C+QRV RSDLD+  +EKELP E
Sbjct  180  VQLVQRRLSNFVEKAFIEDVIPILVVAFHCQLSQLLSDCIQRVARSDLDSVAIEKELPHE  239

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK+  L+ Q   E   ++++ +K+KRIRRI +ALDS+DVELV+LLL ES +TLDDA
Sbjct  240  VSNDIKSLCLRSQEKDESSMMEMEPVKDKRIRRIHKALDSDDVELVELLLKESDITLDDA  299

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V EVL LG+A  NL NARGYT LH+AARRK P++++ LLN GAS +
Sbjct  300  YALHYAVAYCDPKVVKEVLGLGLATINLCNARGYTVLHVAARRKHPAVMVPLLNRGASAS  359

Query  546  DLASNGQ  566
            +   +G+
Sbjct  360  ETTVDGR  366



>ref|XP_011040366.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Populus euphratica]
Length=587

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL+ED+IPIL+VA+HC+LSQL+  CV RV RSDLDN ++EKELP +
Sbjct  179  VSLFQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRVARSDLDNISIEKELPHD  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK  R K   + E +T  VD+L+EKRI+RI  ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VAVEIKLLRRKSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAA+YC+ K+V+EVL LG+AD NL N+RGYT LHIAA RK+PS+I+ +L  GAS  
Sbjct  299  NALHYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAKGASAL  358

Query  546  DLASNGQ  566
            DL S+GQ
Sbjct  359  DLTSDGQ  365



>ref|XP_004491374.1| PREDICTED: regulatory protein NPR3-like [Cicer arietinum]
Length=571

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QR L NFV+KAL+EDVIPILM A+HC+L QLL  C+QRV RSDLD  +LEKELP +
Sbjct  182  VLLFQRYLLNFVDKALVEDVIPILMTAHHCQLDQLLSQCIQRVARSDLDIISLEKELPHD  241

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
              ++IK  R++    L PD ++V+ +K+K IR+IL+ALDS+DVEL+KLLLDES VTLDDA
Sbjct  242  AVTEIKLIRVQSLPELAPDAMEVEPVKDKSIRKILKALDSDDVELLKLLLDESSVTLDDA  301

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+SK+V EVL LG+AD  L N RGYT LH+AARRKDPSI++ LL  GA  +
Sbjct  302  YALHYACAYCDSKVVQEVLSLGLADILLKNPRGYTVLHVAARRKDPSILVALLKKGACAS  361

Query  546  DLASNGQ  566
            +   +GQ
Sbjct  362  ETTLDGQ  368



>ref|XP_009629505.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629506.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629507.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629508.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629509.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=579

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +3

Query  15   VQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFS  194
            V+RRL NFV+KA  EDVIPIL+VA+HC  +QLLE C+QRV  SDLDN TLEKEL  EV +
Sbjct  173  VERRLVNFVDKASPEDVIPILLVAFHCSSNQLLEHCIQRVAGSDLDNATLEKELRHEVLT  232

Query  195  DIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayal  374
            DIK  RLK ++ LE D+++VDSL EKRIRRIL+AL+S+D+EL+KLLL+ES VTLDDA AL
Sbjct  233  DIKTRRLKSRQELEQDSIEVDSLSEKRIRRILKALESDDIELLKLLLEESNVTLDDACAL  292

Query  375  hyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLA  554
            HYAAAYCNSK+VNEVL+L +AD NL N+RGY  LH+AARRK+PSII+GLL  GAS  +  
Sbjct  293  HYAAAYCNSKVVNEVLELDLADVNLQNSRGYNVLHVAARRKEPSIIMGLLEKGASFLNTT  352

Query  555  SNG  563
             +G
Sbjct  353  RDG  355



>gb|KDO44756.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=595

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+EDVIPIL+ A+HC+L+QL   CVQRV RS+LD+  LEKELP E
Sbjct  184  VLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDE  243

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R+K     E +  +VD +  KR+RRI +ALDS+DVEL+KLLLDES VTLDDA
Sbjct  244  VSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDA  303

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYCN K+  EVL++G+AD NL NARG+T LH+AARRK+P++++ LL+ GA  +
Sbjct  304  YALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACAS  363

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  364  ETTSDGQ  370



>ref|XP_011040365.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Populus euphratica]
Length=589

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL+ED+IPIL+VA+HC+LSQL+  CV RV RSDLDN ++EKELP +
Sbjct  179  VSLFQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRVARSDLDNISIEKELPHD  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK  R K   + E +T  VD+L+EKRI+RI  ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VAVEIKLLRRKSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAA+YC+ K+V+EVL LG+AD NL N+RGYT LHIAA RK+PS+I+ +L  GAS  
Sbjct  299  NALHYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAKGASAL  358

Query  546  DLASNGQ  566
            DL S+GQ
Sbjct  359  DLTSDGQ  365



>ref|XP_009621669.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009621670.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009621671.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=571

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 146/187 (78%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL N V++A ++DVIPIL+VA+HC L  LLE CVQ+V RSDL+ FTLEKELP +
Sbjct  171  VKAVQRRLINLVDEATVDDVIPILLVAFHCSLGLLLEHCVQKVERSDLEIFTLEKELPSK  230

Query  186  VFSDIKANRLKFQRNLEPDTV-QVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldd  362
            V  DI A RLK Q  +E D + +  SL EKRIR+IL+AL+S+D+EL+KLLL ES VTL+D
Sbjct  231  VLIDINARRLKSQIVIEQDVIMEGGSLHEKRIRKILKALESDDIELLKLLLGESNVTLND  290

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYCNSK+VNEVL LG+AD NL N+RGYT LHI ARR +PSII+ LL+ GAS 
Sbjct  291  ACALHYAAAYCNSKVVNEVLKLGIADVNLRNSRGYTVLHIGARRMEPSIIMSLLDKGASA  350

Query  543  ADLASNG  563
             D   +G
Sbjct  351  LDTTLDG  357



>ref|XP_002322351.2| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEF06478.2| ankyrin repeat family protein [Populus trichocarpa]
Length=587

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL+ED+IPIL+VA+HC+LSQL+  CV R+ RSDLDN ++EKELP +
Sbjct  179  VSLFQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRIARSDLDNISIEKELPHD  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK  R K   + E +T  VD+L+EKRI+RI  ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VAVEIKLLRRKSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAA+YC+ K+V+EVL LG+AD NL N+RGYT LHIAA RK+PS+I+ +L  GAS  
Sbjct  299  NALHYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAKGASAL  358

Query  546  DLASNGQ  566
            DL S+GQ
Sbjct  359  DLTSDGQ  365



>ref|XP_006437091.1| hypothetical protein CICLE_v10031020mg [Citrus clementina]
 gb|ESR50331.1| hypothetical protein CICLE_v10031020mg [Citrus clementina]
Length=595

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+EDVIPIL+ A+HC+L+QL   CVQRV RS+LD+  LEKELP E
Sbjct  184  VLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDE  243

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R+K     E +  +VD +  KR+RRI +ALDS+DVEL+KLLLDES VTLDDA
Sbjct  244  VSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDA  303

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYCN K+  EVL++G+AD NL NARG+T LH+AARRK+P++++ LL+ GA  +
Sbjct  304  YALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACAS  363

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  364  ETTSDGQ  370



>gb|KDO44755.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=599

 Score =   202 bits (513),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+EDVIPIL+ A+HC+L+QL   CVQRV RS+LD+  LEKELP E
Sbjct  184  VLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDE  243

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R+K     E +  +VD +  KR+RRI +ALDS+DVEL+KLLLDES VTLDDA
Sbjct  244  VSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDA  303

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYCN K+  EVL++G+AD NL NARG+T LH+AARRK+P++++ LL+ GA  +
Sbjct  304  YALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACAS  363

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  364  ETTSDGQ  370



>gb|AGI38077.1| nonexpressor of pathogenesis-related protein 1 [Arachis rigonii]
 gb|AGI38086.1| nonexpressor of pathogenesis-related protein 1 [Arachis rigonii]
Length=481

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCAQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSMLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGYT LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>ref|XP_010655930.1| PREDICTED: regulatory protein NPR3 isoform X2 [Vitis vinifera]
Length=478

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KAL+EDVIPIL+VAYHC+ S L+  CV RV RSDLD+ +LEK+LP E
Sbjct  70   VSLFQRRLTNFIGKALLEDVIPILVVAYHCKSSVLVNQCVDRVARSDLDSISLEKDLPYE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  RLK Q + E +TV VD + EKR+RRIL+ALDS+DVELVKLLL ES +TLD+A
Sbjct  130  VAESIKLLRLKSQPDDECNTVPVDPVHEKRVRRILKALDSDDVELVKLLLSESGITLDEA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+ K+V+EVL LG+AD N  N RGYT LH+AA RK+PSII+ LL  GA  +
Sbjct  190  YALHYAAAYCDPKVVSEVLSLGLADVNRHNPRGYTVLHVAAMRKEPSIIVSLLTKGAHAS  249

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  250  ERTSDGQ  256



>ref|XP_007214668.1| hypothetical protein PRUPE_ppa003290mg [Prunus persica]
 gb|EMJ15867.1| hypothetical protein PRUPE_ppa003290mg [Prunus persica]
Length=587

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA HC+LSQL+  C++RV RSD+D+ +LEKELP E
Sbjct  178  VSIFQRRLLNFVGKALADDVIPILVVALHCQLSQLITQCIERVARSDIDSISLEKELPDE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  238  VIEKIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  298  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGACAS  357

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  358  ELTSDGQ  364



>gb|ABA38910.1| NPR1-like protein, partial [Prunus avium]
Length=336

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV KAL +DVIPIL+V +HC+LSQL++ C++RV RSDLD+ +LEKELP E
Sbjct  112  VSILQRRLINFVGKALADDVIPILVVGFHCKLSQLIDQCIERVARSDLDSISLEKELPDE  171

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ + +   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  172  VVEKIKIIRHNSQQDCDSNIAAVDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDEA  231

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EV+ LG+ D NL N+RGYT LHIA  RK+PSII+ LL  GA V+
Sbjct  232  NALHYAAAYCDPKVVTEVIGLGLVDVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARVS  291

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  292  ELTLDGE  298



>gb|AGI38074.1| nonexpressor of pathogenesis-related protein 1 [Arachis pusilla]
 gb|AGI38083.1| nonexpressor of pathogenesis-related protein 1 [Arachis pusilla]
Length=481

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTLDDA
Sbjct  130  VVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLDDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGYT LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>ref|XP_009356589.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
 ref|XP_009356590.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=591

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFVEKALIEDVIPIL+ A+HC+LSQLL  C+QR+ RS LDN  +EKE P E
Sbjct  180  VQLVQRRLSNFVEKALIEDVIPILIAAFHCQLSQLLSHCIQRIVRSKLDNMAIEKEFPHE  239

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK+ RLK   N E   ++++S+++KRIRRI +ALDS+DVELV LLL ES +TLDDA
Sbjct  240  VSNDIKSLRLKSHENDESSMMEIESIEDKRIRRIHKALDSDDVELVGLLLKESDITLDDA  299

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+ K+V EVL LG A+ NL N+RG+T LH+AARRK P++++ LL+ GAS  
Sbjct  300  YALHYAAAYCDPKVVKEVLGLGEANLNLRNSRGHTVLHVAARRKLPAVLVPLLDRGASAL  359

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  360  ETTSDGQ  366



>gb|ABA41263.1| NPR1-like protein, partial [Prunus laurocerasus]
Length=261

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DV+PIL+VA+HC+LS L+  C+ RV RSD+D+ +LEK LP E
Sbjct  37   VSIFQRRLLNFVGKALADDVMPILVVAFHCQLSPLITQCIDRVARSDIDSISLEKGLPDE  96

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R    +  +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  97   VIEKIKILRSNSHQGCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEA  156

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  R++PSII+ LL  GA  +
Sbjct  157  NALHYAAAYCDPKVVTEVLSLGLADVNLRNSRGYTVLHIAVMRREPSIIVLLLTKGARAS  216

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  217  ELTSDGQ  223



>gb|AGI38069.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38091.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P+ ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPEEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGY+ LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>gb|EEC71545.1| hypothetical protein OsI_03882 [Oryza sativa Indica Group]
Length=568

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 151/187 (81%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            +   QRRL NFV+K L+EDV+PIL VA+H EL+ +LE C++R+ RS+LDN +L+KELPPE
Sbjct  163  ISLFQRRLLNFVDKTLVEDVLPILQVAFHSELTPVLEKCIRRIARSNLDNVSLDKELPPE  222

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K Q N E DTV  D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA
Sbjct  223  VAVQIKEIRQKSQPN-EGDTVISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDA  281

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+SK+V+E+LDL +A+ NL N+RGYTALH+AA R++P+II+ LLN GA+V+
Sbjct  282  NALHYAAAYCDSKVVSELLDLRLANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGAAVS  341

Query  546  DLASNGQ  566
             L ++GQ
Sbjct  342  QLTADGQ  348



>gb|AGI38075.1| nonexpressor of pathogenesis-related protein 1 [Arachis appressipila]
 gb|AGI38084.1| nonexpressor of pathogenesis-related protein 1 [Arachis appressipila]
Length=481

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGYT LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>gb|AGI38064.1| nonexpressor of pathogenesis-related protein 1 [Arachis triseminata]
 gb|AGI38076.1| nonexpressor of pathogenesis-related protein 1 [Arachis paraguariensis]
 gb|AGI38078.1| nonexpressor of pathogenesis-related protein 1 [Arachis triseminata]
 gb|AGI38085.1| nonexpressor of pathogenesis-related protein 1 [Arachis paraguariensis]
Length=481

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGYT LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>gb|AIM54370.1| nonexpressor of pathogenesis-related protein 1 [Gladiolus hybrid 
cultivar]
Length=588

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK L+EDVIPIL+VA+H +L+QLL  CVQRV RS+LDN +LEKELP EV ++
Sbjct  185  QRRLLNFVEKTLVEDVIPILLVAFHSQLNQLLRTCVQRVARSNLDNISLEKELPSEVVAE  244

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK+ R  FQ N + D   VD++ EKRIRRI  ALDS+DVELVKLLL ES VTLDDA ALH
Sbjct  245  IKSVRRSFQVN-DCDVPSVDTVHEKRIRRIHGALDSDDVELVKLLLKESDVTLDDATALH  303

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAAAYC+SK+V EVL+L +A+ NL N RGYT LH+AA R++P++I+ LL+ GAS ++  S
Sbjct  304  YAAAYCDSKVVAEVLELDLANVNLKNERGYTPLHVAAMRREPAVIVSLLDKGASASEATS  363

Query  558  NGQ  566
            +GQ
Sbjct  364  DGQ  366



>gb|AGI38062.1| nonexpressor of pathogenesis-related protein 1 [Arachis glabrata]
 gb|AGI38073.1| nonexpressor of pathogenesis-related protein 1 [Arachis correntina]
 gb|AGI38079.1| nonexpressor of pathogenesis-related protein 1 [Arachis glabrata]
 gb|AGI38082.1| nonexpressor of pathogenesis-related protein 1 [Arachis correntina]
Length=481

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 146/189 (77%), Gaps = 4/189 (2%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPD--TVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTld  359
            V  +IK+  L+ Q  LEP    ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+
Sbjct  130  VVDEIKS--LRAQSVLEPTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLN  187

Query  360  dayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGAS  539
            DAYALHYA AY +SK++ EVL+LG+AD NL N RGYT LH+AARRKDPSI++ LL  GA+
Sbjct  188  DAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVALLKKGAN  247

Query  540  VADLASNGQ  566
             +D   +GQ
Sbjct  248  ASDTTPDGQ  256



>gb|ABF48718.1| ankyrin repeat BTB/POZ domain-containing protein [Populus trichocarpa]
Length=679

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +3

Query  15   VQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFS  194
            VQRRL NFV KAL+ED+IPIL+VA+HC+LSQL+  CV R+ RSDLDN ++EKELP +V  
Sbjct  212  VQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRIARSDLDNISIEKELPHDVAV  271

Query  195  DIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayal  374
            +IK  R K   + E +T  VD+L+EKRI+RI  ALDS+DVELVKLLL ES +TLDDA AL
Sbjct  272  EIKLLRRKSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDANAL  331

Query  375  hyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLA  554
            HYAA+YC+ K+V+EVL LG+AD NL N+RGYT LHIAA RK+PS+I+ +L  GAS  DL 
Sbjct  332  HYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAKGASALDLT  391

Query  555  SNGQ  566
            S+GQ
Sbjct  392  SDGQ  395



>ref|XP_008225741.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=587

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL +DVIPIL+VA+HC+LSQL+  C++RV RSD+D+ +LEK LP E
Sbjct  178  VSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLEKGLPDE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  238  VIEKIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLKESAITLDEA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  298  NALHYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  357

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  358  ELTSDGQ  364



>ref|XP_010908601.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
 ref|XP_010908602.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
Length=587

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFVEKA +EDVIPIL+VA+H +LSQLL  C++RV RSDLDN +L+KELP E
Sbjct  181  VSLLQRRLLNFVEKAFVEDVIPILLVAFHSQLSQLLSHCMKRVARSDLDNISLQKELPQE  240

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK  R K Q + EP+++ VD + EKRIRRI RALDS+DVELVKLLL ES  TLDDA
Sbjct  241  VAEEIKLIRHKAQTD-EPNSLTVDPVLEKRIRRIHRALDSDDVELVKLLLSESDTTLDDA  299

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+SK+V E+L++G A+ NL N RGYT LH+AA RK+P++I+ LL  GAS +
Sbjct  300  NALHYAAAYCDSKVVAELLEMGSANVNLRNNRGYTPLHVAAMRKEPAVIVSLLTKGASAS  359

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  360  ETTADGQ  366



>gb|AGI38059.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VSLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGY+ LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>gb|EYU42809.1| hypothetical protein MIMGU_mgv1a003347mg [Erythranthe guttata]
Length=591

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 145/187 (78%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFV+KA +EDVIPIL+VA  C L++LL  C+QR+ RSDLDN  +EKELP +
Sbjct  184  VMVVQRRLLNFVDKAFVEDVIPILIVASTCNLNELLSHCLQRIARSDLDNTIIEKELPYQ  243

Query  186  VFSDIKANRLKFQ-RNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldd  362
              +++K+ RLK   +  E D++Q D   EKRI+RI RALDSNDVELVK+LL+ES ++LD 
Sbjct  244  TQNEVKSLRLKSNNQEEEHDSIQADPTNEKRIKRIHRALDSNDVELVKMLLEESGISLDS  303

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYCN K+V EVL+LG AD +L + RGYT LH+AARRKDPSI++GLL  GASV
Sbjct  304  ALALHYAAAYCNPKIVAEVLNLGFADVSLRDPRGYTVLHVAARRKDPSIVVGLLTKGASV  363

Query  543  ADLASNG  563
            +D   +G
Sbjct  364  SDRTRDG  370



>ref|NP_001044363.1| Os01g0767900 [Oryza sativa Japonica Group]
 gb|ABE11615.1| ankyrin-repeat protein [Oryza sativa Japonica Group]
 gb|ABE11616.1| ankyrin-repeat protein [Oryza sativa Japonica Group]
 dbj|BAF06277.1| Os01g0767900 [Oryza sativa Japonica Group]
 dbj|BAG90312.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEF30409.1| putative NPR1-like protein 1 [Oryza sativa Japonica Group]
Length=635

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 151/187 (81%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            +   QRRL NFV+K L+EDV+PIL VA+H EL+ +LE C++R+ RS+LDN +L+KELPPE
Sbjct  230  ISLFQRRLLNFVDKTLVEDVLPILQVAFHSELTPVLEKCIRRIARSNLDNVSLDKELPPE  289

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K Q N E DTV  D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA
Sbjct  290  VAVQIKEIRQKSQPN-EGDTVISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDA  348

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+SK+V+E+LDL +A+ NL N+RGYTALH+AA R++P+II+ LLN GA+V+
Sbjct  349  NALHYAAAYCDSKVVSELLDLRLANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGAAVS  408

Query  546  DLASNGQ  566
             L ++GQ
Sbjct  409  QLTADGQ  415



>gb|AGI38061.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38067.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38072.1| nonexpressor of pathogenesis-related protein 1 [Arachis duranensis]
 gb|AGI38081.1| nonexpressor of pathogenesis-related protein 1 [Arachis duranensis]
 gb|AGI38089.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGY+ LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>gb|ABA41254.1| NPR1-like protein, partial [Cydonia oblonga]
Length=245

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KA  ++VIPIL+VA+HC+L+QL++ CV RV RSD+D+ +LEK LP E
Sbjct  21   VSIFERRLLNFVGKAPSDNVIPILVVAFHCQLNQLIDQCVDRVARSDIDDISLEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VVKKIKILRRSYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>gb|AGI38065.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38087.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTLDDA
Sbjct  130  VVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLDDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGY+ LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>dbj|BAD53355.1| putative NPR1 [Oryza sativa Japonica Group]
 dbj|BAD53329.1| putative NPR1 [Oryza sativa Japonica Group]
Length=624

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 151/187 (81%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            +   QRRL NFV+K L+EDV+PIL VA+H EL+ +LE C++R+ RS+LDN +L+KELPPE
Sbjct  219  ISLFQRRLLNFVDKTLVEDVLPILQVAFHSELTPVLEKCIRRIARSNLDNVSLDKELPPE  278

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K Q N E DTV  D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA
Sbjct  279  VAVQIKEIRQKSQPN-EGDTVISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDA  337

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+SK+V+E+LDL +A+ NL N+RGYTALH+AA R++P+II+ LLN GA+V+
Sbjct  338  NALHYAAAYCDSKVVSELLDLRLANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGAAVS  397

Query  546  DLASNGQ  566
             L ++GQ
Sbjct  398  QLTADGQ  404



>gb|AGI38066.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38088.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGY+ LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>gb|ABA41289.1| NPR1-like protein, partial [Cydonia oblonga]
 gb|ABA60147.1| NPR1-like protein, partial [Cydonia oblonga]
Length=245

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KA  ++VIPIL+VA+HC+L+QL++ CV RV RSD+D+ +LEK LP E
Sbjct  21   VSIFERRLLNFVGKAPSDNVIPILVVAFHCQLNQLIDQCVDRVARSDIDDISLEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VVKKIKILRRSYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>ref|XP_002274045.1| PREDICTED: regulatory protein NPR3 isoform X1 [Vitis vinifera]
Length=587

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KAL+EDVIPIL+VAYHC+ S L+  CV RV RSDLD+ +LEK+LP E
Sbjct  179  VSLFQRRLTNFIGKALLEDVIPILVVAYHCKSSVLVNQCVDRVARSDLDSISLEKDLPYE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  RLK Q + E +TV VD + EKR+RRIL+ALDS+DVELVKLLL ES +TLD+A
Sbjct  239  VAESIKLLRLKSQPDDECNTVPVDPVHEKRVRRILKALDSDDVELVKLLLSESGITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+ K+V+EVL LG+AD N  N RGYT LH+AA RK+PSII+ LL  GA  +
Sbjct  299  YALHYAAAYCDPKVVSEVLSLGLADVNRHNPRGYTVLHVAAMRKEPSIIVSLLTKGAHAS  358

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  359  ERTSDGQ  365



>ref|XP_010272311.1| PREDICTED: regulatory protein NPR3 isoform X1 [Nelumbo nucifera]
Length=571

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL  FVEKA  EDVIPILMVA+HC+L+ L++ CVQR+ RSDLD+ +LEK LP E
Sbjct  179  VSLFQRRLLIFVEKAFAEDVIPILMVAFHCQLNHLIDHCVQRIARSDLDSISLEK-LPNE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  DIK+ RLK   + E   + VD ++EK IRRI +ALDS+DVELVKLLL+ES VTLDDA
Sbjct  238  VKMDIKSLRLKSHLD-EASAMDVDPVREKNIRRIHKALDSDDVELVKLLLNESGVTLDDA  296

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVLDLG+A+ NL +ARGYT LH+AA RK+PSII+ LLN GAS  
Sbjct  297  NALHYAAAYCDPKVVAEVLDLGLANANLRDARGYTVLHVAAMRKEPSIIVRLLNKGASAL  356

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  357  ELTSDGQ  363



>ref|XP_010272312.1| PREDICTED: regulatory protein NPR3 isoform X2 [Nelumbo nucifera]
Length=570

 Score =   199 bits (505),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL  FVEKA  EDVIPILMVA+HC+L+ L++ CVQR+ RSDLD+ +LEK LP E
Sbjct  179  VSLFQRRLLIFVEKAFAEDVIPILMVAFHCQLNHLIDHCVQRIARSDLDSISLEK-LPNE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  DIK+ RLK   + E   + VD ++EK IRRI +ALDS+DVELVKLLL+ES VTLDDA
Sbjct  238  VKMDIKSLRLKSHLD-EASAMDVDPVREKNIRRIHKALDSDDVELVKLLLNESGVTLDDA  296

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVLDLG+A+ NL +ARGYT LH+AA RK+PSII+ LLN GAS  
Sbjct  297  NALHYAAAYCDPKVVAEVLDLGLANANLRDARGYTVLHVAAMRKEPSIIVRLLNKGASAL  356

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  357  ELTSDGQ  363



>gb|ABA38908.1| NPR1-like protein, partial [Pyrus communis]
Length=245

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPIL+VA+HC+L+QL++ C+ RV RSD+D+ +LEK LP E
Sbjct  21   VSIFERRLLNFVGKALSDNVIPILVVAFHCQLNQLIDQCIDRVARSDIDDISLEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKR+RRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VVKKIKILRRNYQQDSDPNLPPADPLLEKRMRRIHKALDSDDVELVKLLLTESNITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>ref|XP_008229582.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=589

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFVEKA IEDVIPIL+VA+HC+LSQLL  C+Q V RSDLD+  +EKELP E
Sbjct  180  VQLVQRRLSNFVEKAFIEDVIPILVVAFHCQLSQLLSHCIQWVARSDLDSVAIEKELPHE  239

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V + IK+  LK Q   E   ++++ +++KRIRRI +ALDS+DVELV+LLL ES +TLDDA
Sbjct  240  VSNVIKSLHLKSQEKDESSMMEMEPVEDKRIRRIHKALDSDDVELVELLLKESDITLDDA  299

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V EVL LG+A  NL NARG+T LH+AARRK+P++++ LLN GAS +
Sbjct  300  YALHYAVAYCDPKVVKEVLGLGLATINLCNARGHTVLHVAARRKNPAVMVPLLNRGASAS  359

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  360  ETTADGQ  366



>gb|AGI38068.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38090.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVE+A++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNFVERAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGY+ LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYARAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>gb|ABA38920.1| NPR1-like protein, partial [Cydonia oblonga]
 gb|ABA41288.1| NPR1-like protein, partial [Cydonia oblonga]
Length=251

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KA  ++VIPIL+VA+HC+L+QL++ CV RV RSD+D+ +LEK LP E
Sbjct  27   VSIFERRLLNFVGKAPSDNVIPILVVAFHCQLNQLIDQCVDRVARSDIDDISLEKGLPDE  86

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  87   VVKKIKILRRSYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNITLDEA  146

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  147  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  206

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  207  ELTSDGQ  213



>gb|ABA38904.1| NPR1-like protein, partial [Pyrus communis]
Length=252

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPIL+VA+HC+L+QL++ C+ RV RSD+D+ +LEK LP E
Sbjct  28   VSIFERRLLNFVGKALSDNVIPILVVAFHCQLNQLIDQCIDRVARSDIDDISLEKGLPDE  87

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKR+RRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  88   VVKKIKILRRNYQQDSDPNLPPADPLLEKRMRRIHKALDSDDVELVKLLLTESNITLDEA  147

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  148  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  207

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  208  ELTSDGQ  214



>ref|XP_008806697.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
 ref|XP_008806698.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
 ref|XP_008806699.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
Length=591

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFVEKAL+EDVIPIL VA H +L+QL   C++RV RSDLD  +LEKELP E
Sbjct  183  VSLLQRRLLNFVEKALVEDVIPILRVALHSQLNQLRSHCIKRVARSDLDKISLEKELPHE  242

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R K Q + EP+++ VD + EKR RRILRALDS+DVELVKLLL ES +TLDDA
Sbjct  243  VAEEIKSIRCKAQPD-EPNSLTVDPVHEKRTRRILRALDSDDVELVKLLLSESDITLDDA  301

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+SK+V E+L+LG A+ NL N RGYT LH+AA R +P+II+ LL  GASV+
Sbjct  302  NALHYAAAYCDSKVVAELLELGSANVNLKNVRGYTPLHVAAMRMEPAIIVSLLTKGASVS  361

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  362  ETTADGQ  368



>ref|XP_007213800.1| hypothetical protein PRUPE_ppa003221mg [Prunus persica]
 gb|EMJ14999.1| hypothetical protein PRUPE_ppa003221mg [Prunus persica]
Length=591

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV KAL +DVIPIL+V +HC+LSQL++ C++RV RSDLD+ +LEKELP E
Sbjct  182  VSILQRRLINFVGKALADDVIPILLVGFHCKLSQLIDQCIERVARSDLDSISLEKELPDE  241

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +   IK  R   Q++ +P+   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  242  IVEKIKIIRHNSQQDCDPNIAAVDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDEA  301

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EV+ LG+ D NL N+RGYT LHIA  RK+PSII+ LL  GA V+
Sbjct  302  NALHYAAAYCDPKVVTEVIGLGLVDVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARVS  361

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  362  ELTLDGE  368



>gb|ABA38907.1| NPR1-like protein, partial [Pyrus communis]
Length=245

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL  +VIPIL+VA+HC+L+QL++ C+ RV RSD+D+ +LEK LP E
Sbjct  21   VSIFERRLLNFVGKALSGNVIPILVVAFHCQLNQLIDQCIDRVARSDIDDISLEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKR+RRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VVKKIKILRRNYQQDSDPNLPPADPLLEKRMRRIHKALDSDDVELVKLLLTESNITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>gb|AEE81755.1| regulatory protein NPR2 [Populus deltoides]
Length=587

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL+ED+IPIL+VA+HC+LSQL+  CV R+ RSDLDN ++EKELP +
Sbjct  179  VSLFQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRIARSDLDNISIEKELPHD  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK  R     + E +T  VD+L+EKRI+RI  ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VAVEIKLLRRNSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAA+YC+ K+V+EVL LG+AD NL N+RGYT LHIAA RK+PS+I+ +L  GAS  
Sbjct  299  NALHYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAKGASAL  358

Query  546  DLASNGQ  566
             L S+GQ
Sbjct  359  QLTSDGQ  365



>ref|XP_008380174.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=409

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +3

Query  15   VQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFS  194
            +QRRL NFVEKALIEDVIPIL  A+HC+LSQLL  C+QR+ RSDLD   + KE P EV +
Sbjct  1    MQRRLSNFVEKALIEDVIPILKAAFHCQLSQLLSHCIQRIARSDLDYMAIGKEFPHEVSN  60

Query  195  DIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayal  374
            DIK+ RLK   N E   ++++ +++KRIRRI +ALDS+DVELV LLL ES +TLDDAYAL
Sbjct  61   DIKSLRLKSHENDESSMMEIELIEDKRIRRIHKALDSDDVELVGLLLKESDITLDDAYAL  120

Query  375  hyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLA  554
            HYA AYC+ K+V EVL LG A+ NL N+RG+T LH+AARRK P++++ LL+ GAS  +  
Sbjct  121  HYAVAYCDPKVVKEVLSLGEANLNLRNSRGHTVLHVAARRKLPAVLVPLLDRGASALETT  180

Query  555  SNGQ  566
            S+GQ
Sbjct  181  SDGQ  184



>gb|KJB69916.1| hypothetical protein B456_011G050200 [Gossypium raimondii]
 gb|KJB69917.1| hypothetical protein B456_011G050200 [Gossypium raimondii]
Length=465

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+ED+IPIL+VA+HC+ SQL+  CV RV RSDLD+  +EKELP E
Sbjct  179  VPLFQRRLLNFVEKALLEDIIPILVVAFHCQCSQLVSQCVDRVARSDLDSICIEKELPYE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   I+  R K   + E +   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VTESIRLLRRKSPSDGEGNEAVVDPLQEKRIRRIHKALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL L +AD NL N+RGYT LHIAA RK+PS+I+ LL  GAS +
Sbjct  299  TALHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMALLAKGASAS  358

Query  546  DLASNGQ  566
             L  +GQ
Sbjct  359  TLTFDGQ  365



>gb|AGI38071.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38093.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL N VEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P E
Sbjct  70   VLLFQRRLLNLVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQE  129

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL+ES VTL+DA
Sbjct  130  VVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLNESKVTLNDA  189

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ EVL+LG+AD NL N RGY+ LH+AARRKDPSI++ LL  GA+ +
Sbjct  190  YALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVALLKKGANAS  249

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  250  DTTPDGQ  256



>ref|XP_010942675.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
Length=604

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFVEKAL+EDVIPIL+VA H +L+QLL  C++R+ RSDLDN +L+K+LP E
Sbjct  195  VSLLQRRLLNFVEKALVEDVIPILLVAVHSQLNQLLSHCIKRIARSDLDNISLDKQLPHE  254

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
               +IK  R K Q + EP++  VD + EKRIRRI RALDS+DVELVKLLL ES +TLDDA
Sbjct  255  AAEEIKLIRRKAQPD-EPNSSIVDPIHEKRIRRIHRALDSDDVELVKLLLSESDITLDDA  313

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             A+HYAAAYC+SK+V+E+L+LG A+ NL N RGYT LH+AA R++P+II+ LL  GAS +
Sbjct  314  NAIHYAAAYCDSKVVSELLELGSANVNLKNDRGYTPLHVAAMRREPAIIVSLLTKGASAS  373

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  374  ETTSDGQ  380



>ref|NP_001233844.1| NIM1-like protein 2 [Solanum lycopersicum]
 ref|XP_010323612.1| PREDICTED: NIM1-like protein 2 isoform X1 [Solanum lycopersicum]
 ref|XP_010323613.1| PREDICTED: NIM1-like protein 2 isoform X1 [Solanum lycopersicum]
 gb|AAT57639.1| NIM1-like protein 2 [Solanum lycopersicum]
Length=573

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 153/188 (81%), Gaps = 3/188 (2%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V FV+R L NFV+KA  EDVIPIL+VA+H + +QLLE C+QRV RSDLDN TLEKELP E
Sbjct  165  VMFVERYLDNFVDKATPEDVIPILLVAFHRKSNQLLEHCIQRVARSDLDNATLEKELPHE  224

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK+ RLK ++  E ++  +DSL EKRIRRIL+AL+S+D+EL+ LLL+ES VTL+DA
Sbjct  225  VLTDIKSRRLKSRQGTEQES--LDSLSEKRIRRILKALESDDIELLTLLLEESNVTLNDA  282

Query  366  yalhyaaayCNSKLVNEVLDLGM-ADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
             ALHYAAAYCNSK+VNEVL+LG+ AD NL N+RGY  LH+AARRK+PSII+GLL  GASV
Sbjct  283  CALHYAAAYCNSKVVNEVLELGLGADVNLQNSRGYNVLHVAARRKEPSIIMGLLAKGASV  342

Query  543  ADLASNGQ  566
             D   +G 
Sbjct  343  LDTTRDGH  350



>ref|XP_008225738.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=591

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV KAL + VIPIL+V +HC+LSQL++ C++RV RSDLD+ +LEKELP E
Sbjct  182  VSILQRRLINFVGKALADHVIPILVVGFHCKLSQLIDQCIERVARSDLDSISLEKELPDE  241

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q++ +P+   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  242  VVEKIKIIRHNSQQDCDPNIAAVDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDEA  301

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EV+ LG+ D NL N+RGYT LHIA  RK+PSII+ LL  GA V+
Sbjct  302  NALHYAAAYCDPKVVTEVIGLGLVDVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARVS  361

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  362  ELTLDGE  368



>gb|ACJ45014.1| NPR1-2 protein [Glycine max]
Length=502

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KAL+EDVIPIL VA+HC+LSQL+  C+ RV RSDLD  ++++ELP E
Sbjct  179  VSLFQRRLLNFIGKALVEDVIPILTVAFHCQLSQLVNQCIDRVARSDLDQISIDQELPNE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +   +K  R   QR++E D   VD+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+A
Sbjct  239  LSQKVKLLRRNPQRDVENDASIVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL LG+A+ NL N+RGYT LHIAA RK+PSII+ LL  GA  +
Sbjct  299  NALHYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +GQ
Sbjct  359  DLTFDGQ  365



>gb|ABA38909.1| NPR1-like protein, partial [Pyrus communis]
Length=245

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPIL+VA+ C+L+QL+   ++RV RSD+D+ ++EK LP E
Sbjct  21   VSIFERRLLNFVGKALPDNVIPILVVAFRCQLNQLIAEGIERVARSDIDDISIEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K QR+   +   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  81   VVKKIKVLRCKAQRDCVSNLPPVDPLREKRIRRIHKALDSDDVELVKLLLTESNITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVLDLG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLDLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>gb|AGL61506.1| NPR1 [Morus alba var. multicaulis]
Length=581

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFV KAL+EDVIPIL VA+HC+LSQL   CV RV RSDL+  +LEKELP EV  +
Sbjct  177  QRRLLNFVGKALVEDVIPILGVAFHCQLSQLFAECVDRVARSDLEIVSLEKELPHEVAEN  236

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R K     + +T   D L+EKRIRRI +ALDS+DVELV+LLL ES +TLDDA ALH
Sbjct  237  IKVLRRKSPCGDKDNTESADPLREKRIRRIHKALDSDDVELVELLLTESEITLDDANALH  296

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAAAYC+ K+V EVL LG+AD NL N+RGYT LH+AA RK PSII+ LL  GA  +DL S
Sbjct  297  YAAAYCDPKVVTEVLGLGLADVNLQNSRGYTVLHVAAMRKVPSIIVSLLTKGAYASDLTS  356

Query  558  NGQ  566
            +GQ
Sbjct  357  DGQ  359



>gb|KJB69919.1| hypothetical protein B456_011G050200 [Gossypium raimondii]
Length=541

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+ED+IPIL+VA+HC+ SQL+  CV RV RSDLD+  +EKELP E
Sbjct  179  VPLFQRRLLNFVEKALLEDIIPILVVAFHCQCSQLVSQCVDRVARSDLDSICIEKELPYE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   I+  R K   + E +   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VTESIRLLRRKSPSDGEGNEAVVDPLQEKRIRRIHKALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL L +AD NL N+RGYT LHIAA RK+PS+I+ LL  GAS +
Sbjct  299  TALHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMALLAKGASAS  358

Query  546  DLASNGQ  566
             L  +GQ
Sbjct  359  TLTFDGQ  365



>gb|ABA38902.1| NPR1-like protein, partial [Pyrus communis]
Length=336

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPIL+VA+HC+L+QL++ C+ RV RSD+D+ +LEK LP E
Sbjct  112  VSIFERRLLNFVGKALSDNVIPILVVAFHCQLNQLIDQCIDRVARSDIDDISLEKGLPDE  171

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKR+RRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  172  VVKKIKILRRNYQQDSDPNLPPADPLLEKRMRRIHKALDSDDVELVKLLLTESNITLDEA  231

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  232  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  291

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  292  ELTSDGQ  298



>gb|KDO77445.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=501

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KA+ ED+IPIL+ A+HC+LSQLL  CV R+ RSDLD  ++EKELP E
Sbjct  179  VSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIEKELPTE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+  RLK   + E   V+VD L+EKRI+RI +ALDS+DVELV+LLL ES +TLD+A
Sbjct  239  VAEEIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+++EVL LG+AD NL ++RGYT LHI A RK+PS+I+ LL  GA  +
Sbjct  299  NALHYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +G+
Sbjct  359  DLTLDGR  365



>ref|XP_008348376.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like, 
partial [Malus domestica]
Length=586

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFVEKALIEDVIPIL  A+HC+LSQLL  C+QR+ RSDLD   + KE P E
Sbjct  175  VQLVQRRLSNFVEKALIEDVIPILKAAFHCQLSQLLSHCIQRIARSDLDYMAIGKEFPHE  234

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK+ RLK   N E   ++++ +++KRIRRI +ALDS+DVELV LLL ES +TLDDA
Sbjct  235  VSNDIKSLRLKSHENDESSMMEIELIEDKRIRRIHKALDSDDVELVGLLLKESDITLDDA  294

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V EVL LG A+ NL N+RG+T LH+AARRK P++++ LL+ GAS  
Sbjct  295  YALHYAVAYCDPKVVKEVLSLGEANLNLRNSRGHTVLHVAARRKLPAVLVPLLDRGASAL  354

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  355  ETTSDGQ  361



>gb|ABA38906.1| NPR1-like protein, partial [Pyrus communis]
Length=251

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPIL+VA+HC+L+QL++ C+ RV RSD+D+ +LEK LP E
Sbjct  27   VSIFERRLLNFVGKALSDNVIPILVVAFHCQLNQLIDQCIDRVARSDIDDISLEKGLPDE  86

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKR+RRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  87   VVKKIKILRRNYQQDSDPNLPPADPLLEKRMRRIHKALDSDDVELVKLLLTESNITLDEA  146

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+ SII+ LL  GA  +
Sbjct  147  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEQSIIVLLLTKGARAS  206

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  207  ELTSDGQ  213



>gb|ABA41252.1| NPR1-like protein [Pyrus communis]
Length=245

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QR+L +FV KAL +DV+PILMVA+HC+LSQL++ C++RV  SDLD+ +LEK LP E
Sbjct  21   VSILQRQLIDFVVKALADDVLPILMVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A
Sbjct  81   VVEKIKVLRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL ++RGYT LHIA  RK+PSII+ LL NGA  +
Sbjct  141  NALHYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLLPNGARAS  200

Query  546  DLASNGQ  566
            +    G+
Sbjct  201  EPTLEGE  207



>gb|ABA38905.1| NPR1-like protein, partial [Pyrus communis]
Length=252

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QR+L +FV KAL +DVIPIL+VA+HC+LSQL++ C++RV  SDLD+ +LEK LP E
Sbjct  28   VSILQRQLIDFVVKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDE  87

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A
Sbjct  88   VVEKIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEA  147

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL ++RGYT LHIA  RK+PSII+ LL+NGA  +
Sbjct  148  NALHYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLLSNGARAS  207

Query  546  DLASNGQ  566
            +    G+
Sbjct  208  EPTLEGE  214



>gb|KJB69920.1| hypothetical protein B456_011G050200 [Gossypium raimondii]
Length=587

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+ED+IPIL+VA+HC+ SQL+  CV RV RSDLD+  +EKELP E
Sbjct  179  VPLFQRRLLNFVEKALLEDIIPILVVAFHCQCSQLVSQCVDRVARSDLDSICIEKELPYE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   I+  R K   + E +   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VTESIRLLRRKSPSDGEGNEAVVDPLQEKRIRRIHKALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL L +AD NL N+RGYT LHIAA RK+PS+I+ LL  GAS +
Sbjct  299  TALHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMALLAKGASAS  358

Query  546  DLASNGQ  566
             L  +GQ
Sbjct  359  TLTFDGQ  365



>gb|KDO77446.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=532

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KA+ ED+IPIL+ A+HC+LSQLL  CV R+ RSDLD  ++EKELP E
Sbjct  179  VSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIEKELPTE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+  RLK   + E   V+VD L+EKRI+RI +ALDS+DVELV+LLL ES +TLD+A
Sbjct  239  VAEEIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+++EVL LG+AD NL ++RGYT LHI A RK+PS+I+ LL  GA  +
Sbjct  299  NALHYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +G+
Sbjct  359  DLTLDGR  365



>ref|XP_007141442.1| hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris]
 gb|ESW13436.1| hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris]
Length=588

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QR+L NFV+KAL+EDVIPILM A++C+L QLL  C+ +V  SD D+ +LEKELP E
Sbjct  178  VLLFQRQLLNFVDKALVEDVIPILMAAFNCQLEQLLSRCIHKVASSDFDSISLEKELPHE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V ++IK+ RL FQ     D ++V+ L EK I RI +ALDS+DVEL+KLLL+ES VTLDDA
Sbjct  238  VVTEIKSCRLSFQPESAADAMEVEPLSEKSIMRIHKALDSDDVELLKLLLNESRVTLDDA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AY +SK++ E+L LGMAD    N+RGYT LH+AARRKDPSI++ LLN GA   
Sbjct  298  YALHYACAYSDSKVIQELLGLGMADILRRNSRGYTVLHVAARRKDPSILVALLNKGACAT  357

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  358  DTTPDGQ  364



>gb|ADP95762.1| npr1 protein [Malus hupehensis]
Length=586

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++V+PIL+VA+HC+L+QL++ CV RV RSD+D+ +LEK LP E
Sbjct  178  VSIFERRLLNFVGKALSDNVVPILLVAFHCQLNQLIDQCVDRVARSDIDDISLEKGLPDE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  238  VVKKIKILRRNYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNITLDEA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYTALHIA  RK+PSII+ LL  GA  +
Sbjct  298  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTALHIAVMRKEPSIIVLLLTKGARAS  357

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  358  ELTSDGQ  364



>gb|KHG00475.1| Regulatory NPR3 -like protein [Gossypium arboreum]
Length=587

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+ED++PIL+VA+HC+ SQL+  CV RV RSDLD+  +EKELP E
Sbjct  179  VPLFQRRLLNFVEKALLEDIMPILVVAFHCQCSQLVSQCVDRVARSDLDSICIEKELPYE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   I+  R K   + E +   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VTESIRLLRCKSPSDGEGNEAVVDPLREKRIRRIHKALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL L +AD NL N+RGYT LHIAA RK+PS+I+ LL  GAS +
Sbjct  299  TALHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMALLAKGASAS  358

Query  546  DLASNGQ  566
             L  +GQ
Sbjct  359  TLTLDGQ  365



>ref|NP_001238674.1| NPR1-2 protein [Glycine max]
 gb|ACJ45015.1| NPR1-2 protein [Glycine max]
Length=590

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KAL+EDVIPIL VA+HC+LSQL+  C+ RV RSDLD  ++++ELP E
Sbjct  179  VSLFQRRLLNFIGKALVEDVIPILTVAFHCQLSQLVNQCIDRVARSDLDQISIDQELPNE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +   +K  R   QR++E D   VD+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+A
Sbjct  239  LSQKVKLLRRNPQRDVENDASIVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL LG+A+ NL N+RGYT LHIAA RK+PSII+ LL  GA  +
Sbjct  299  NALHYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +GQ
Sbjct  359  DLTFDGQ  365



>gb|KHN14362.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KAL+EDVIPIL VA+HC+LSQL+  C+ RV RSDLD  ++++ELP E
Sbjct  179  VSLFQRRLLNFIGKALVEDVIPILTVAFHCQLSQLVNQCIDRVARSDLDQISIDQELPNE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +   +K  R   QR++E D   VD+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+A
Sbjct  239  LSQKVKLLRRNPQRDVENDASIVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL LG+A+ NL N+RGYT LHIAA RK+PSII+ LL  GA  +
Sbjct  299  NALHYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +GQ
Sbjct  359  DLTFDGQ  365



>gb|KDO77444.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=587

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KA+ ED+IPIL+ A+HC+LSQLL  CV R+ RSDLD  ++EKELP E
Sbjct  179  VSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIEKELPTE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+  RLK   + E   V+VD L+EKRI+RI +ALDS+DVELV+LLL ES +TLD+A
Sbjct  239  VAEEIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+++EVL LG+AD NL ++RGYT LHI A RK+PS+I+ LL  GA  +
Sbjct  299  NALHYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +G+
Sbjct  359  DLTLDGR  365



>gb|ABA41255.1| NPR1-like protein, partial [Cydonia oblonga]
Length=245

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPI++VA+HC+L+QL+   ++RV RSD+D+ ++EK LP E
Sbjct  21   VSIFERRLINFVGKALPDNVIPIVVVAFHCQLNQLIAQGIERVARSDIDDISIEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IKA R K Q++   +   VD L+EKRIRRI +ALDS+DVELV+LLL ES +TLD+A
Sbjct  81   VVKKIKALRRKPQQDCVSNLPPVDPLREKRIRRIHKALDSDDVELVRLLLTESDITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>ref|XP_004970097.1| PREDICTED: regulatory protein NPR3-like [Setaria italica]
Length=629

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            +   QRRL NFV+K L+EDVIPIL VA H EL+Q+L+ C+QR+ RS+LD+ +L+KEL PE
Sbjct  214  ISLFQRRLLNFVDKTLVEDVIPILQVASHSELTQVLDKCIQRIARSNLDDISLDKELSPE  273

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK  R K Q   + D    D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA
Sbjct  274  VVEEIKKIRKKLQ-TADDDASISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDA  332

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAA+YC+SK+V+E+L+LG+A+ NL N+RGYTALH+AA R++P+II+ LLN GA+V+
Sbjct  333  NALHYAASYCDSKVVSELLELGLANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGATVS  392

Query  546  DLASNGQ  566
             L ++G+
Sbjct  393  QLTADGR  399



>ref|XP_006468441.1| PREDICTED: regulatory protein NPR3-like [Citrus sinensis]
Length=587

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KA+ ED+IPIL+ A+HC+LSQLL  CV R+ RSDLD  +++KELP E
Sbjct  179  VSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIQKELPTE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+  RLK   + E   V+VD L+EKRI+RI +ALDS+DVELV+LLL ES +TLD+A
Sbjct  239  VAEEIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+++EVL LG+AD NL ++RGYT LHI A RK+PS+I+ LL  GA  +
Sbjct  299  NALHYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +G+
Sbjct  359  DLTLDGR  365



>gb|ACC77697.1| NPR1-like protein [Malus domestica]
Length=586

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++V+PIL+VA+HC+L+QL++ CV RV RSD+D+ +LEK LP E
Sbjct  178  VSIFERRLLNFVGKALSDNVVPILLVAFHCQLNQLIDQCVDRVARSDIDDISLEKGLPDE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  238  VVKKIKILRRNYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNITLDEA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  298  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  357

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  358  ELTSDGQ  364



>ref|NP_001280793.1| regulatory protein NPR3-like [Malus domestica]
 gb|AGK30592.1| NPR1-like protein [Malus domestica]
Length=586

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++V+PIL+VA+HC+L+QL++ CV RV RSD+D+ +LEK LP E
Sbjct  178  VSIFERRLLNFVGKALSDNVVPILLVAFHCQLNQLIDQCVDRVARSDIDDISLEKGLPDE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  238  VVKKIKILRRNYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNITLDEA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  298  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  357

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  358  ELTSDGQ  364



>gb|ACJ45012.1| NPR1-1 protein [Glycine max]
Length=495

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KAL+EDVIPIL VA+HC+ +QL+  C+ RV RSDLD  ++++ELP E
Sbjct  179  VSLFQRRLLNFIGKALVEDVIPILTVAFHCQSNQLVNQCIDRVARSDLDQISIDQELPHE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +   +K  R K Q+++E D   VD+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+A
Sbjct  239  LSQKVKLLRRKPQQDVENDASVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL LG+A+ NL N+RGYT LHIAA RK+PSII+ LL  GA  +
Sbjct  299  NALHYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +GQ
Sbjct  359  DLTFDGQ  365



>gb|KEH28396.1| NPR1/NIM1-like regulatory protein, putative [Medicago truncatula]
Length=456

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 144/185 (78%), Gaps = 2/185 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QR L N+V+KAL+EDVIPILM A+HC+  QLL  C+QRV RSD++   LE+ELP EV ++
Sbjct  188  QRCLLNYVDKALVEDVIPILMAAHHCKQDQLLSHCIQRVARSDMEIIYLERELPHEVVTE  247

Query  198  IKANRLKFQRNLEPDTVQVDSL--KEKRIRRILRALDSNDVELVKLLLDESMVTlddaya  371
            IK+ R++      PD+++V+ +   +K IR+IL+ALDS+DVEL+KLLLDES VTLDDAYA
Sbjct  248  IKSLRVQSLPESTPDSMEVEPVIVSDKSIRKILKALDSDDVELLKLLLDESSVTLDDAYA  307

Query  372  lhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADL  551
            LHYA AYC+SK+V EVL LG+AD  L N RGYT LH+AARRKDPSI++ LL NGA  ++ 
Sbjct  308  LHYACAYCDSKVVQEVLTLGLADILLKNPRGYTVLHVAARRKDPSILVALLKNGACASET  367

Query  552  ASNGQ  566
              +GQ
Sbjct  368  TLDGQ  372



>gb|ABK62792.1| NPR-1 [Pyrus pyrifolia]
Length=586

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPIL+VA+HC+L+QL++ C+ RV RSD+D+ +LEK LP E
Sbjct  178  VSIFERRLLNFVGKALSDNVIPILVVAFHCQLNQLIDQCIDRVARSDIDDISLEKGLPDE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  238  VVKKIKILRRNYQQDSDPNLPPADPLLEKRIRRIHKALDSDDVELVKLLLTESNITLDEA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL NARGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  298  NALHYAAAYCDPKVVTEVLALGLADVNLRNARGYTVLHIAVMRKEPSIIVLLLTKGARAS  357

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  358  ELTSDGQ  364



>ref|NP_001289241.1| uncharacterized protein LOC103945128 [Pyrus x bretschneideri]
 gb|ACN87218.1| NPR-1 [Pyrus x bretschneideri]
Length=586

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPIL+VA+HC+L+QL++ C+ RV RSD+D+ +LEK LP E
Sbjct  178  VSIFERRLLNFVGKALSDNVIPILVVAFHCQLNQLIDQCIDRVARSDIDDISLEKGLPDE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  238  VVKKIKILRRNYQQDSDPNLPPADPLLEKRIRRIHKALDSDDVELVKLLLTESNITLDEA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL NARGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  298  NALHYAAAYCDPKVVTEVLALGLADVNLRNARGYTVLHIAVMRKEPSIIVLLLTKGARAS  357

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  358  ELTSDGQ  364



>ref|XP_004486434.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Cicer arietinum]
Length=591

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL+EDVIPILMVA+HC+LSQL+  CV RV RSDL+  ++EKELP E
Sbjct  182  VSLFQRRLLNFVGKALVEDVIPILMVAFHCQLSQLVALCVDRVARSDLNQISIEKELPCE  241

Query  186  VFSDIKANRLKFQR-NLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldd  362
            +   +K  R   Q+ + E     VD+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+
Sbjct  242  LSEKVKLLRRDLQQQDSENYAPVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDE  301

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K+V+EVL LGMA+ NL N+RGYT LH+AA RK+PSII+ LL NGA  
Sbjct  302  AGALHYAAAYCDPKVVSEVLGLGMANVNLRNSRGYTVLHVAAMRKEPSIIVSLLTNGACA  361

Query  543  ADLASNGQ  566
            +DL  +GQ
Sbjct  362  SDLTFDGQ  369



>ref|XP_008787319.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
Length=585

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFVEKAL+EDVIPIL+VA+H  L+QLL  C++RV RS LDN +LEKELP +
Sbjct  179  VSLLQRRLLNFVEKALVEDVIPILLVAFHSHLNQLLGHCMKRVARSYLDNISLEKELPHD  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK  R K Q + EP+++ VD + EKRIR I +ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VAEEIKLIRHKAQPD-EPNSLTVDPVLEKRIRGIHKALDSDDVELVKLLLSESDITLDDA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+SK+V E+L+LG A+ NL N RGYT LH+AA RK+P++I+ LL  GAS +
Sbjct  298  NALHYAAAYCDSKVVAELLELGSANVNLKNDRGYTPLHVAAMRKEPAVIVSLLTKGASAS  357

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  358  ETTADGQ  364



>ref|XP_008342333.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=585

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 142/187 (76%), Gaps = 8/187 (4%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQR L NFVEKAL+EDVIPIL+ A+HC+L QLL  C+QRV RSDLDN  +EKELP E
Sbjct  182  VQLVQRHLSNFVEKALVEDVIPILVAAFHCQLDQLLSHCIQRVARSDLDNVAIEKELPHE  241

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK  RLK Q  +EP       +++KRIR I +ALDS+DVELV LLL ES +TLD+A
Sbjct  242  VSNDIKLIRLKHQ-EMEP-------VEDKRIRSIHKALDSDDVELVGLLLKESDITLDEA  293

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V EVL LG A+PNL N+RG+T LH+AARRK PS+++ LL  GAS +
Sbjct  294  YALHYAVAYCDPKVVKEVLGLGKANPNLRNSRGHTVLHVAARRKLPSVLVPLLKWGASAS  353

Query  546  DLASNGQ  566
            +   +GQ
Sbjct  354  ETTLDGQ  360



>ref|XP_004486433.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Cicer arietinum]
Length=595

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL+EDVIPILMVA+HC+LSQL+  CV RV RSDL+  ++EKELP E
Sbjct  182  VSLFQRRLLNFVGKALVEDVIPILMVAFHCQLSQLVALCVDRVARSDLNQISIEKELPCE  241

Query  186  VFSDIKANRLKFQR-NLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldd  362
            +   +K  R   Q+ + E     VD+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+
Sbjct  242  LSEKVKLLRRDLQQQDSENYAPVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDE  301

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K+V+EVL LGMA+ NL N+RGYT LH+AA RK+PSII+ LL NGA  
Sbjct  302  AGALHYAAAYCDPKVVSEVLGLGMANVNLRNSRGYTVLHVAAMRKEPSIIVSLLTNGACA  361

Query  543  ADLASNGQ  566
            +DL  +GQ
Sbjct  362  SDLTFDGQ  369



>ref|XP_008451832.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like 
[Cucumis melo]
Length=586

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFVEKA +EDVI IL+ A+HC L QL   C+QRV RSDLD  +LE+ELP E
Sbjct  179  VLLVQRRLLNFVEKAAVEDVITILIAAFHCHLDQLHSPCIQRVARSDLDAVSLERELPDE  238

Query  186  VFSDIKANRLKFQRNLEPDTV-QVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTld  359
            V S+IK+ R+K Q++ E D V +VD  +EK+IRR+ +ALDS+DVEL+KLLL ES  +TL+
Sbjct  239  VASEIKSLRMKSQQDTEADIVEEVDLNREKKIRRLHKALDSDDVELLKLLLIESSDITLN  298

Query  360  dayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGAS  539
            DAYALHYA AYC+ K++ EVL+LG+AD NL N RG T LH+AARRKDP II+ LL+ GAS
Sbjct  299  DAYALHYATAYCDPKVIKEVLNLGLADLNLKNLRGQTVLHVAARRKDPKIIVALLDKGAS  358

Query  540  VADLASNGQ  566
              +  ++GQ
Sbjct  359  ALEPTADGQ  367



>ref|XP_007024872.1| NPR1-like protein 4 [Theobroma cacao]
 gb|EOY27494.1| NPR1-like protein 4 [Theobroma cacao]
Length=587

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+ED+I IL+VA+HC+ SQL+  CV RV RSDLD+ ++EKELP E
Sbjct  179  VSLFQRRLLNFVEKALVEDIITILVVAFHCQCSQLVSQCVDRVARSDLDSISIEKELPYE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   I+  R K   + E + V VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VAESIRLLRRKSPPDGEDNEVVVDPLREKRIRRIHKALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL L +AD NL N+RGYT LHIAA RK+PS+I+ LL  GAS +
Sbjct  299  AALHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMSLLAKGASAS  358

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  359  ELTVDGR  365



>gb|KEH37013.1| regulatory protein NPR1 [Medicago truncatula]
Length=509

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL+EDVI ILM ++HC+L+QL   CV RV RSDLD  ++EKELP E
Sbjct  181  VSLFQRRLLNFVGKALVEDVISILMASFHCQLNQLAAQCVDRVARSDLDQISIEKELPHE  240

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +   +K  R    +N E D   VD+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+A
Sbjct  241  LSEKVKLLRRDLHQNDENDAPVVDTLSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  300

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYA A+C+ K+V+EVL LG+A+ NL N+RGYT LHIAA RK+PSII+ LL  GA  +
Sbjct  301  GALHYAVAHCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACAS  360

Query  546  DLASNGQ  566
            DL  +GQ
Sbjct  361  DLTFDGQ  367



>gb|ABA41253.1| NPR1-like protein, partial [Cydonia oblonga]
Length=245

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPI++VA+HC+L+QL+   ++RV RSD+D+ ++EK LP E
Sbjct  21   VSIFERRLINFVGKALPDNVIPIVVVAFHCQLNQLIAQGIERVARSDIDDISIEKGLPDE  80

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K Q++   +   VD L+EKRIRRI +ALDS+DVELV+LLL ES +TLD+A
Sbjct  81   VVKKIKVLRRKPQQDCVSNLPPVDPLREKRIRRIHKALDSDDVELVRLLLTESDITLDEA  140

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  141  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  200

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  201  ELTSDGQ  207



>gb|AFO10948.1| non-expressor of PR1-like protein, partial [Gossypium barbadense]
Length=512

 Score =   190 bits (482),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = +3

Query  12   FVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVF  191
            ++QRRL NFVEKAL+ED+IPIL+VA+HC+ SQL    V RV RSDLD+  +EKELP EV 
Sbjct  106  YLQRRLLNFVEKALLEDIIPILVVAFHCQCSQLGSPFVDRVARSDLDSICIEKELPYEVT  165

Query  192  SDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddaya  371
              I+  R K   + E     VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLDDA A
Sbjct  166  ESIRLLRRKSPSDGEGSEAVVDPLREKRIRRIHKALDSDDVELVKLLLTESDITLDDATA  225

Query  372  lhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADL  551
            LHYAAAYC+ K+V+EVL L +AD NL N+RGYT LHIAA RK+PS+I+ LL  GAS + L
Sbjct  226  LHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMALLAKGASASTL  285

Query  552  ASNGQ  566
              +GQ
Sbjct  286  TLDGQ  290



>ref|NP_001238658.1| NPR1-1 protein [Glycine max]
 gb|ACJ45013.1| NPR1-1 protein [Glycine max]
 gb|KHN22972.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KAL+EDVIPIL VA+HC+ +QL+  C+ RV RSDLD  ++++ELP E
Sbjct  179  VSLFQRRLLNFIGKALVEDVIPILTVAFHCQSNQLVNQCIDRVARSDLDQISIDQELPHE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +   +K  R K Q+++E D   VD+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+A
Sbjct  239  LSQKVKLLRRKPQQDVENDASVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL LG+A+ NL N+RGYT LHIAA RK+PSII+ LL  GA  +
Sbjct  299  NALHYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +GQ
Sbjct  359  DLTFDGQ  365



>ref|XP_004497710.1| PREDICTED: regulatory protein NPR3-like [Cicer arietinum]
Length=595

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL+EDVIPILMVA+HC+LSQL+  CV RV RSDL+  ++EKELP E
Sbjct  182  VSLFQRRLLNFVGKALVEDVIPILMVAFHCQLSQLVALCVDRVARSDLNQISIEKELPCE  241

Query  186  VFSDIKANRLKFQRNLEPDTVQV-DSLKEKRIRRILRALDSNDVELVKLLLDESMVTldd  362
            +   +K  R   Q+    +   V D+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+
Sbjct  242  LSEKVKLFRRDLQQQNSGNYAPVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDE  301

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            A ALHYAAAYC+ K+V+EVL LGMA+ NL N+RGYT LH+AA RK+PSII+ LL NG   
Sbjct  302  AGALHYAAAYCDPKVVSEVLGLGMANVNLRNSRGYTVLHVAAMRKEPSIIVSLLTNGVCA  361

Query  543  ADLASNGQ  566
            +DL  +GQ
Sbjct  362  SDLTFDGQ  369



>gb|KDP22628.1| hypothetical protein JCGZ_02854 [Jatropha curcas]
Length=587

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KA +EDVIPIL+VA+HC+ +QL+  CV R+ RSDLDN ++E+ELP E
Sbjct  182  VSLFQRRLLNFVGKAYVEDVIPILVVAFHCQSNQLVAQCVDRIARSDLDNMSIERELPYE  241

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  DIK  R +     E +T  VD + EKRIRRI +ALDS+DVELVKLLL ES VTLDDA
Sbjct  242  VSEDIKFLRKRPVSEDEENTEAVDPMHEKRIRRIHKALDSDDVELVKLLLTESAVTLDDA  301

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL L +AD NL N++GYT LH+AA R++PS+I+ LL  GA   
Sbjct  302  RALHYAAAYCDPKVVSEVLSLDLADVNLTNSQGYTVLHVAAMRREPSVIVSLLAKGACAL  361

Query  546  DLASNGQ  566
            DL S+G+
Sbjct  362  DLTSDGR  368



>gb|AFW84951.1| regulatory protein NPR1 [Zea mays]
Length=621

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 146/183 (80%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFV+K L+EDVIPIL VA H  L+Q+++ C+QR+ RSDLD+ +L+KELPPE   +
Sbjct  218  QRRLLNFVDKTLVEDVIPILEVASHSGLTQVIDKCIQRIARSDLDDISLDKELPPEAVDE  277

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R K Q   + DT   D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA ALH
Sbjct  278  IKNLRKKSQ-TADGDTFISDPVHEKRVRRIHRALDSDDVELVKLLLNESDITLDDANALH  336

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAA+YC+ K+V+E+LDL MA+ NL N+RGYTALH+AA R++P+II+ LLN GA+V+ L +
Sbjct  337  YAASYCDPKVVSELLDLAMANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGANVSQLTA  396

Query  558  NGQ  566
            +G+
Sbjct  397  DGR  399



>gb|AGC39275.1| NPR1-like3 protein [Theobroma cacao]
Length=587

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFVEKAL+ED+I IL+VA+HC+ SQL+  CV RV RSDLD+ ++EKELP E
Sbjct  179  VSLFQRRLLNFVEKALVEDIITILVVAFHCQCSQLVSQCVDRVARSDLDSISIEKELPYE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   I+  R K   + E +   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLDDA
Sbjct  239  VAESIRLLRRKSPPDGEDNEAVVDPLREKRIRRIHKALDSDDVELVKLLLTESDITLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+EVL L +AD NL N+RGYT LHIAA RK+PS+I+ LL  GAS +
Sbjct  299  AALHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMSLLAKGASAS  358

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  359  ELTVDGR  365



>ref|NP_001147587.1| regulatory protein NPR1 [Zea mays]
 gb|ACG28002.1| regulatory protein NPR1 [Zea mays]
Length=621

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 145/182 (80%), Gaps = 1/182 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFV+K L+EDVIPIL VA H  L+Q+++ C+QR+ RSDLD+ +L+KELPPE   +
Sbjct  218  QRRLLNFVDKTLVEDVIPILEVASHSGLTQVIDKCIQRIARSDLDDISLDKELPPEAVDE  277

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R K Q   + DT   D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA ALH
Sbjct  278  IKNLRKKSQ-TADGDTFISDPVHEKRVRRIHRALDSDDVELVKLLLNESDITLDDANALH  336

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAA+YC+ K+V+E+LDL MA+ NL N+RGYTALH+AA R++P+II+ LLN GA+V+ L +
Sbjct  337  YAASYCDPKVVSELLDLAMANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGANVSQLTA  396

Query  558  NG  563
            +G
Sbjct  397  DG  398



>gb|KJB34938.1| hypothetical protein B456_006G091900 [Gossypium raimondii]
Length=459

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV+KAL+ED+IPIL+VA+HC+ SQL+  CV RVTRSDLD+ ++EKELP E
Sbjct  177  VSLFQRRLLNFVDKALVEDIIPILVVAFHCQCSQLVSQCVDRVTRSDLDSISIEKELPYE  236

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   I+  R K     E     V  L+EK+IRRI +ALDS+DVELVKLLL ES VTLDDA
Sbjct  237  VAESIRLLRCKPPTEAEDGEAVVVPLREKQIRRIQKALDSDDVELVKLLLTESDVTLDDA  296

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+E+L L +AD N  N+RGYT LHIAA RK+PS+I+ LL  GAS +
Sbjct  297  TALHYAAAYCDPKVVSEILALRLADVNRRNSRGYTVLHIAAMRKEPSVIMSLLAKGASAS  356

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  357  ELTLDGR  363



>ref|XP_003594464.1| NPR1-1 protein [Medicago truncatula]
 gb|AES64715.1| regulatory protein NPR1 [Medicago truncatula]
Length=589

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL+EDVI ILM ++HC+L+QL   CV RV RSDLD  ++EKELP E
Sbjct  181  VSLFQRRLLNFVGKALVEDVISILMASFHCQLNQLAAQCVDRVARSDLDQISIEKELPHE  240

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +   +K  R    +N E D   VD+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+A
Sbjct  241  LSEKVKLLRRDLHQNDENDAPVVDTLSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  300

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYA A+C+ K+V+EVL LG+A+ NL N+RGYT LHIAA RK+PSII+ LL  GA  +
Sbjct  301  GALHYAVAHCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACAS  360

Query  546  DLASNGQ  566
            DL  +GQ
Sbjct  361  DLTFDGQ  367



>ref|XP_003569900.1| PREDICTED: regulatory protein NPR3-like [Brachypodium distachyon]
Length=622

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 146/187 (78%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            +   QRRL NFV+K L+EDV+PIL VAY  +L Q+LE CVQR+ RSDLDN +L+KE+ PE
Sbjct  214  ISLFQRRLLNFVDKTLVEDVLPILQVAYDSDLGQVLEKCVQRIVRSDLDNISLDKEVCPE  273

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K   + + DTV +D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA
Sbjct  274  VADKIKKIRQKSPPD-DGDTVILDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDA  332

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+SK+V+E+LDLG+A+ NL N RGYTALH+AA R++P+II+ LLN GA  +
Sbjct  333  NALHYAAAYCDSKVVSELLDLGLANLNLKNNRGYTALHLAAMRREPTIIMCLLNKGAVAS  392

Query  546  DLASNGQ  566
             L  +G+
Sbjct  393  QLTCDGR  399



>ref|XP_002520549.1| Regulatory protein NPR1, putative [Ricinus communis]
 gb|EEF41835.1| Regulatory protein NPR1, putative [Ricinus communis]
Length=590

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV K  +EDVIPIL+VA+HC+ +QL+  CV R+ RSDLDN ++EKELP E
Sbjct  179  VSLFQRRLLNFVGKTYVEDVIPILVVAFHCQSNQLVAQCVDRIARSDLDNISIEKELPYE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+  R+K   + E +   VD L+EKRIRRI +ALDS+DVELVKLLL ES VT+DDA
Sbjct  239  VAENIRLLRIKPISDDEENVEVVDPLREKRIRRIHKALDSDDVELVKLLLTESEVTMDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYA AYC+ K+V+EVL LG+AD N  N++GYT LHIAA R++PS+I+ LL  GA   
Sbjct  299  NALHYATAYCDPKVVSEVLGLGLADVNRRNSQGYTVLHIAAMRREPSVIVSLLTKGACAL  358

Query  546  DLASNGQ  566
            DL S+G+
Sbjct  359  DLTSDGR  365



>gb|AHF20181.1| ankyrin-repeat protein, partial [Musa acuminata AAA Group]
Length=584

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFVEKAL+EDVIPIL VA H +L+QLL  CVQRV RSDLD+  LEK+LP E
Sbjct  188  VSLLQRRLLNFVEKALVEDVIPILQVASHSKLNQLLTHCVQRVARSDLDDIALEKKLPQE  247

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I++ R K Q   +   V VD + EKRI+RI RALDS+DVELVKLLL+ES VTLDD 
Sbjct  248  VTDEIRSLRRKSQP--KGSNVTVDPVHEKRIKRIHRALDSDDVELVKLLLNESGVTLDDT  305

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+SK++ E+LDLG A+ NL N +GYT LH+AA R++P +I+ LL  GAS  
Sbjct  306  YALHYAAAYCDSKVIAELLDLGSANVNLKNDKGYTPLHVAAMRREPKVIVSLLTKGASAL  365

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  366  ETTADGQ  372



>ref|XP_009399066.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=584

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 142/187 (76%), Gaps = 2/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFVEKAL+EDVIPIL VA H +L+QLL  CVQRV RSDLD+  LEK+LP E
Sbjct  188  VSLLQRRLLNFVEKALVEDVIPILQVASHSKLNQLLTHCVQRVARSDLDDIALEKKLPQE  247

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I++ R K Q   +   V VD + EKRI+RI RALDS+DVELVKLLL ES VTLDD 
Sbjct  248  VTDEIRSLRRKSQP--KESNVTVDPVHEKRIKRIHRALDSDDVELVKLLLSESGVTLDDT  305

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+SK++ E+LDLG A+ NL N +GYT LH+AA R++P +I+ LL  GAS  
Sbjct  306  YALHYAAAYCDSKVIAELLDLGSANVNLKNDKGYTPLHVAAMRREPKVIVSLLTKGASAL  365

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  366  ETTADGQ  372



>gb|ABA38903.1| NPR1-like protein, partial [Pyrus communis]
Length=353

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QR+L +FV KAL +DVIPIL+VA+HC+LSQL++ C++RV  SDLD+ +LEK LP E
Sbjct  129  VSVLQRQLTDFVVKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKRLPDE  188

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A
Sbjct  189  VVEKIKILRRNSQHYCDPNMPIVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEA  248

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL ++RG+T LHIA  RK+PSII+ LL+NGA  +
Sbjct  249  NALHYAAAYCDPKVVTEVLGLGLADVNLRDSRGFTVLHIAVMRKEPSIIILLLSNGARAS  308

Query  546  DLASNGQ  566
            +    G+
Sbjct  309  EPTLEGE  315



>ref|XP_003617362.1| NPR1-1 protein [Medicago truncatula]
 gb|AET00321.1| NPR1/NIM1-like regulatory protein, putative [Medicago truncatula]
Length=594

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 144/185 (78%), Gaps = 2/185 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QR L N+V+KAL+EDVIPILM A+HC+  QLL  C+QRV RSD++   LE+ELP EV ++
Sbjct  188  QRCLLNYVDKALVEDVIPILMAAHHCKQDQLLSHCIQRVARSDMEIIYLERELPHEVVTE  247

Query  198  IKANRLKFQRNLEPDTVQVDSL--KEKRIRRILRALDSNDVELVKLLLDESMVTlddaya  371
            IK+ R++      PD+++V+ +   +K IR+IL+ALDS+DVEL+KLLLDES VTLDDAYA
Sbjct  248  IKSLRVQSLPESTPDSMEVEPVIVSDKSIRKILKALDSDDVELLKLLLDESSVTLDDAYA  307

Query  372  lhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADL  551
            LHYA AYC+SK+V EVL LG+AD  L N RGYT LH+AARRKDPSI++ LL NGA  ++ 
Sbjct  308  LHYACAYCDSKVVQEVLTLGLADILLKNPRGYTVLHVAARRKDPSILVALLKNGACASET  367

Query  552  ASNGQ  566
              +GQ
Sbjct  368  TLDGQ  372



>ref|XP_002300863.2| hypothetical protein POPTR_0002s05740g, partial [Populus trichocarpa]
 gb|EEE80136.2| hypothetical protein POPTR_0002s05740g, partial [Populus trichocarpa]
Length=435

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+EKAL+EDVIPILM A+H +L QLL  C++R+ RSDLD+  ++KELP E
Sbjct  179  VLLFQRRLLNFIEKALVEDVIPILMAAFHYQLDQLLSHCIERLVRSDLDSTCIDKELPDE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            + S IK  R K     E    +VD + EK  RRI +ALDS+DVELV+LLL ES +TLDDA
Sbjct  239  ISSKIKLLRKKSLPEAESSVEEVDPILEKSFRRIHKALDSDDVELVELLLSESNLTLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V EVL LG AD NL N+RGY+ LH+AARRK+PSII+ LL  GAS +
Sbjct  299  YALHYAVAYCDPKIVKEVLSLGSADLNLRNSRGYSVLHVAARRKEPSIIMALLTRGASAS  358

Query  546  DLASNGQ  566
            +   +GQ
Sbjct  359  ETTLDGQ  365



>gb|ACU78081.1| NPR1-like protein [Malus hupehensis]
Length=586

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++V+PIL+VA+HC+L+QL++ CV RV RSD+++ +LEK LP E
Sbjct  178  VSIFERRLLNFVGKALSDNVVPILLVAFHCQLNQLIDQCVDRVARSDINDISLEKGLPDE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R  +Q++ +P+    D L EKRIRRI +ALDS+DVELVK LL ES +TLD+A
Sbjct  238  VVKKIKILRRNYQQDSDPNLSPADPLHEKRIRRIHKALDSDDVELVKPLLTESNITLDEA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  298  NALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  357

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  358  ELTSDGQ  364



>ref|XP_007048936.1| NPR1-like protein 3, putative [Theobroma cacao]
 gb|EOX93093.1| NPR1-like protein 3, putative [Theobroma cacao]
Length=583

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQR L N V KAL+EDVIPIL+ A+H +L+ LL  C+QRV  SDLD+  LEKELP E
Sbjct  183  VLLVQRHLLNSVGKALVEDVIPILVAAFHYKLNPLLYDCIQRVATSDLDDACLEKELPGE  242

Query  186  VFSDIKANRLK-FQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldd  362
            V+ +I++ RLK  ++  EP  V++D + EKRIRRI +ALDS+DVEL++LLL ES VTLDD
Sbjct  243  VYHEIRSVRLKSHKQEAEPGAVELDPMLEKRIRRIHKALDSDDVELLRLLLTESNVTLDD  302

Query  363  ayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASV  542
            AYALHYAAAYC+ K+VNEVL LG A+ NL N RGYT L +AARRK+PS+++ LLN GA V
Sbjct  303  AYALHYAAAYCDPKVVNEVLSLGSANVNLRNPRGYTVLQVAARRKEPSVLVALLNKGAYV  362

Query  543  ADLASNGQ  566
            A+   +GQ
Sbjct  363  AETTPDGQ  370



>ref|XP_009357279.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=586

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   +RRL NFV KAL ++VIPIL+VA+HC+L+QL+   ++RV RSD+D+ ++EK LP E
Sbjct  178  VSIFERRLLNFVGKALPDNVIPILVVAFHCQLNQLIAEGIERVARSDIDDISIEKGLPDE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K Q++   +   VD L+EKRIRRI +ALDS+DVELVKLLL ES +TLD+A
Sbjct  238  VVKKIKVLRCKTQQDCVSNLPPVDPLREKRIRRIHKALDSDDVELVKLLLTESNITLDEA  297

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVLDLG+AD NL N+RGYT LHIA  RK+PSII+ LL  GA  +
Sbjct  298  NALHYAAAYCDPKVVTEVLDLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARAS  357

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  358  ELTSDGQ  364



>emb|CDP17620.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KA +EDVIPIL+ AY+C+ +QLL  C+ RV+RSD+++ +LEKE+P E
Sbjct  180  VSLFQRRLLNFIGKAFVEDVIPILVAAYYCQSNQLLSQCIDRVSRSDIESISLEKEIPCE  239

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +  +IK+ RLK     + + V VD L EKRIRRI +ALDS+D+ELV+LLL ES VTLD+A
Sbjct  240  IAENIKSCRLKSDAGEKDNVVLVDHLHEKRIRRIHKALDSDDIELVRLLLTESDVTLDEA  299

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V+E+L L +AD NL NARGY+ LHIAA RK+PSII+ LL  GA V+
Sbjct  300  YALHYAVAYCDPKIVSELLGLSLADVNLQNARGYSVLHIAAMRKEPSIIVSLLTKGACVS  359

Query  546  DLASNGQ  566
            +   +G+
Sbjct  360  ETTLDGR  366



>ref|XP_011096773.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
Length=563

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL N V KA++EDVIPI++VA+HC+LSQLL  C+ RV RSDL+  ++EKELP +
Sbjct  156  VSLFQRRLLNLVGKAVVEDVIPIVVVAFHCQLSQLLTQCIHRVARSDLEAISIEKELPSK  215

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+  RL  Q   E     VD L EKR++RI +ALDS+DVELV+LLL ES +TLD+A
Sbjct  216  VAEEIRLLRLNSQVEQENKVATVDPLHEKRVKRIHKALDSDDVELVRLLLTESDITLDEA  275

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V EVL LG++D NL N RG T LHIAARRK+PSII+ LL  GAS +
Sbjct  276  YALHYAIAYCDPKIVTEVLSLGLSDVNLRNTRGNTVLHIAARRKEPSIIVSLLTKGASAS  335

Query  546  DLASNGQ  566
            +    GQ
Sbjct  336  EPTFEGQ  342



>gb|KHG09335.1| Regulatory NPR3 -like protein [Gossypium arboreum]
Length=583

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV+KAL+ED+IPIL+VA+HC+ SQL+  CV+RVTRSDLD+ ++EKELP E
Sbjct  177  VSLFQRRLLNFVDKALVEDMIPILVVAFHCQCSQLVSQCVERVTRSDLDSISIEKELPYE  236

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   I+  R K     E     V  L+EK+IRRI +ALDS+DVELVKLLL ES VTLDDA
Sbjct  237  VAESIRLLRCKPPTEAEDSEAVVVPLREKQIRRIQKALDSDDVELVKLLLTESDVTLDDA  296

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+E+L L +AD N  N+RGYT LHIAA RK+PS+I+ LL  GAS +
Sbjct  297  TALHYAAAYCDPKVVSEILALRLADVNRRNSRGYTVLHIAAMRKEPSVIMSLLAKGASAS  356

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  357  ELTLDGR  363



>gb|ACJ04030.1| NPR1-like protein [Musa ABB Group]
 gb|ACJ04031.1| NPR1-like protein [Musa ABB Group]
Length=595

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 144/187 (77%), Gaps = 2/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV+KA++EDVIPIL VA H +L+QLL  CVQRV RSDLD+ +LEKELP E
Sbjct  189  VSLLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDLDDVSLEKELPQE  248

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+   L+ +   +  T  VD + EKRI+RI RALDS+DVELVKLLL ES VTLDDA
Sbjct  249  VAEEIRL--LRRESQPKESTATVDPMLEKRIKRIHRALDSDDVELVKLLLSESGVTLDDA  306

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+SK+V E+LDLG A+ NL N RGYT LH+AA R++P++I+ LL  GAS  
Sbjct  307  YALHYAAAYCDSKVVAELLDLGSANVNLKNDRGYTPLHLAAMRREPAVIVSLLTKGASAL  366

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  367  ETTADGQ  373



>ref|XP_009399065.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=599

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 140/184 (76%), Gaps = 2/184 (1%)
 Frame = +3

Query  15   VQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFS  194
             QRRL NFVEKAL+EDVIPIL VA H +L+QLL  CVQRV RSDLD+  LEK+LP EV  
Sbjct  206  AQRRLLNFVEKALVEDVIPILQVASHSKLNQLLTHCVQRVARSDLDDIALEKKLPQEVTD  265

Query  195  DIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayal  374
            +I++ R K Q   +   V VD + EKRI+RI RALDS+DVELVKLLL ES VTLDD YAL
Sbjct  266  EIRSLRRKSQP--KESNVTVDPVHEKRIKRIHRALDSDDVELVKLLLSESGVTLDDTYAL  323

Query  375  hyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLA  554
            HYAAAYC+SK++ E+LDLG A+ NL N +GYT LH+AA R++P +I+ LL  GAS  +  
Sbjct  324  HYAAAYCDSKVIAELLDLGSANVNLKNDKGYTPLHVAAMRREPKVIVSLLTKGASALETT  383

Query  555  SNGQ  566
            ++GQ
Sbjct  384  ADGQ  387



>ref|XP_006376994.1| hypothetical protein POPTR_0012s11900g [Populus trichocarpa]
 gb|ERP54791.1| hypothetical protein POPTR_0012s11900g [Populus trichocarpa]
Length=587

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL EDVIPIL+VA+HC+ SQL+  CV R+  S+LDN ++EKELP E
Sbjct  179  VSLFQRRLLNFVRKALAEDVIPILVVAFHCQSSQLIAQCVDRIAVSNLDNISIEKELPHE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K   + E +T   D L+EKRI+RI  ALDS+DVELVKLLL ES ++LDDA
Sbjct  239  VADKIKQLRRKPISDDENNTEAGDPLREKRIKRIHMALDSDDVELVKLLLTESDISLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHY A+YC+ K+++EVL LG+A+ NL N+RGYT LHIAA RK+PS+I+ LL  GAS  
Sbjct  299  NALHYCASYCDLKVMSEVLSLGLANVNLRNSRGYTVLHIAAMRKEPSVIVSLLAKGASAL  358

Query  546  DLASNGQ  566
            DL S+GQ
Sbjct  359  DLTSDGQ  365



>gb|KJB34937.1| hypothetical protein B456_006G091900 [Gossypium raimondii]
Length=583

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV+KAL+ED+IPIL+VA+HC+ SQL+  CV RVTRSDLD+ ++EKELP E
Sbjct  177  VSLFQRRLLNFVDKALVEDIIPILVVAFHCQCSQLVSQCVDRVTRSDLDSISIEKELPYE  236

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   I+  R K     E     V  L+EK+IRRI +ALDS+DVELVKLLL ES VTLDDA
Sbjct  237  VAESIRLLRCKPPTEAEDGEAVVVPLREKQIRRIQKALDSDDVELVKLLLTESDVTLDDA  296

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V+E+L L +AD N  N+RGYT LHIAA RK+PS+I+ LL  GAS +
Sbjct  297  TALHYAAAYCDPKVVSEILALRLADVNRRNSRGYTVLHIAAMRKEPSVIMSLLAKGASAS  356

Query  546  DLASNGQ  566
            +L  +G+
Sbjct  357  ELTLDGR  363



>ref|XP_007147518.1| hypothetical protein PHAVU_006G131400g [Phaseolus vulgaris]
 gb|ESW19512.1| hypothetical protein PHAVU_006G131400g [Phaseolus vulgaris]
Length=590

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+ KAL+EDVIPIL VA+HC+ SQL+  C+ RV RSDLD  +++KELP E
Sbjct  179  VSLFQRRLLNFIGKALVEDVIPILTVAFHCKSSQLITQCIDRVARSDLDQISVDKELPHE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            +   +K  R   Q+ +E D   +D+L  KRI RI +ALDS+DVELVKLLL+ES +TLD+A
Sbjct  239  LSGKVKLLRHNPQQEVENDASALDALSLKRITRIHKALDSDDVELVKLLLNESEITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYAAAYC+ K+V+EVL LG+A+ NL N+RGY+ LHIAA R++PSII+ LL  GA  +
Sbjct  299  HALHYAAAYCDPKVVSEVLGLGLANVNLRNSRGYSVLHIAAMRREPSIIVSLLTKGACAS  358

Query  546  DLASNGQ  566
            DL  +GQ
Sbjct  359  DLTFDGQ  365



>gb|EMS60174.1| Regulatory protein NPR4 [Triticum urartu]
Length=470

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFV+K L EDV+PIL VA+H EL+Q+ E CVQR+ RSDLD  +L+KELPPE+  +
Sbjct  74   QRRLMNFVDKTLAEDVLPILQVAFHSELTQVREKCVQRIARSDLDILSLDKELPPEIADE  133

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R K    ++ DT+  D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA ALH
Sbjct  134  IKKIRQK-SPPIDGDTIISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDANALH  192

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAAAYC+SK++ E+L L +A+ NL N+RGYTALH+AA R++P+II+ LL+ GA  + L  
Sbjct  193  YAAAYCDSKVLTELLGLELANLNLKNSRGYTALHLAAMRREPAIIMCLLSKGAVASQLTD  252

Query  558  NGQ  566
            +G+
Sbjct  253  DGR  255



>ref|XP_004293734.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011460459.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
Length=587

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KA+ EDVIPIL+V +HC LS+L+   ++RV RSDLD+  ++KELP E
Sbjct  179  VSVFQRRLLNFVGKAMAEDVIPILVVGFHCHLSELVTHSIERVARSDLDSICIDKELPYE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q   E  T  VD L+EKRIR I +ALDS+DVELVKLLL ES +TLD+A
Sbjct  239  VAEKIKLLRRDSQHASELSTPPVDPLREKRIRSIHKALDSDDVELVKLLLSESNITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYAAAYC+ K+V EVL LGMAD NL N RGYT LHIA  R++PSII+ LL+ GA  +
Sbjct  299  HALHYAAAYCDPKVVTEVLGLGMADVNLRNPRGYTVLHIAVMRREPSIIVLLLSKGARAS  358

Query  546  DLASNGQ  566
            +L S+GQ
Sbjct  359  ELTSDGQ  365



>ref|XP_008371834.1| PREDICTED: regulatory protein NPR3 isoform X1 [Malus domestica]
Length=580

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QR+L +FV KAL +DVIPIL+VA+HC+LSQL++ C++RV  SDLD+ +LEK LP E
Sbjct  174  VSILQRQLIDFVLKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKALPDE  233

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A
Sbjct  234  VVEKIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEA  293

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL ++RGYT LHIA  RK+PSII+ LL+NGA  +
Sbjct  294  NALHYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAVXRKEPSIIILLLSNGARAS  353

Query  546  DLASNGQ  566
            +    G+
Sbjct  354  EPTLEGE  360



>ref|XP_009397343.1| PREDICTED: regulatory protein NPR3-like [Musa acuminata subsp. 
malaccensis]
Length=595

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV+KA++EDVIPIL VA H +L+QLL  CVQRV RSDLD+  LEKELP E
Sbjct  189  VSLLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDLDDIALEKELPQE  248

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+   L+ +   +  T  VD + EKRI+RI RALDS+DVELVKLLL ES VTLDDA
Sbjct  249  VAEEIRL--LRRESQPKESTATVDPMLEKRIKRIHRALDSDDVELVKLLLSESGVTLDDA  306

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAY +SK+V E+LDLG A+ NL N RGYTALH+AA R++P++I+ LL  GAS  
Sbjct  307  YALHYAAAYSDSKVVAELLDLGSANVNLKNDRGYTALHLAAMRREPAVIVSLLTKGASAL  366

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  367  ETTADGQ  373



>ref|XP_004303898.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011467613.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011467614.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011467615.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011467616.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
Length=591

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 147/191 (77%), Gaps = 4/191 (2%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFVEKAL+EDVIPIL+ ++HC+ +QLL  C+QRV RSDLDN  LEKELP +
Sbjct  178  VQVVQRRLTNFVEKALVEDVIPILVASFHCKQNQLLSHCIQRVERSDLDNVVLEKELPHK  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKR---IRRILRALDSNDVELVKLLLDES-MVT  353
            VF +IK+ RL++Q+  +   V+++ +++KR   IR I  ALD++DVELV  LLDES   T
Sbjct  238  VFINIKSLRLEYQKMADSIMVEMEPVEDKRLKSIRNIHMALDTDDVELVTRLLDESGSST  297

Query  354  lddayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNG  533
            LDDA ALHYA AYC+ K+V EVL L + + NL NARG+T LH+AARRKDP++++ LLN+G
Sbjct  298  LDDACALHYAVAYCDPKIVKEVLGLRLGNTNLRNARGHTVLHVAARRKDPAVLVPLLNSG  357

Query  534  ASVADLASNGQ  566
            AS  ++ S+GQ
Sbjct  358  ASALEITSDGQ  368



>ref|XP_009357280.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Pyrus x bretschneideri]
Length=580

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QR+L +FV KAL +DVIPIL+VA+HC+LSQL++ C++RV  SDLD+ +LEK LP E
Sbjct  174  VSILQRQLIDFVVKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDE  233

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A
Sbjct  234  VVEKIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEA  293

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL ++RGYT LHIA  RK+PSII+ LL+NGA  +
Sbjct  294  NALHYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLLSNGARAS  353

Query  546  DLASNGQ  566
            +    G+
Sbjct  354  EPTLEGE  360



>ref|XP_011001309.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=587

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV KAL EDVIPIL+VA+HC+ SQL+  CV R+  S+L+N ++EKELP E
Sbjct  179  VSLFQRRLLNFVRKALAEDVIPILVVAFHCQSSQLIAQCVDRIAVSNLENISIEKELPHE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K   + E +T   D L+EKRI+RI  ALDS+DVELVKLLL ES ++LDDA
Sbjct  239  VADKIKQLRRKPISDDENNTEAGDHLREKRIKRIHMALDSDDVELVKLLLTESDISLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHY A+YC+ K+++EVL LG+A+ NL N+RGYT LHIAA RK+PS+I+ LL  GAS  
Sbjct  299  NALHYCASYCDLKVMSEVLSLGLANVNLRNSRGYTVLHIAAMRKEPSLIVSLLAKGASAL  358

Query  546  DLASNGQ  566
            DL S+GQ
Sbjct  359  DLTSDGQ  365



>ref|XP_009341186.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Pyrus x bretschneideri]
Length=580

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QR+L +FV KAL +DVIPIL+VA+HC+LSQL++ C++RV  SDLD+ +LEK LP E
Sbjct  174  VSILQRQLIDFVVKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDE  233

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A
Sbjct  234  VAEKIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEA  293

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K+V EVL LG+AD NL ++RGYT LHIA  RK+PSII+ LL+NGA  +
Sbjct  294  NALHYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLLSNGARAS  353

Query  546  DLASNGQ  566
            +    G+
Sbjct  354  EPTLEGE  360



>ref|XP_010056640.1| PREDICTED: regulatory protein NPR3-like [Eucalyptus grandis]
 gb|KCW73444.1| hypothetical protein EUGRSUZ_E01922 [Eucalyptus grandis]
Length=585

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QR L NFV KA  ED+IPIL VA+HCEL+QL   CV RV RSDLDN  LEKELPP+
Sbjct  179  VSLLQRHLVNFVGKARSEDIIPILTVAFHCELNQLEMQCVDRVARSDLDNIALEKELPPK  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK  RLKFQ   E +    D L+EKRI+RI +ALDS+D+ELV LLL ES + LD+A
Sbjct  239  VAEEIKLLRLKFQPKDETNLEIPDPLREKRIKRIHKALDSDDIELVTLLLSESNINLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            Y LHYAAAYC+ K+V+E+L LG+A+ NL N RGYT LH+AA RK+  II+ LL+ GA  +
Sbjct  299  YGLHYAAAYCDPKVVSELLGLGLANVNLRNPRGYTVLHVAAMRKETKIIVSLLSKGACAS  358

Query  546  DLASNGQ  566
            +L  +GQ
Sbjct  359  ELTPDGQ  365



>gb|EYU43699.1| hypothetical protein MIMGU_mgv1a003483mg [Erythranthe guttata]
Length=582

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 133/187 (71%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL N V KA++EDV+PI+ VA+ C+LSQLL  CV RV RSD +  ++EKELPP 
Sbjct  179  VSLFQRRLLNLVGKAIVEDVVPIIKVAFDCQLSQLLNECVHRVARSDFEAISIEKELPPI  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  DI +  LK Q   E  T  V  L EKR++RI +ALDS DVELV+LLL ES +TLD+A
Sbjct  239  VAQDIASLCLKSQSEQENKTGPVSPLHEKRVKRIHKALDSEDVELVRLLLTESDITLDEA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K V EVL LG+AD NL N RGYT LH+AARRK+PSII+ LL  GA  A
Sbjct  299  YALHYAVAYCDPKTVTEVLSLGLADVNLRNNRGYTVLHVAARRKEPSIIVSLLTKGACAA  358

Query  546  DLASNGQ  566
            D    G+
Sbjct  359  DPTFEGR  365



>gb|ACE86413.1| NPR1-like protein [Musa ABB Group]
Length=574

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 142/187 (76%), Gaps = 2/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV+KA++EDVIPIL VA H +L+QLL  CVQRV RSDLD+  LEKEL  E
Sbjct  168  VSLLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDLDDIALEKELLQE  227

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+   L+ +   +  T  VD + EKRI+RI RALDS+DVELVKLLL+ES VTLDD 
Sbjct  228  VAEEIRL--LRRESQPKESTATVDPMLEKRIKRIHRALDSDDVELVKLLLNESGVTLDDT  285

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+SK++ E+LDLG A+ NL N RGYT LH+AA R++P++I+ LL  GAS  
Sbjct  286  YALHYAAAYCDSKVIAELLDLGSANVNLKNDRGYTPLHLAAMRREPAVIVSLLTKGASAL  345

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  346  ETTADGQ  352



>ref|XP_011026213.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
 ref|XP_011026214.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=591

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NF+EKAL+EDVIPILM A+H +L QLL  C++R+ RSDLD+  ++KELP E
Sbjct  179  VLLFQRRLLNFIEKALVEDVIPILMAAFHYQLGQLLSHCIERLVRSDLDSTCIDKELPDE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            + S IK  R K     E    +VD + E+  RRI +ALDS+DVELV+LLL ES +TLDDA
Sbjct  239  ISSKIKLLRKKSLPEAESSVEEVDPILERSFRRIHQALDSDDVELVELLLRESNLTLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V EVL LG AD NL N+RGY+ LH+AARRK+PSII+ LL  GAS +
Sbjct  299  YALHYAVAYCDPKIVKEVLGLGSADLNLRNSRGYSVLHVAARRKEPSIIMALLTRGASAS  358

Query  546  DLASNGQ  566
            +   +GQ
Sbjct  359  ETTLDGQ  365



>gb|AHF20180.1| ankyrin-repeat protein [Musa acuminata AAA Group]
Length=595

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 142/187 (76%), Gaps = 2/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL NFV+KA++EDVIPIL VA H +L+QLL  CVQRV RSDLD+  LEKELP E
Sbjct  189  VSLLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDLDDIALEKELPQE  248

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +I+   L+ +   +  T  VD + EKRI+RI RALDS+DVELVKLLL ES VTLDDA
Sbjct  249  VAEEIRL--LRRESQPKESTATVDPMLEKRIKRIHRALDSDDVELVKLLLSESGVTLDDA  306

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAY +SK+V E+LDLG A+ NL N RGYT LH+AA R++P++I+ LL  GAS  
Sbjct  307  YALHYAAAYSDSKVVAELLDLGSANVNLKNDRGYTPLHLAAMRREPAVIVSLLTKGASAL  366

Query  546  DLASNGQ  566
            +  ++GQ
Sbjct  367  ETTADGQ  373



>ref|XP_009377037.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=583

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 139/187 (74%), Gaps = 8/187 (4%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  V+  L NFVEKAL+EDVIPIL+ A+HC+L QLL  C+Q V  SDLD   +EKELP +
Sbjct  180  VQLVEHHLSNFVEKALVEDVIPILVAAFHCQLDQLLSHCIQMVASSDLDIMAIEKELPHK  239

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V +DIK NR K Q  +EP       +++KRIR I +ALDS+DVELV LLL ES +TLD+A
Sbjct  240  VSNDIKLNRPKPQ-EMEP-------VEDKRIRSIHKALDSDDVELVGLLLKESGITLDEA  291

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V EVL LG A+PNL N+RG+TALH+AARRK P+++  LL  GAS +
Sbjct  292  YALHYAVAYCDPKVVKEVLGLGKANPNLCNSRGHTALHVAARRKLPAVLFPLLKWGASAS  351

Query  546  DLASNGQ  566
            +  SNGQ
Sbjct  352  ETTSNGQ  358



>ref|XP_004147747.1| PREDICTED: regulatory protein NPR3-like [Cucumis sativus]
Length=585

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFVEKA +EDVI +L+ A+HC L QL   C+QRV RS+LD  +L +ELP E
Sbjct  179  VLLVQRRLLNFVEKAAVEDVITLLIAAFHCHLDQLHTPCIQRVARSNLDAVSLGRELPDE  238

Query  186  VFSDIKANRLKFQRNLEPDTV-QVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTld  359
            + S+IK+ R+K Q+  EPD V + D  +EK+IRR+ +ALDS+DVEL+ LLL ES  +TL+
Sbjct  239  IASEIKSLRMKSQQETEPDIVEEADLNREKKIRRLHKALDSDDVELLGLLLRESSDITLN  298

Query  360  dayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGAS  539
            DAYALHYA AYC+ K++ EVL+LG+AD N  N RG T LH+AARRKDP+II+ LL+ GAS
Sbjct  299  DAYALHYATAYCDPKIIKEVLNLGLADLNHKNLRGQTVLHVAARRKDPNIIVALLDKGAS  358

Query  540  VADLASNGQ  566
              +  ++GQ
Sbjct  359  ALEPTADGQ  367



>emb|CAN67078.1| hypothetical protein VITISV_004499 [Vitis vinifera]
Length=628

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  48   ALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKANRLKFQR  227
            AL+EDVIPIL+VAYHC+ S L+  CV RV RS+LD+ +LEK+LP EV   IK  RLK Q 
Sbjct  234  ALLEDVIPILVVAYHCKSSVLVNQCVBRVXRSBLDSISLEKDLPYEVXESIKLLRLKSQP  293

Query  228  NLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaaayCNSKL  407
            + E +TV VD + EKR+RRIL+ALDS+DVELVKLLL ES +TLD+AYALHYAAAYC+ K+
Sbjct  294  DDECNTVPVDPVHEKRVRRILKALDSDDVELVKLLLSESGITLDEAYALHYAAAYCDPKV  353

Query  408  VNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
            V+EVL LG+AD N  N RGYT LH+AA RK+PSII+ LL  GA  ++  S+GQ
Sbjct  354  VSEVLSLGLADVNRHNPRGYTVLHVAAMRKEPSIIVSLLTKGAHASERTSDGQ  406



>ref|XP_004169978.1| PREDICTED: regulatory protein NPR3-like [Cucumis sativus]
Length=585

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFVEKA +EDVI +L+ A+HC L QL   C+QRV RS+LD  +L +ELP E
Sbjct  179  VLLVQRRLLNFVEKAAVEDVITLLIAAFHCHLDQLHTPCIQRVARSNLDAVSLGRELPDE  238

Query  186  VFSDIKANRLKFQRNLEPDTV-QVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTld  359
            + S+IK+ R+K Q+  EPD V + D  +EK+IRR+ +ALDS+DVEL+ LLL ES  +TL+
Sbjct  239  IASEIKSLRMKSQQETEPDIVEEADLNREKKIRRLHKALDSDDVELLGLLLRESSDITLN  298

Query  360  dayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGAS  539
            DAYALHYA AYC+ K++ EVL+LG+AD N  N RG T LH+AARRKDP+II+ LL+ GAS
Sbjct  299  DAYALHYATAYCDPKVIKEVLNLGLADLNHKNLRGQTVLHVAARRKDPNIIVALLDKGAS  358

Query  540  VADLASNGQ  566
              +  ++GQ
Sbjct  359  ALEPTADGQ  367



>ref|XP_009602190.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=580

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = +3

Query  21   RRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDI  200
            RRL NFV KAL+EDVIPIL VA+HC+LS+LL  CV RV RSDL+   +EKE+P EV   I
Sbjct  186  RRLINFVGKALVEDVIPILRVAFHCQLSELLTHCVDRVARSDLEIICIEKEVPFEVAESI  245

Query  201  KANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhy  380
            K  R K Q + E   + VD L EKR  RI +ALDS+DVELVKLLL+ES ++LD+AYALHY
Sbjct  246  KLLRPKCQVD-ESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLNESEISLDEAYALHY  304

Query  381  aaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASN  560
            A AYC+ K+V EVL LG+AD NL N RGYT LHIAA RK+P+II+ LL  GA V+++  +
Sbjct  305  AVAYCDPKVVTEVLGLGVADVNLRNTRGYTVLHIAAMRKEPAIIVSLLTKGAHVSEITLD  364

Query  561  GQ  566
            GQ
Sbjct  365  GQ  366



>ref|NP_001234562.1| NIM1-like protein 1 [Solanum lycopersicum]
 gb|AAT57638.1| NIM1-like protein 1 [Solanum lycopersicum]
Length=581

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  21   RRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDI  200
            R L++FV KAL+EDVIPIL VA+HC++S+LL  CV RV RSDL++  +EKE+P +V   I
Sbjct  186  RHLFSFVGKALVEDVIPILGVAFHCQMSELLTHCVDRVARSDLESTCIEKEVPFKVAESI  245

Query  201  KANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhy  380
            K +RLK Q + E   + VD L EKR  RI +ALDS+DVELVKLLL+ES ++LD AYALHY
Sbjct  246  KLSRLKCQGD-ESMVLTVDPLHEKRKNRIYKALDSDDVELVKLLLNESDISLDGAYALHY  304

Query  381  aaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASN  560
            A AYC+ K+V EVL LG+A+ NL NARGYT LHIAA RK+PSII+ LL  GA  +++  +
Sbjct  305  AVAYCDPKVVAEVLGLGVANVNLRNARGYTVLHIAAMRKEPSIIVSLLTKGAHASEITLD  364

Query  561  GQ  566
            GQ
Sbjct  365  GQ  366



>dbj|BAJ94508.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86173.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03697.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=611

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFV+K L EDV+PIL VA+H EL+Q+ E CVQR+ RSDLDN +L+KELPPE+  +
Sbjct  215  QRRLMNFVDKTLAEDVLPILQVAFHSELTQVREKCVQRIARSDLDNMSLDKELPPEIADE  274

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R K    ++ +T+  D + EKR+ RI RALDS+DVELV+LLL+ES +TLDDA ALH
Sbjct  275  IKKIRQK-SPPIDGNTIISDPVHEKRVTRIHRALDSDDVELVRLLLNESEITLDDANALH  333

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAAAYC+SK++ E+L L +A+ NL N+RGYTALH+AA R++P+II+ LL+ GA  + L  
Sbjct  334  YAAAYCDSKVLTELLGLELANLNLKNSRGYTALHLAAMRREPAIIMCLLSKGAVASQLTD  393

Query  558  NGQ  566
            +G+
Sbjct  394  DGR  396



>gb|EMT27088.1| hypothetical protein F775_31940 [Aegilops tauschii]
Length=470

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFV+K L EDV+PIL VA+H EL+Q+ E CVQR+ RSDLD  +L+KEL PE+  +
Sbjct  74   QRRLMNFVDKTLAEDVLPILQVAFHSELTQVREKCVQRIARSDLDIMSLDKELLPEIADE  133

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R K    ++ DT+  D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA ALH
Sbjct  134  IKRIRQK-SPPIDGDTIISDPIHEKRVRRIHRALDSDDVELVKLLLNESEITLDDANALH  192

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAAAYC+SK++ E+L L +A+ NL N+RGYTALH+AA R++P+II+ LL+ GA  + L  
Sbjct  193  YAAAYCDSKVLTELLGLELANLNLKNSRGYTALHLAAMRREPAIIMCLLSKGAVASQLTD  252

Query  558  NGQ  566
            +G+
Sbjct  253  DGR  255



>gb|ABN45747.1| nonexpressor of pathogenesis-related genes 3 [Nicotiana glutinosa]
 gb|ADI52630.1| nonexpressor of pathogenesis-like protein 3 [Nicotiana glutinosa]
Length=588

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = +3

Query  21   RRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDI  200
            RRL NFV KAL+EDVIPIL VA+HC+LS+LL  CV RV RSDL+   +EKE+P EV   I
Sbjct  186  RRLINFVGKALVEDVIPILRVAFHCQLSELLTHCVDRVARSDLEIICIEKEVPFEVAESI  245

Query  201  KANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhy  380
            K+ R K Q + E   + VD L EKR  RI +ALDS+DVELVKLLLDES ++LD+AYALHY
Sbjct  246  KSLRPKCQVD-ESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLDESEISLDEAYALHY  304

Query  381  aaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASN  560
            A AYC+ K+V +VL L +AD NL N RGYT LHIAA RK+P+II+ LL  GA V+++  +
Sbjct  305  AVAYCDPKVVTDVLGLDVADVNLRNTRGYTVLHIAAMRKEPTIIVSLLTKGAHVSEITLD  364

Query  561  GQ  566
            GQ
Sbjct  365  GQ  366



>ref|XP_008383328.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=584

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  15   VQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFS  194
            +QR+L +FV KA+ +DVIPIL+VA++C+LSQL++ C++RV  SDLD+ +LEK LP EV +
Sbjct  179  LQRQLADFVVKAVADDVIPILVVAFNCQLSQLIDQCIERVAHSDLDSISLEKRLPDEVVA  238

Query  195  DIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayal  374
             IK  R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A AL
Sbjct  239  KIKILRRNSQHYCDPNMPIVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANAL  298

Query  375  hyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLA  554
            HYAAAYC+ K+V EVL LG+AD NL ++RG+T LHIA  RK+PSII+ LL+NGA  ++  
Sbjct  299  HYAAAYCDPKVVTEVLGLGLADVNLRDSRGFTVLHIAVMRKEPSIIILLLSNGARASEPT  358

Query  555  SNGQ  566
              G+
Sbjct  359  LEGE  362



>ref|XP_008371836.1| PREDICTED: regulatory protein NPR3 isoform X2 [Malus domestica]
Length=578

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  24   RLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIK  203
            +L +FV KAL +DVIPIL+VA+HC+LSQL++ C++RV  SDLD+ +LEK LP EV   IK
Sbjct  178  QLIDFVLKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKALPDEVVEKIK  237

Query  204  ANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhya  383
              R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A ALHYA
Sbjct  238  ILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANALHYA  297

Query  384  aayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNG  563
            AAYC+ K+V EVL LG+AD NL ++RGYT LHIA  RK+PSII+ LL+NGA  ++    G
Sbjct  298  AAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAVXRKEPSIIILLLSNGARASEPTLEG  357

Query  564  Q  566
            +
Sbjct  358  E  358



>ref|XP_009357282.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Pyrus x bretschneideri]
Length=578

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  24   RLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIK  203
            +L +FV KAL +DVIPIL+VA+HC+LSQL++ C++RV  SDLD+ +LEK LP EV   IK
Sbjct  178  QLIDFVVKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDEVVEKIK  237

Query  204  ANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhya  383
              R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A ALHYA
Sbjct  238  ILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANALHYA  297

Query  384  aayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNG  563
            AAYC+ K+V EVL LG+AD NL ++RGYT LHIA  RK+PSII+ LL+NGA  ++    G
Sbjct  298  AAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLLSNGARASEPTLEG  357

Query  564  Q  566
            +
Sbjct  358  E  358



>emb|CDM84353.1| unnamed protein product [Triticum aestivum]
Length=609

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFV+K L EDV+PIL VA+H EL+Q+   CVQR+ RSDLD  +L+KELPPE+  +
Sbjct  213  QRRLMNFVDKTLAEDVLPILQVAFHSELTQVRGKCVQRIARSDLDIMSLDKELPPEIADE  272

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R K    ++ DT+  D + +KR+RRI RALDS+DVELVKLLL+ES +TLDDA ALH
Sbjct  273  IKKIRQK-SPPIDGDTIISDPVHDKRVRRIHRALDSDDVELVKLLLNESEITLDDANALH  331

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAAAYC+SK++ E+L L +A+ NL N+RGYTALH+AA R++P+II+ LL+ GA  + L  
Sbjct  332  YAAAYCDSKVLTELLGLELANLNLKNSRGYTALHLAAMRREPAIIMCLLSKGAVASQLTD  391

Query  558  NGQ  566
            +G+
Sbjct  392  DGR  394



>ref|XP_009341187.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Pyrus x bretschneideri]
Length=578

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  24   RLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIK  203
            +L +FV KAL +DVIPIL+VA+HC+LSQL++ C++RV  SDLD+ +LEK LP EV   IK
Sbjct  178  QLIDFVVKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDEVAEKIK  237

Query  204  ANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhya  383
              R   Q   +P+   VD L+EKRIRRI +ALDS+DVEL+KLLL ES VTLD+A ALHYA
Sbjct  238  ILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANALHYA  297

Query  384  aayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNG  563
            AAYC+ K+V EVL LG+AD NL ++RGYT LHIA  RK+PSII+ LL+NGA  ++    G
Sbjct  298  AAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLLSNGARASEPTLEG  357

Query  564  Q  566
            +
Sbjct  358  E  358



>gb|AHA43769.1| NPR3 [Morus alba var. multicaulis]
Length=594

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 139/183 (76%), Gaps = 8/183 (4%)
 Frame = +3

Query  33   NFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKANR  212
            NFVEKAL+EDVIPIL+VAYHC+LS LL  C+QR  +S+LD+  LEK LP EV  +IK  R
Sbjct  187  NFVEKALVEDVIPILVVAYHCQLSHLLSHCIQRSAKSNLDDVALEKALPYEVSKEIKLFR  246

Query  213  LKFQR-----NLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
             K Q+     N+  +TVQV   ++KR+ RI +ALDS+DVELVKLLL+ES +TLDDAYALH
Sbjct  247  QKSQQEADESNMMEETVQV---QDKRVGRIHKALDSDDVELVKLLLNESDITLDDAYALH  303

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y  AYC+ K+V EVL L +A+ NL N+RG+T LH+AARRK+PS+I+ LL+ GAS  +   
Sbjct  304  YVVAYCDPKVVKEVLGLNLANINLQNSRGHTVLHVAARRKEPSVIVALLDRGASAVETTI  363

Query  558  NGQ  566
            +GQ
Sbjct  364  DGQ  366



>ref|XP_006353069.1| PREDICTED: regulatory protein NPR3-like [Solanum tuberosum]
Length=581

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  21   RRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDI  200
            RRL +FV KA++EDVIPIL VA+HC+LS+LL  CV RV RSDL++  +EKE+P +V   I
Sbjct  186  RRLISFVGKAVLEDVIPILGVAFHCQLSELLTHCVDRVARSDLESTCIEKEVPFKVAESI  245

Query  201  KANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhy  380
            K ++LK Q + E   + VD L EKR  RI +ALDS+DVELVKLLL+ES ++LD AYALHY
Sbjct  246  KLSQLKCQGD-ESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLNESDISLDGAYALHY  304

Query  381  aaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASN  560
            A AYC+ K+V EVL LG+A+ NL N RGYT LHIAA RK+PSII+ LL  GA  +++  +
Sbjct  305  AVAYCDPKVVTEVLGLGVANVNLRNTRGYTVLHIAAMRKEPSIIVSLLTKGAHASEITLD  364

Query  561  GQ  566
            GQ
Sbjct  365  GQ  366



>ref|XP_010093184.1| Regulatory protein [Morus notabilis]
 gb|EXB53672.1| Regulatory protein [Morus notabilis]
Length=598

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 138/183 (75%), Gaps = 8/183 (4%)
 Frame = +3

Query  33   NFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKANR  212
            NFVEKAL EDVIPIL+VAYHC+LS LL  C+QR  +S+LD+  LEK LP EV  +IK  R
Sbjct  191  NFVEKALAEDVIPILVVAYHCQLSHLLSHCIQRSAKSNLDDVALEKALPYEVSKEIKLFR  250

Query  213  LKFQR-----NLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
             K Q+     N+  +TVQV   ++KR+ RI +ALDS+DVELVKLLL+ES +TLDDAYALH
Sbjct  251  QKSQQEDDESNMMGETVQV---QDKRVGRIHKALDSDDVELVKLLLNESDITLDDAYALH  307

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y  AYC+ K+V EVL L +A+ NL N+RG+T LH+AARRK+PS+I+ LL+ GAS  +   
Sbjct  308  YVVAYCDPKVVKEVLGLNLANINLQNSRGHTVLHVAARRKEPSVIVALLDRGASAVETTI  367

Query  558  NGQ  566
            +GQ
Sbjct  368  DGQ  370



>ref|XP_010536418.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010536426.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Tarenaya 
hassleriana]
Length=587

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK+L+E+V+PIL+VA+HC+L+QLL+ CV+RV RSDLD F +EKELP EV   
Sbjct  180  QRRLCNFVEKSLVENVLPILLVAFHCKLTQLLDQCVERVARSDLDRFCIEKELPLEVSEK  239

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  + +  ++ E  T  V    +K I  I +ALDS+DVELVKLLL ES VTLD A ALH
Sbjct  240  IKQLQGRSPQD-EDSTSDVSEKWQKSIGTIHKALDSDDVELVKLLLTESNVTLDQANALH  298

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YA AYC+SK+V  +L L MAD N  N RGYT LH AA RK+PSII+ LL  GA  +DL  
Sbjct  299  YAVAYCDSKVVAGILSLDMADVNFRNYRGYTVLHFAAMRKEPSIIISLLKKGAFASDLTF  358

Query  558  NGQ  566
            +G+
Sbjct  359  DGR  361



>ref|XP_010536434.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Tarenaya 
hassleriana]
Length=530

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK+L+E+V+PIL+VA+HC+L+QLL+ CV+RV RSDLD F +EKELP EV   
Sbjct  123  QRRLCNFVEKSLVENVLPILLVAFHCKLTQLLDQCVERVARSDLDRFCIEKELPLEVSEK  182

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  + +  ++ E  T  V    +K I  I +ALDS+DVELVKLLL ES VTLD A ALH
Sbjct  183  IKQLQGRSPQD-EDSTSDVSEKWQKSIGTIHKALDSDDVELVKLLLTESNVTLDQANALH  241

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YA AYC+SK+V  +L L MAD N  N RGYT LH AA RK+PSII+ LL  GA  +DL  
Sbjct  242  YAVAYCDSKVVAGILSLDMADVNFRNYRGYTVLHFAAMRKEPSIIISLLKKGAFASDLTF  301

Query  558  NGQ  566
            +G+
Sbjct  302  DGR  304



>gb|KCW89778.1| hypothetical protein EUGRSUZ_A02033 [Eucalyptus grandis]
Length=432

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL +F+ KA +EDVIPIL VA++  L +LL  C + V RS +D+  LEKELP E
Sbjct  175  VMLVQRRLLHFIGKAAVEDVIPILKVAFNFRLKELLPSCFETVARSYMDSIVLEKELPHE  234

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            ++++IK  R +F    EP   +V+   EK I++I +ALD++DVELV+ LL+ES+VTLDDA
Sbjct  235  IYAEIKVQRDRFGEAGEPMVTEVNPSLEKSIKQIHKALDNDDVELVRRLLNESVVTLDDA  294

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+  EVL LG+AD NL ++RGYT LH+AARRK PSI+L LL  GA   
Sbjct  295  YALHYATAYCHPKIFKEVLGLGLADLNLKDSRGYTVLHVAARRKAPSILLPLLYKGACAM  354

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  355  ESTSDGQ  361



>gb|KDO39256.1| hypothetical protein CISIN_1g045501mg, partial [Citrus sinensis]
Length=381

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V+ +Q  L + VEKAL+E+VIPIL+ A HC+L+QL   C+QR+ +S+LDN  LEKELP E
Sbjct  126  VFLLQLWLRSMVEKALVENVIPILVAALHCQLNQLRSVCIQRIAKSNLDNVCLEKELPDE  185

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V S+IK+ R+K  +  E +T +VD L+EK +RRI +ALD++D EL+ LLLD S VTLDDA
Sbjct  186  VSSEIKSLRVKSNQESEANTKEVDPLREKTVRRIHKALDTDDFELLTLLLDVSNVTLDDA  245

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYCN K+  EVL++ +A  NL +ARG T LH+AARR +P +++ LL+ GA  +
Sbjct  246  YALHYAAAYCNPKVFKEVLNMDLAGLNLKDARGRTVLHVAARRNEPEVMVTLLSKGACAS  305

Query  546  DLASNGQ  566
            +  S+ Q
Sbjct  306  ETTSDWQ  312



>gb|KFK41854.1| hypothetical protein AALP_AA2G179400 [Arabis alpina]
Length=587

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK+L+E+VIPIL+VA++C+L++LL+ C++RV RSDLD F +EKE+P EV   
Sbjct  178  QRRLCNFVEKSLVENVIPILLVAFNCKLTELLDQCIERVARSDLDKFCIEKEVPFEVAEK  237

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  RLK  ++ E +    D   E RI +ILRALDS+DVELVKLLL ES +TLD+A  LH
Sbjct  238  IKQLRLKSPQDEENNPKVSDKFLE-RIGKILRALDSDDVELVKLLLTESDITLDEANGLH  296

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+ AY + K+V E+L L M D N  N+RGYT LH AA RK+PSII+ L+  GA+V+D   
Sbjct  297  YSVAYSDPKVVTEILALDMGDVNFRNSRGYTVLHFAAMRKEPSIIVSLIGKGANVSDFTC  356

Query  558  NGQ  566
            +G+
Sbjct  357  DGR  359



>ref|XP_006280229.1| hypothetical protein CARUB_v10026146mg [Capsella rubella]
 gb|EOA13127.1| hypothetical protein CARUB_v10026146mg [Capsella rubella]
Length=579

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 136/183 (74%), Gaps = 2/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK L+E+V+PILMVA++C+L+ LL+ C++RV RSDL  F +EKELP EV   
Sbjct  178  QRRLCNFVEKTLVENVLPILMVAFNCKLNDLLDQCIERVARSDLYRFCIEKELPSEVAEK  237

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  RLK  ++     V    L+  RIR+IL+ALDS+DVELVKLLL+ES +TLD+A  LH
Sbjct  238  IKQIRLKSPQDGGESKVSEKLLE--RIRKILKALDSDDVELVKLLLNESDITLDEANGLH  295

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+  Y + K+V E+L+LGM D N  N+RGYT LH AA R++PSII+ L+  GA+ ++L S
Sbjct  296  YSVVYSDPKVVAEILNLGMGDVNFRNSRGYTVLHFAAMRREPSIIISLIEKGANASELTS  355

Query  558  NGQ  566
            +G+
Sbjct  356  DGR  358



>gb|KCW89777.1| hypothetical protein EUGRSUZ_A02033 [Eucalyptus grandis]
Length=482

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL +F+ KA +EDVIPIL VA++  L +LL  C + V RS +D+  LEKELP E
Sbjct  175  VMLVQRRLLHFIGKAAVEDVIPILKVAFNFRLKELLPSCFETVARSYMDSIVLEKELPHE  234

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            ++++IK  R +F    EP   +V+   EK I++I +ALD++DVELV+ LL+ES+VTLDDA
Sbjct  235  IYAEIKVQRDRFGEAGEPMVTEVNPSLEKSIKQIHKALDNDDVELVRRLLNESVVTLDDA  294

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+  EVL LG+AD NL ++RGYT LH+AARRK PSI+L LL  GA   
Sbjct  295  YALHYATAYCHPKIFKEVLGLGLADLNLKDSRGYTVLHVAARRKAPSILLPLLYKGACAM  354

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  355  ESTSDGQ  361



>gb|AGI38070.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38092.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = +3

Query  33   NFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKANR  212
            NFVEKA++EDVIP+LM A+HC+LSQL   C QRV RSDLD  +LEKE P EV  +IK+ R
Sbjct  79   NFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTTSLEKEFPQEVVDEIKSLR  138

Query  213  LKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaaay  392
             +      P  ++V++L EK IRRI +A+DS+DVEL+KLLL ES VTL+DAYALHYA AY
Sbjct  139  AQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLSESKVTLNDAYALHYACAY  198

Query  393  CNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
             +SK++ EVL+LG+AD NL N RGY+ LH+AARRKDPSI++ LL  GA+ +D   +GQ
Sbjct  199  SDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVALLKKGANASDTTPDGQ  256



>gb|KJB33389.1| hypothetical protein B456_006G009000 [Gossypium raimondii]
Length=575

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 145/187 (78%), Gaps = 6/187 (3%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQR L N VEKALIEDVIP+L+ A+H +L+QLL  C +RV +SDLDN  LEKELPPE
Sbjct  181  VLLVQRHLLNIVEKALIEDVIPVLVAAFHYQLNQLLSQCFERVAKSDLDNVCLEKELPPE  240

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V++ I++ RL       P+ V+ D + EK+I+RI +ALDS+D+EL++LLL ES VTLD+A
Sbjct  241  VYAKIRSLRLV------PELVESDLVHEKKIKRIHKALDSDDIELLELLLRESNVTLDEA  294

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+V+EVL LG+A+  L + RG+TALH+AARRK+PS+++ LLN GASV 
Sbjct  295  YALHYAVAYCDPKIVSEVLCLGLANVYLKDHRGFTALHVAARRKEPSVLVALLNKGASVT  354

Query  546  DLASNGQ  566
            +   +G+
Sbjct  355  ETTLDGR  361



>ref|XP_002307566.2| hypothetical protein POPTR_0005s22770g [Populus trichocarpa]
 gb|EEE94562.2| hypothetical protein POPTR_0005s22770g [Populus trichocarpa]
Length=586

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL +F++KAL EDVIPI+M A+HC+L QLL  C++R+ RSDLD+  ++KELP E
Sbjct  179  VLLFQRRLLSFIDKALDEDVIPIVMAAFHCQLDQLLSLCIERLVRSDLDSVCIDKELPHE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            + S +K  R K     E    +VD ++EKR+ RI +AL+S+DVELV+LLL ES  TLDDA
Sbjct  239  ISSKVKLLRKKSLEEAESSVEEVDPMREKRMSRIHKALESDDVELVQLLLSESNFTLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA +YC+ K+V EVL LG+AD NL N+RGYT LH+AARRK+ SI++ LL  GA  +
Sbjct  299  YALHYAVSYCDPKVVKEVLALGLADLNLRNSRGYTVLHVAARRKESSILVALLAKGARAS  358

Query  546  DLASNGQ  566
            ++  +G+
Sbjct  359  EITMDGR  365



>ref|XP_010054033.1| PREDICTED: regulatory protein NPR3-like [Eucalyptus grandis]
 gb|KCW89776.1| hypothetical protein EUGRSUZ_A02033 [Eucalyptus grandis]
Length=574

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL +F+ KA +EDVIPIL VA++  L +LL  C + V RS +D+  LEKELP E
Sbjct  175  VMLVQRRLLHFIGKAAVEDVIPILKVAFNFRLKELLPSCFETVARSYMDSIVLEKELPHE  234

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            ++++IK  R +F    EP   +V+   EK I++I +ALD++DVELV+ LL+ES+VTLDDA
Sbjct  235  IYAEIKVQRDRFGEAGEPMVTEVNPSLEKSIKQIHKALDNDDVELVRRLLNESVVTLDDA  294

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYA AYC+ K+  EVL LG+AD NL ++RGYT LH+AARRK PSI+L LL  GA   
Sbjct  295  YALHYATAYCHPKIFKEVLGLGLADLNLKDSRGYTVLHVAARRKAPSILLPLLYKGACAM  354

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  355  ESTSDGQ  361



>ref|XP_010439666.1| PREDICTED: regulatory protein NPR4-like [Camelina sativa]
 ref|XP_010439667.1| PREDICTED: regulatory protein NPR4-like [Camelina sativa]
Length=583

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 135/187 (72%), Gaps = 11/187 (6%)
 Frame = +3

Query  15   VQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFS  194
            +QRRL N+VEK+L+E+VIPIL VA+HC+L+QLL+ C++RV RSDLD F +EKELP EV  
Sbjct  181  LQRRLCNYVEKSLVENVIPILFVAFHCDLTQLLDQCIERVARSDLDRFCIEKELPSEVSE  240

Query  195  DIKANRLKFQRNLEPDTVQVDSLKEKRIRR---ILRALDSNDVELVKLLLDESMVTldda  365
             IK  RLK        ++ V  + +K + R   +L+ALDS+D+ELVKLLL ES +TLD A
Sbjct  241  KIKQLRLK--------SMNVSEVADKSLERTGKVLKALDSDDLELVKLLLTESDITLDQA  292

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
              LHYA AY + K+V EVLDL MAD N  N+RGYT LH AA R++P+II+ L+  GA+ +
Sbjct  293  NGLHYAVAYSDPKVVTEVLDLNMADVNFRNSRGYTVLHFAAMRREPTIIISLIQKGANAS  352

Query  546  DLASNGQ  566
            D   +G+
Sbjct  353  DFTFDGR  359



>ref|XP_010434372.1| PREDICTED: regulatory protein NPR4 [Camelina sativa]
Length=583

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 137/190 (72%), Gaps = 11/190 (6%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  +QRRL N+VEK+L+E+VIPIL+VA+HC+L+QLL+ C++RV RSDLD F +EKELP E
Sbjct  178  VSSLQRRLCNYVEKSLVENVIPILLVAFHCDLTQLLDQCIERVARSDLDRFCIEKELPSE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEK---RIRRILRALDSNDVELVKLLLDESMVTl  356
            V   IK  R+K        +V V  + +K   R  ++L+ALDS+D+ELVKLLL ES +TL
Sbjct  238  VSDKIKQLRVK--------SVNVPEVADKTLERTGKVLKALDSDDLELVKLLLTESDITL  289

Query  357  ddayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGA  536
            D A  LHYA AY + K+V EVLDL MAD N  N+RGYT LH AA R++P+II+ L+  GA
Sbjct  290  DQANGLHYAVAYSDPKVVTEVLDLNMADVNFRNSRGYTVLHFAAMRREPTIIISLIQKGA  349

Query  537  SVADLASNGQ  566
            + +D   +G+
Sbjct  350  NASDFTFDGR  359



>ref|XP_006437092.1| hypothetical protein CICLE_v10031432mg [Citrus clementina]
 gb|ESR50332.1| hypothetical protein CICLE_v10031432mg [Citrus clementina]
Length=469

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +3

Query  36   FVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKANRL  215
            FV+ A +EDVIP+L+ A+HC+L+QL   C+QR+ RS+LDN  LEKE+P E+ S+IK+ R+
Sbjct  154  FVDYAPVEDVIPVLVAAFHCQLNQLRSYCIQRIARSNLDNVCLEKEIPDELSSEIKSLRV  213

Query  216  KFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaaayC  395
            K  +  E +T +VD L+EK +RRI +ALD++D EL+ LLL E  VTLDDAYALHYAAAYC
Sbjct  214  KSNQESEANTNEVDPLREKTVRRIHKALDTDDFELLNLLLKEYKVTLDDAYALHYAAAYC  273

Query  396  NSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
            N     EVL++G+AD NL +ARG T LH+AARRK+P++++ LL+ GA  ++  S+GQ
Sbjct  274  NPNFFVEVLNMGLADLNLKDARGRTVLHVAARRKEPAVMVTLLSKGAYASETTSDGQ  330



>ref|XP_006437111.1| hypothetical protein CICLE_v10031749mg [Citrus clementina]
 gb|ESR50351.1| hypothetical protein CICLE_v10031749mg [Citrus clementina]
Length=395

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = +3

Query  36   FVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKANRL  215
             VEKAL+EDVIPIL+ A HC+L+QL   C+QR+ +S+LDN  LEKELP EV S+IK+ R+
Sbjct  1    MVEKALVEDVIPILVAALHCQLNQLRSVCIQRIAKSNLDNVCLEKELPDEVSSEIKSLRV  60

Query  216  KFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaaayC  395
            K  +  E +T +VD L+EK +RRI +ALD++D EL+ LLLD S VTLDDAYALHYAAAYC
Sbjct  61   KSNQESEANTKEVDPLREKTVRRIHKALDTDDFELLTLLLDVSNVTLDDAYALHYAAAYC  120

Query  396  NSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
            N K+  EVL++ +A  NL +ARG T LH+AARR +P +++ LL+ GA  ++  S+ Q
Sbjct  121  NPKVFKEVLNMDLAGLNLKDARGRTVLHVAARRNEPEVMVTLLSKGACASETTSDWQ  177



>ref|NP_193701.2| NPR1-like protein 4 [Arabidopsis thaliana]
 sp|Q5ICL9.1|NPR4_ARATH RecName: Full=Regulatory protein NPR4; AltName: Full=BTB/POZ 
domain-containing protein NPR4 [Arabidopsis thaliana]
 gb|AAW31628.1| ankyrin repeat BTB/POZ domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE84211.1| NPR1-like protein 4 [Arabidopsis thaliana]
Length=574

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 137/186 (74%), Gaps = 11/186 (6%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QR+L N+VEK+L+E+V+PIL+VA+HC+L+QLL+ C++RV RSDLD F +EKELP EV   
Sbjct  173  QRKLRNYVEKSLVENVLPILLVAFHCDLTQLLDQCIERVARSDLDRFCIEKELPLEVLEK  232

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRR---ILRALDSNDVELVKLLLDESMVTldday  368
            IK  R+K        +V +  +++K I R   +L+ALDS+DVELVKLLL ES +TLD A 
Sbjct  233  IKQLRVK--------SVNIPEVEDKSIERTGKVLKALDSDDVELVKLLLTESDITLDQAN  284

Query  369  alhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVAD  548
             LHYA AY + K+V +VLDL MAD N  N+RGYT LHIAA R++P+II+ L+  GA+ +D
Sbjct  285  GLHYAVAYSDPKVVTQVLDLDMADVNFRNSRGYTVLHIAAMRREPTIIIPLIQKGANASD  344

Query  549  LASNGQ  566
               +G+
Sbjct  345  FTFDGR  350



>ref|XP_002456404.1| hypothetical protein SORBIDRAFT_03g035720 [Sorghum bicolor]
 gb|EES01524.1| hypothetical protein SORBIDRAFT_03g035720 [Sorghum bicolor]
Length=621

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFV+K L+EDVIPIL VA H  L+Q+++ C+QR+ RSDLD+ +L+KELPPE   +
Sbjct  218  QRRLLNFVDKTLVEDVIPILKVASHSGLTQVIDKCIQRIARSDLDDISLDKELPPEAVEE  277

Query  198  IKANRLKFQR-NLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayal  374
            IK  R K Q  + + D    D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA AL
Sbjct  278  IKNLRKKSQTADGDGDAFISDPVHEKRVRRIHRALDSDDVELVKLLLNESDITLDDANAL  337

Query  375  hyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLA  554
            HYAA+YC++K+V+E+LDL +A+ NL N+RGYTALH+AA R++P+II+ LLN GA+V+ L 
Sbjct  338  HYAASYCDNKVVSELLDLALANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGANVSQLT  397

Query  555  SNGQ  566
            ++G+
Sbjct  398  ADGR  401



>emb|CAA19683.1| putative protein [Arabidopsis thaliana]
 emb|CAB78968.1| putative protein [Arabidopsis thaliana]
Length=601

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 137/186 (74%), Gaps = 11/186 (6%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QR+L N+VEK+L+E+V+PIL+VA+HC+L+QLL+ C++RV RSDLD F +EKELP EV   
Sbjct  173  QRKLRNYVEKSLVENVLPILLVAFHCDLTQLLDQCIERVARSDLDRFCIEKELPLEVLEK  232

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRR---ILRALDSNDVELVKLLLDESMVTldday  368
            IK  R+K        +V +  +++K I R   +L+ALDS+DVELVKLLL ES +TLD A 
Sbjct  233  IKQLRVK--------SVNIPEVEDKSIERTGKVLKALDSDDVELVKLLLTESDITLDQAN  284

Query  369  alhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVAD  548
             LHYA AY + K+V +VLDL MAD N  N+RGYT LHIAA R++P+II+ L+  GA+ +D
Sbjct  285  GLHYAVAYSDPKVVTQVLDLDMADVNFRNSRGYTVLHIAAMRREPTIIIPLIQKGANASD  344

Query  549  LASNGQ  566
               +G+
Sbjct  345  FTFDGR  350



>ref|XP_011032773.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=586

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL +F++KAL EDVIPI M A+HC+L QLL  C++R+ RSDLD+  ++KELP E
Sbjct  179  VLLFQRRLLSFIDKALDEDVIPIAMAAFHCQLDQLLSHCIERLVRSDLDSVCIDKELPHE  238

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            + S +K  R K     E    + D ++EKR+ RI +AL+S+DVELV+LLL ES  TLDDA
Sbjct  239  ISSKVKLLRKKSLEEAESSVEEEDPVREKRMSRIHKALESDDVELVRLLLSESNFTLDDA  298

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYA +YC+ K+V EVL LG+AD NL N+RGYT LH+AARRK+ SI++ LL  GA  +
Sbjct  299  HALHYAVSYCDPKVVKEVLALGLADLNLRNSRGYTVLHVAARRKESSILVALLAKGARAS  358

Query  546  DLASNGQ  566
            +   +G+
Sbjct  359  ETTMDGR  365



>ref|XP_006485155.1| PREDICTED: regulatory protein NPR4-like [Citrus sinensis]
Length=579

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V+ +Q  L + VEKAL+E+VIPIL+ A HC+L+QL   C+QR+ +S+LDN  LEKELP E
Sbjct  175  VFLLQLWLRSMVEKALVENVIPILVAALHCQLNQLRSVCIQRIAKSNLDNVCLEKELPDE  234

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V S+IK+ R+K  +  E +T +VD L+EK +RRI +ALD++D EL+ LLLD S VTLDDA
Sbjct  235  VSSEIKSLRVKSNQESEANTKEVDPLREKTVRRIHKALDTDDFELLTLLLDVSNVTLDDA  294

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYCN K+  EVL++ +A  NL +ARG T LH+AARR +P +++ LL+ GA  +
Sbjct  295  YALHYAAAYCNPKVFKEVLNMDLAGLNLKDARGRTVLHVAARRNEPEVMVTLLSKGACAS  354

Query  546  DLASNGQ  566
            +  S+ Q
Sbjct  355  ETTSDWQ  361



>gb|KDO39140.1| hypothetical protein CISIN_1g0469551mg, partial [Citrus sinensis]
Length=434

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 131/176 (74%), Gaps = 0/176 (0%)
 Frame = +3

Query  39   VEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKANRLK  218
            VEKAL+EDVIPILM A HC+L+QL    +QR+ RS+LDN  LEKELP EV S+IK+ R+K
Sbjct  129  VEKALVEDVIPILMAALHCQLNQLRSYWIQRIARSNLDNVCLEKELPDEVSSEIKSLRVK  188

Query  219  FQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaaayCN  398
            + +  E +  +V+ +  K +R I RALDS DVEL+KLLLD S VTLDDAY LHYAAAYCN
Sbjct  189  YNQESEANIAEVNPINAKVVRGIHRALDSGDVELLKLLLDVSNVTLDDAYTLHYAAAYCN  248

Query  399  SKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
              +  EVL++G A  NL +ARG T LH+AAR K+P++++ LL+ GA  ++  S+GQ
Sbjct  249  PMVFKEVLNMGSAGLNLKDARGRTVLHVAARHKEPAVMVALLSKGAWASETTSDGQ  304



>ref|XP_006398160.1| hypothetical protein EUTSA_v10000824mg [Eutrema salsugineum]
 gb|ESQ39613.1| hypothetical protein EUTSA_v10000824mg [Eutrema salsugineum]
Length=588

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK+L+E+V+PIL+VA++C+L+QLL+ C++RV RSDL  F +EKE+P EV   
Sbjct  178  QRRLCNFVEKSLVENVLPILLVAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPLEVAER  237

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  RLK  R+ E +T++V     +RI +IL+ALDS+D+ELVKLLL ES +TLD A  LH
Sbjct  238  IKQIRLKSPRD-EDNTLKVSDKMVERIGKILKALDSDDIELVKLLLTESDITLDQANGLH  296

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+  Y + K+V E+L L M D N  N+RGYT LH+AA R++PSII+ LL  GA+ +D   
Sbjct  297  YSVVYSDPKVVAEILTLDMGDVNYRNSRGYTVLHLAAMRREPSIIISLLKKGANASDFTC  356

Query  558  NGQ  566
            +G+
Sbjct  357  DGR  359



>ref|XP_010449314.1| PREDICTED: regulatory protein NPR4-like [Camelina sativa]
Length=583

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 137/184 (74%), Gaps = 5/184 (3%)
 Frame = +3

Query  15   VQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFS  194
            +QRRL N+VEK+L+E+VIPIL+VA+HC+L+QLL+ C++RV RSDLD F +EKELP EV  
Sbjct  181  LQRRLCNYVEKSLVENVIPILLVAFHCDLTQLLDQCIERVARSDLDRFCIEKELPSEVSE  240

Query  195  DIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayal  374
             IK  R+K   N+ P+   VD   E R  ++L+ALDS+D+ELVKLLL ES +TLD A  L
Sbjct  241  KIKQLRVK-SMNI-PEV--VDKTLE-RTGKVLKALDSDDLELVKLLLTESDITLDQANGL  295

Query  375  hyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLA  554
            HYA AY + K+V EVLDL MAD N  N+RGYT LH AA R++P+II+ L+  GA+ +D  
Sbjct  296  HYAVAYSDPKVVTEVLDLNMADVNFRNSRGYTVLHFAAMRREPTIIISLIQKGANASDFT  355

Query  555  SNGQ  566
             +G+
Sbjct  356  FDGR  359



>emb|CDY26398.1| BnaA02g23720D [Brassica napus]
Length=562

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 133/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK+L+E+VIPIL+VA+HC L+QLL+ C++RV RSDL  F +EKE+P EV   
Sbjct  176  QRRLCNFVEKSLVENVIPILLVAFHCNLTQLLDQCIERVARSDLYRFCIEKEVPLEVAER  235

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  RLK     E ++ +V     +R+ +IL+ALDS+DVELVKLLL ES +TLD+A  LH
Sbjct  236  IKQIRLKSPLEEEENSPKVSDKMLERVGKILKALDSDDVELVKLLLTESDITLDEANGLH  295

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+  Y + K+V E+L LG+ D N  N+RGY+ LH AA R++PSII+ LL  GA+ +   S
Sbjct  296  YSVVYSDPKVVAEILALGLGDVNHRNSRGYSVLHFAAMRREPSIIISLLKEGANASSFTS  355

Query  558  NGQ  566
            +G+
Sbjct  356  DGR  358



>ref|XP_006437109.1| hypothetical protein CICLE_v10031627mg [Citrus clementina]
 gb|ESR50349.1| hypothetical protein CICLE_v10031627mg [Citrus clementina]
Length=425

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  27   LYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKA  206
            L N VEKAL+EDVIPIL+ A HC+L+ L   C+QR+ +S+LDN  LEKELP EV S+IK+
Sbjct  20   LLNLVEKALVEDVIPILVAALHCQLNHLRSFCIQRIAKSNLDNVCLEKELPDEVSSEIKS  79

Query  207  NRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaa  386
             R+K  +  E +  +VD +  K +RRI +ALDS+DVEL+KLLLD S VTLDDAYALHYAA
Sbjct  80   LRVKSNQESEANIAEVDPMHAKIVRRIHKALDSDDVELLKLLLDVSNVTLDDAYALHYAA  139

Query  387  ayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
            AYC+ K+  EVL++ +A  NL +ARG T LH+AARR +P +++ LL+ GA  ++  S+GQ
Sbjct  140  AYCSPKVFKEVLNMDLACLNLKDARGRTVLHVAARRNEPEVMVTLLSKGACASETTSDGQ  199



>ref|XP_010538609.1| PREDICTED: regulatory protein NPR3-like [Tarenaya hassleriana]
Length=588

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK+L+E+V+PIL+VA++C+L+ LL+ CV+RV RSDLD F +EKELP EV   
Sbjct  181  QRRLCNFVEKSLVENVLPILLVAFNCKLALLLDQCVERVARSDLDRFCIEKELPFEVSEK  240

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  +LK   + E +T +V     K+I  I +ALDS+DVELVKLL  ES ++LD A ALH
Sbjct  241  IKQLQLKSPHDEEDNTPEVSEKLLKKIGAIHKALDSDDVELVKLLSSESDISLDQANALH  300

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YA AYC+ K+V  +L L MAD NL N+RGYT LH AA RK+PSII+ LL  GA+ +DL  
Sbjct  301  YAVAYCDPKVVAGILSLDMADVNLRNSRGYTVLHFAAMRKEPSIIISLLKKGANASDLTL  360

Query  558  NGQ  566
            +G+
Sbjct  361  DGR  363



>ref|XP_009776511.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
Length=588

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = +3

Query  21   RRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDI  200
            RRL NFV KAL+EDVIPIL VA+HC+LS+LL   V RV RSDL+   +EKE+P EV  +I
Sbjct  186  RRLINFVGKALVEDVIPILRVAFHCQLSELLTHSVDRVARSDLEITCIEKEVPFEVAENI  245

Query  201  KANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhy  380
            K    K Q + E   + VD L EKR  RI +ALDS+DVELVKLLL ES ++LD+AYALHY
Sbjct  246  KLLWPKCQVD-ESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLSESNISLDEAYALHY  304

Query  381  aaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASN  560
            A AYC+ K+V EVL LG+AD NL N RGYT LHIA+ RK+P++I+ LL  GA  ++   +
Sbjct  305  AVAYCDPKVVTEVLGLGVADVNLRNTRGYTVLHIASMRKEPAVIVSLLTKGARASETTLD  364

Query  561  GQ  566
            GQ
Sbjct  365  GQ  366



>ref|XP_009776515.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Nicotiana 
sylvestris]
Length=558

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = +3

Query  21   RRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDI  200
            RRL NFV KAL+EDVIPIL VA+HC+LS+LL   V RV RSDL+   +EKE+P EV  +I
Sbjct  156  RRLINFVGKALVEDVIPILRVAFHCQLSELLTHSVDRVARSDLEITCIEKEVPFEVAENI  215

Query  201  KANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhy  380
            K    K Q + E   + VD L EKR  RI +ALDS+DVELVKLLL ES ++LD+AYALHY
Sbjct  216  KLLWPKCQVD-ESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLSESNISLDEAYALHY  274

Query  381  aaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASN  560
            A AYC+ K+V EVL LG+AD NL N RGYT LHIA+ RK+P++I+ LL  GA  ++   +
Sbjct  275  AVAYCDPKVVTEVLGLGVADVNLRNTRGYTVLHIASMRKEPAVIVSLLTKGARASETTLD  334

Query  561  GQ  566
            GQ
Sbjct  335  GQ  336



>gb|AAT57641.1| NIM1-like protein 1 [Nicotiana tabacum]
Length=588

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = +3

Query  21   RRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDI  200
            RRL NFV KAL+EDVIPIL VA+HC+LS+LL   V RV RSDL+   +EKE+P EV  +I
Sbjct  186  RRLINFVGKALVEDVIPILRVAFHCQLSELLTHSVDRVARSDLEITCIEKEVPFEVAENI  245

Query  201  KANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhy  380
            K    K Q + E   + VD L EKR  RI +ALDS+DVELVKLLL ES ++LD+AYALHY
Sbjct  246  KLLWPKCQVD-ESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLSESNISLDEAYALHY  304

Query  381  aaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASN  560
            A AYC+ K+V EVL LG+AD NL N RGYT LHIA+ RK+P++I+ LL  GA  ++   +
Sbjct  305  AVAYCDPKVVTEVLGLGVADVNLRNTRGYTVLHIASMRKEPAVIVSLLTKGARASETTLD  364

Query  561  GQ  566
            GQ
Sbjct  365  GQ  366



>gb|KGN53513.1| hypothetical protein Csa_4G063470 [Cucumis sativus]
Length=358

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 129/169 (76%), Gaps = 2/169 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V  VQRRL NFVEKA +EDVI +L+ A+HC L QL   C+QRV RS+LD  +L +ELP E
Sbjct  179  VLLVQRRLLNFVEKAAVEDVITLLIAAFHCHLDQLHTPCIQRVARSNLDAVSLGRELPDE  238

Query  186  VFSDIKANRLKFQRNLEPDTV-QVDSLKEKRIRRILRALDSNDVELVKLLLDESM-VTld  359
            + S+IK+ R+K Q+  EPD V + D  +EK+IRR+ +ALDS+DVEL+ LLL ES  +TL+
Sbjct  239  IASEIKSLRMKSQQETEPDIVEEADLNREKKIRRLHKALDSDDVELLGLLLRESSDITLN  298

Query  360  dayalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPS  506
            DAYALHYA AYC+ K++ EVL+LG+AD N  N RG T LH+AARRKDPS
Sbjct  299  DAYALHYATAYCDPKVIKEVLNLGLADLNHKNLRGQTVLHVAARRKDPS  347



>ref|XP_008459083.1| PREDICTED: regulatory protein NPR3-like [Cucumis melo]
Length=586

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 137/187 (73%), Gaps = 1/187 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QR L N+V KAL+E+VI IL+VA+HC+LS L+  C+ R+ RSDLD  +LEK LP E
Sbjct  178  VSLFQRHLLNYVVKALVENVIQILVVAFHCQLSPLVTQCIDRIARSDLDCASLEKGLPYE  237

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  RLK +   E + V  DS ++K+I++I  ALDS+DVEL+KLLL ES VTLD+A
Sbjct  238  VAERIKLVRLKSRGGDEQNLV-ADSPRDKKIKKICLALDSDDVELMKLLLSESDVTLDEA  296

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYAAAYC+ K + EVL+L +AD NL N+RGYT LH+AA RKDPS+I+ LLN GA   
Sbjct  297  NALHYAAAYCDPKSLTEVLNLNIADVNLRNSRGYTVLHVAAMRKDPSVIMSLLNKGAWAF  356

Query  546  DLASNGQ  566
            DL  +G+
Sbjct  357  DLTPDGR  363



>ref|XP_006413942.1| hypothetical protein EUTSA_v10024752mg [Eutrema salsugineum]
 gb|ESQ55395.1| hypothetical protein EUTSA_v10024752mg [Eutrema salsugineum]
Length=441

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 135/186 (73%), Gaps = 11/186 (6%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL N++EK+L+E+V+PIL+VA+HC+L+QLL+ C+ RV RSDLD F +EKELP EV   
Sbjct  182  QRRLCNYIEKSLVENVLPILLVAFHCDLTQLLDQCIDRVARSDLDRFCIEKELPFEVSEK  241

Query  198  IKANRLKFQRNLEPDTVQVDSLKEK---RIRRILRALDSNDVELVKLLLDESMVTldday  368
            IK  ++K        +V +  + +K   R  ++L+ALDS+DVELVKLLL ES +TLD A 
Sbjct  242  IKKLQIK--------SVNIPEVVDKPLERTGKVLKALDSDDVELVKLLLTESDITLDQAN  293

Query  369  alhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVAD  548
             LHYA AY + K+V EVL L MAD N  N+RGYT LHIAA R++PSII+ LL  GA+ +D
Sbjct  294  GLHYAVAYSDPKVVAEVLALDMADVNFRNSRGYTVLHIAAMRREPSIIISLLGKGANTSD  353

Query  549  LASNGQ  566
            L  +G+
Sbjct  354  LTFDGR  359



>ref|XP_010441782.1| PREDICTED: regulatory protein NPR3 [Camelina sativa]
Length=579

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK L+E+V+PILMVA++C L+ LL+ C++RV RSDL  F +EKE+P EV   
Sbjct  178  QRRLCNFVEKTLVENVLPILMVAFNCNLTDLLDQCIERVARSDLYRFCIEKEVPFEVAEK  237

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  RLKF ++     V    L   RI +IL+ALDS+DVELVKLLL ES +TLD A  LH
Sbjct  238  IKQIRLKFPQDGGESKVSEKFLG--RIGKILKALDSDDVELVKLLLTESDITLDQANGLH  295

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+  Y + K+V E+L LGM D N  N+RGYT LH AA R++PSII+ L+  GA+ +D  S
Sbjct  296  YSVVYSDPKVVAEILALGMGDVNHRNSRGYTVLHFAAMRREPSIIISLIEKGANASDFTS  355

Query  558  NGQ  566
            +G+
Sbjct  356  DGR  358



>ref|XP_009128768.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like 
[Brassica rapa]
Length=597

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 133/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK+L+E+VIPIL+VA+HC+L+QLL+ C++RV RSDL  F +EK +P EV   
Sbjct  188  QRRLCNFVEKSLVENVIPILLVAFHCKLTQLLDQCIERVARSDLYRFCIEKMVPLEVAER  247

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  RLK     E ++ +V     +R+ +IL+ALDS+DVELVKLLL ES +TLD+A  LH
Sbjct  248  IKQIRLKSPLEEEENSPKVSDKMLERVGKILKALDSDDVELVKLLLTESDITLDEANGLH  307

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+  Y + K+V E+L LG+ D N  N+RGY+ LH AA RK+PSII+ LL  GA+ +   S
Sbjct  308  YSVVYSDPKVVAEILALGLGDVNHRNSRGYSVLHFAAMRKEPSIIISLLKEGANASSFTS  367

Query  558  NGQ  566
            +G+
Sbjct  368  DGR  370



>dbj|BAB09496.1| regulatory protein NPR1-like; transcription factor inhibitor 
I kappa B-like [Arabidopsis thaliana]
Length=593

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK L+E+V+PILMVA++C+L+QLL+ C++RV RSDL  F +EKE+PPEV   
Sbjct  178  QRRLCNFVEKTLVENVLPILMVAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPPEVAEK  237

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  RL   ++ E      + L E RI +IL+ALDS+DVELVKLLL ES +TLD A  LH
Sbjct  238  IKQLRLISPQDEETSPKISEKLLE-RIGKILKALDSDDVELVKLLLTESDITLDQANGLH  296

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+  Y + K+V E+L L M D N  N+RGYT LH AA R++PSII+ L++ GA+ ++  S
Sbjct  297  YSVVYSDPKVVAEILALDMGDVNYRNSRGYTVLHFAAMRREPSIIISLIDKGANASEFTS  356

Query  558  NGQ  566
            +G+
Sbjct  357  DGR  359



>ref|NP_199324.2| NPR1-like protein 3 [Arabidopsis thaliana]
 sp|Q8L746.1|NPR3_ARATH RecName: Full=Regulatory protein NPR3; AltName: Full=BTB/POZ 
domain-containing protein NPR3 [Arabidopsis thaliana]
 gb|AAM98084.1| AT5g45110/K17O22_11 [Arabidopsis thaliana]
 gb|AAO42783.1| AT5g45110/K17O22_11 [Arabidopsis thaliana]
 gb|AED95205.1| NPR1-like protein 3 [Arabidopsis thaliana]
Length=586

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK L+E+V+PILMVA++C+L+QLL+ C++RV RSDL  F +EKE+PPEV   
Sbjct  178  QRRLCNFVEKTLVENVLPILMVAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPPEVAEK  237

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  RL   ++ E      + L E RI +IL+ALDS+DVELVKLLL ES +TLD A  LH
Sbjct  238  IKQLRLISPQDEETSPKISEKLLE-RIGKILKALDSDDVELVKLLLTESDITLDQANGLH  296

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+  Y + K+V E+L L M D N  N+RGYT LH AA R++PSII+ L++ GA+ ++  S
Sbjct  297  YSVVYSDPKVVAEILALDMGDVNYRNSRGYTVLHFAAMRREPSIIISLIDKGANASEFTS  356

Query  558  NGQ  566
            +G+
Sbjct  357  DGR  359



>emb|CDX99350.1| BnaC01g12020D [Brassica napus]
Length=588

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 131/186 (70%), Gaps = 11/186 (6%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL N+VEK+L+E+V+PIL+VA+HC+L+QLL+ CV+RV RSDLD F +EKELP EV   
Sbjct  180  QRRLCNYVEKSLVENVLPILLVAFHCDLTQLLDQCVERVARSDLDRFYIEKELPLEVSEK  239

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRR---ILRALDSNDVELVKLLLDESMVTldday  368
            IK  R+K        +   D + +K I R   +L+ALDS+DVELVKLLL ES  TLD A 
Sbjct  240  IKKLRVK--------STNTDEVADKLIERTGKVLKALDSDDVELVKLLLTESDTTLDQAN  291

Query  369  alhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVAD  548
             LHY  AY + K+V EVL L MAD N  N+RGYT LH AA R++PSII+ LL  GA+ +D
Sbjct  292  GLHYVVAYSDPKVVAEVLALDMADVNYRNSRGYTVLHYAAMRREPSIIISLLKKGANASD  351

Query  549  LASNGQ  566
               +G+
Sbjct  352  FTFDGR  357



>gb|KDO40807.1| hypothetical protein CISIN_1g014994mg [Citrus sinensis]
Length=415

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V+ +Q  L   V KAL+EDV+PIL+ A+HC+L+ L   C+QR+  S+LDNF LE+ELP E
Sbjct  116  VFLLQHWLLGMVGKALVEDVLPILVAAFHCQLNMLRSYCIQRIAGSNLDNFCLERELPDE  175

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V S+IK+ R+K  +  E +  +VD +  K +RRI +AL S+DVEL+KLLLD S VTLDDA
Sbjct  176  VSSEIKSLRVKSNQESEANIAEVDPMHAKIVRRIHKALHSDDVELLKLLLDVSNVTLDDA  235

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAA C+ K+  EVL++  A  NL +ARG T LH+AARR +P +++ LL+ GA  +
Sbjct  236  YALHYAAACCSPKVFKEVLNMDSAGLNLKDARGRTVLHVAARRNEPEVMVTLLSKGARAS  295

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  296  ETTSDGQ  302



>emb|CDX78955.1| BnaA01g10220D [Brassica napus]
Length=588

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 133/183 (73%), Gaps = 5/183 (3%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL N+VEK+L+E+V+PIL+VA+HC+L+QLL+ C++RV RSDLD F +EKELP EV   
Sbjct  181  QRRLCNYVEKSLVENVLPILLVAFHCDLTQLLDQCIERVARSDLDRFYIEKELPLEVSEK  240

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R+K   ++  D V  D L E R  ++L+ALDS+DVELVKLLL ES  TLD A  LH
Sbjct  241  IKKLRVK---SMNTDEV-ADKLIE-RTGKVLKALDSDDVELVKLLLTESDTTLDQANGLH  295

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y  AY + K+V EVL L MAD N  N+RGYT LH AA R++PSII+ LL  GA+ +D   
Sbjct  296  YVVAYSDPKVVAEVLALDMADVNYRNSRGYTVLHYAAMRREPSIIISLLKKGANASDFTF  355

Query  558  NGQ  566
            +G+
Sbjct  356  DGR  358



>gb|AAT57642.1| NIM1-like protein 1 [Helianthus annuus]
Length=591

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   QRRL NFV+KAL+EDVIPIL+VA+HC+L  +L  C+ RV RS LD  ++EKELP E
Sbjct  183  VSLFQRRLLNFVDKALVEDVIPILVVAFHCQLQNVLSRCIDRVVRSKLDTISIEKELPFE  242

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK+     Q + E        L+EKRI+ I +ALD +DVELVK++LDES +TLD+A
Sbjct  243  VTQMIKSIDNIIQEDDEHTVESEVVLREKRIKSIHKALDCDDVELVKMILDESKITLDEA  302

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
             ALHYA  YCN ++  E+L+L  AD NL N+R YT LH+AA RK+PS+I+ +L+ GA  +
Sbjct  303  CALHYAVMYCNQEVAKEILNLNRADVNLRNSRDYTVLHVAAMRKEPSLIVSILSKGACAS  362

Query  546  DLASNGQ  566
            D   +GQ
Sbjct  363  DTTFDGQ  369



>gb|KDO39136.1| hypothetical protein CISIN_1g0389552mg, partial [Citrus sinensis]
Length=250

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = +3

Query  39   VEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKANRLK  218
             E A +EDVIPIL+ A+HC+L++L   C+QR+ RS+LDN  LEKELP EV  +IK+ R+K
Sbjct  7    AEDAPVEDVIPILVAAFHCQLNKLRFFCIQRIARSNLDNVCLEKELPDEVSREIKSLRVK  66

Query  219  FQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaaayCN  398
              +  E +  +VD +  K + RI +ALDS+D+EL+KLLLD S VTLDDAYALHYAAAYC+
Sbjct  67   SNQESEANIAEVDPMHAKIVSRIHKALDSDDIELLKLLLDVSNVTLDDAYALHYAAAYCS  126

Query  399  SKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
             K+  EVL++G+AD NL +ARG T LH+AA+RK+P++++ LL+ GA  ++  S+G+
Sbjct  127  PKVFKEVLNMGLADLNLKDARGRTVLHVAAKRKEPAVLVTLLSKGACTSETTSDGK  182



>ref|XP_006413943.1| hypothetical protein EUTSA_v10024752mg [Eutrema salsugineum]
 dbj|BAJ34281.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55396.1| hypothetical protein EUTSA_v10024752mg [Eutrema salsugineum]
Length=588

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 135/186 (73%), Gaps = 11/186 (6%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL N++EK+L+E+V+PIL+VA+HC+L+QLL+ C+ RV RSDLD F +EKELP EV   
Sbjct  182  QRRLCNYIEKSLVENVLPILLVAFHCDLTQLLDQCIDRVARSDLDRFCIEKELPFEVSEK  241

Query  198  IKANRLKFQRNLEPDTVQVDSLKEK---RIRRILRALDSNDVELVKLLLDESMVTldday  368
            IK  ++K        +V +  + +K   R  ++L+ALDS+DVELVKLLL ES +TLD A 
Sbjct  242  IKKLQIK--------SVNIPEVVDKPLERTGKVLKALDSDDVELVKLLLTESDITLDQAN  293

Query  369  alhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVAD  548
             LHYA AY + K+V EVL L MAD N  N+RGYT LHIAA R++PSII+ LL  GA+ +D
Sbjct  294  GLHYAVAYSDPKVVAEVLALDMADVNFRNSRGYTVLHIAAMRREPSIIISLLGKGANTSD  353

Query  549  LASNGQ  566
            L  +G+
Sbjct  354  LTFDGR  359



>ref|XP_006484991.1| PREDICTED: regulatory protein NPR4-like isoform X1 [Citrus sinensis]
Length=617

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  27   LYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKA  206
            L N VEKAL+EDVIPIL+ A HC+L+ L   C+QR+ +S+LDN  LEKELP EV S+IK+
Sbjct  178  LLNLVEKALVEDVIPILVAALHCQLNHLRSFCIQRIAKSNLDNVCLEKELPDEVSSEIKS  237

Query  207  NRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaa  386
             R+K  +  E +  +VD +  K +RRI +ALDS+DVEL+KLLLD S VTLDDAYALHYAA
Sbjct  238  LRVKSNQESEANIAEVDPMHAKIVRRIHKALDSDDVELLKLLLDVSSVTLDDAYALHYAA  297

Query  387  ayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
            AYC+ K+  EVL++ +A  NL +ARG T LH+AARR +P +++ LL+ GA  ++  S+GQ
Sbjct  298  AYCSPKVFKEVLNMDLACLNLKDARGRTVLHVAARRNEPEVMVTLLSKGACASETTSDGQ  357



>ref|XP_006437106.1| hypothetical protein CICLE_v10030929mg [Citrus clementina]
 gb|ESR50346.1| hypothetical protein CICLE_v10030929mg [Citrus clementina]
Length=646

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  27   LYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKA  206
            L N VEKAL+EDVIPIL+ A HC+L+ L   C+QR+ +S+LDN  LEKELP EV S+IK+
Sbjct  219  LLNLVEKALVEDVIPILVAALHCQLNHLRSFCIQRIAKSNLDNVCLEKELPDEVSSEIKS  278

Query  207  NRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaa  386
             R+K  +  E +  +VD +  K +RRI +ALDS+DVEL+KLLLD S VTLDDAYALHYAA
Sbjct  279  LRVKSNQESEANIAEVDPMHAKIVRRIHKALDSDDVELLKLLLDVSNVTLDDAYALHYAA  338

Query  387  ayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
            AYC+ K+  EVL++ +A  NL +ARG T LH+AARR +P +++ LL+ GA  ++  S+GQ
Sbjct  339  AYCSPKVFKEVLNMDLACLNLKDARGRTVLHVAARRNEPEVMVTLLSKGACASETTSDGQ  398



>ref|XP_002865280.1| hypothetical protein ARALYDRAFT_494469 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41539.1| hypothetical protein ARALYDRAFT_494469 [Arabidopsis lyrata subsp. 
lyrata]
Length=586

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 132/183 (72%), Gaps = 1/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK L+E+V+PILMVA++C+L+QLL+ C++RV RSDL  F +EKE+P EV   
Sbjct  178  QRRLCNFVEKTLVENVLPILMVAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPSEVAEK  237

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  RL   ++ E      + L E RI +IL+ALDS+DVELVKLLL ES +TLD A  LH
Sbjct  238  IKQLRLMSPQDEETSPKISEKLLE-RISKILKALDSDDVELVKLLLTESDITLDQANGLH  296

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+  Y + K+V E+L L M D N  N+RGYT LH AA R++PSII+ L++ GA+ ++  S
Sbjct  297  YSVVYSDPKVVAEILALDMGDVNFRNSRGYTVLHFAAMRREPSIIISLIDEGANASEFTS  356

Query  558  NGQ  566
            +G+
Sbjct  357  DGR  359



>ref|XP_006437103.1| hypothetical protein CICLE_v10031115mg [Citrus clementina]
 gb|ESR50343.1| hypothetical protein CICLE_v10031115mg [Citrus clementina]
Length=560

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 134/187 (72%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   Q  L   VEKAL+EDVIP L+ A HC+L+QL    +QR+ RS+LDN  LEKELP E
Sbjct  174  VSVFQLWLLEVVEKALVEDVIPTLVAALHCQLNQLRSYWIQRIARSNLDNVCLEKELPDE  233

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V S+IK+ R+K  +  E +  +V+ +  K +R I RALDS DVEL+KLLLD S VTLDDA
Sbjct  234  VSSEIKSLRVKSNQESEANIAEVNPINAKVVRGIHRALDSGDVELLKLLLDVSNVTLDDA  293

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYCN     EVL++G+AD NL +ARG T LH+AAR K+P++++ LL+ GA  +
Sbjct  294  YALHYAAAYCNPMGFKEVLNMGLADLNLKDARGRTVLHVAARHKEPAVMVALLSKGACAS  353

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  354  ETTSDGQ  360



>ref|XP_010481651.1| PREDICTED: regulatory protein NPR3-like [Camelina sativa]
Length=579

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK L+E+V+PILMVA++C L+ LL+ C++RV RSDL  F +EKE+P EV   
Sbjct  178  QRRLCNFVEKTLVENVLPILMVAFNCNLTDLLDQCIERVARSDLYRFCIEKEVPFEVAEK  237

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  +++F+   +    +V      RI +IL+ALDS+DVELVKLLL ES +TLD A  LH
Sbjct  238  IK--QIRFKSPQDGGETKVSEKLLGRIGKILKALDSDDVELVKLLLTESDITLDQANGLH  295

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y+  Y + K+V E+L LGM D N  N+RGYT LH AA R++PSII+ L+  GA+ +D  S
Sbjct  296  YSVVYSDPKVVAEILALGMGDVNHRNSRGYTVLHFAAMRREPSIIISLIEKGANASDFTS  355

Query  558  NGQ  566
            +G+
Sbjct  356  DGR  358



>ref|XP_009133120.1| PREDICTED: regulatory protein NPR4 [Brassica rapa]
Length=588

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL N+VEK+L+E+V+ IL+VA+HC+L+QLL+ C++RV RSDLD F +EKELP EV   
Sbjct  181  QRRLCNYVEKSLVENVLAILLVAFHCDLTQLLDQCIERVARSDLDRFYIEKELPLEVSEK  240

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R+K   ++  D V  D L E R  ++L+ALDS+DVELVKLLL ES  TLD A  LH
Sbjct  241  IKKLRVK---SMNTDEV-ADKLIE-RTGKVLKALDSDDVELVKLLLTESDTTLDQANGLH  295

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            Y  AY + K+V EVL L MAD N  N+RGYT LH AA R++PSII+ LL  GA+ +D   
Sbjct  296  YVVAYSDPKVVAEVLALDMADVNYRNSRGYTVLHYAAMRREPSIIISLLKKGANASDFTF  355

Query  558  NGQ  566
            +G+
Sbjct  356  DGR  358



>ref|XP_010494583.1| PREDICTED: regulatory protein NPR3 [Camelina sativa]
Length=579

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 129/186 (69%), Gaps = 8/186 (4%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL NFVEK L+E+V+PILMVA++C L+ LL+ C++RV RSDL  F +EKE+P EV   
Sbjct  178  QRRLCNFVEKTLVENVLPILMVAFNCNLTDLLDQCIERVARSDLYRFCIEKEVPFEVAEK  237

Query  198  IKANRLKFQRNLEPDTVQVDSLKEK---RIRRILRALDSNDVELVKLLLDESMVTldday  368
            IK  RLK      P       + EK   RI +IL+ALDS+DVELVKLLL ES +TLD A 
Sbjct  238  IKQIRLK-----SPQDGGESKVSEKLLGRIGKILKALDSDDVELVKLLLTESDITLDQAN  292

Query  369  alhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVAD  548
             LHY+  Y + K+V E+L LGM D N  N+RGYT LH AA R++PSII+ L+  GA+ ++
Sbjct  293  GLHYSVVYSDPKVVAEILALGMGDVNHRNSRGYTVLHFAAMRREPSIIISLIEKGANASE  352

Query  549  LASNGQ  566
              S+G+
Sbjct  353  FTSDGR  358



>ref|XP_002867926.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44185.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=580

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 133/183 (73%), Gaps = 5/183 (3%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QR+L ++V K+L+E+V+PIL+VA+HC+L+QLL+ C++RV RSDLD F +EKELP EV   
Sbjct  176  QRKLCSYVGKSLVENVLPILLVAFHCDLTQLLDQCIERVARSDLDRFCIEKELPFEVSEK  235

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK  R+K     E    +VD   E R  ++L+ALDS+DVELVKLLL ES +TLD A  LH
Sbjct  236  IKQLRVKSVNIPE----EVDKSLE-RTGKVLKALDSDDVELVKLLLTESDITLDQANGLH  290

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YA AY + K+V +VLDL MAD N  N+RGYT LHIAA R++P+II+ L+  GA  +D   
Sbjct  291  YAVAYSDPKVVTQVLDLNMADVNFRNSRGYTVLHIAAMRREPTIIIPLIQKGAHASDFTF  350

Query  558  NGQ  566
            +G+
Sbjct  351  DGR  353



>gb|KDO40806.1| hypothetical protein CISIN_1g007758mg [Citrus sinensis]
Length=427

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V + Q  L    E A +EDVIPIL+ A HC+L++L  CC+QR+ RS+LDN  LEKELP E
Sbjct  155  VSYFQCLLLILAENAPVEDVIPILVAALHCQLNRLHSCCIQRIARSNLDNVCLEKELPDE  214

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V S+IK+ R+K  +  E +  +VD + EKR+RRI +ALDS+D EL+ LLL+E  VTLDDA
Sbjct  215  VSSEIKSLRVKSNQESEANIKEVDPMHEKRVRRIHKALDSDDFELLNLLLNEYEVTLDDA  274

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYAAAYCN K+  EVL++G+AD NL +ARG T LH+AARRK+P+++  LL+ GA  +
Sbjct  275  FALHYAAAYCNPKVFKEVLNMGLADLNLKDARGRTVLHVAARRKEPAVLETLLSKGACAS  334

Query  546  DLASNGQ  566
            +  S+G+
Sbjct  335  ETTSDGR  341



>ref|XP_006285143.1| hypothetical protein CARUB_v10006486mg [Capsella rubella]
 gb|EOA18041.1| hypothetical protein CARUB_v10006486mg [Capsella rubella]
Length=585

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 133/186 (72%), Gaps = 11/186 (6%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL N+VEK+L+E+VIPIL+VA+HC+L+QLL+ C++RV RSDL  F +EKELP EV   
Sbjct  181  QRRLCNYVEKSLVENVIPILLVAFHCDLTQLLDQCIERVARSDLGRFCIEKELPSEVSEK  240

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRR---ILRALDSNDVELVKLLLDESMVTldday  368
            IK  R+K        +V V  + +K + R   +L+ALDS+D+EL+KLLL ES +TLD A 
Sbjct  241  IKQLRVK--------SVNVPEVVDKSLERAGKVLKALDSDDLELMKLLLSESDITLDQAN  292

Query  369  alhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVAD  548
             LHYA AY +  +V +VLDL MAD N  N+RGYT LHIAA R++P II+ L+  GA+ +D
Sbjct  293  GLHYAVAYSDPNVVIQVLDLNMADVNFRNSRGYTVLHIAAMRREPKIIISLIQKGANPSD  352

Query  549  LASNGQ  566
               +G+
Sbjct  353  FTFDGR  358



>ref|XP_006437094.1| hypothetical protein CICLE_v10031258mg [Citrus clementina]
 gb|ESR50334.1| hypothetical protein CICLE_v10031258mg [Citrus clementina]
Length=514

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            Q  L   V KAL EDVIPIL+ A+HC+L+ L   C+QR+  S+LDN  LEKELP EV S+
Sbjct  172  QYWLMGMVGKALAEDVIPILVAAFHCQLNMLRSYCIQRIAGSNLDNVCLEKELPDEVSSE  231

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            IK+ R+K  +  E +  +VD +  K +RRI +ALDS+DVEL+KLLLD S VTLDDAYALH
Sbjct  232  IKSLRVKSNQESEANIAEVDPMHAKIVRRIHKALDSDDVELLKLLLDVSNVTLDDAYALH  291

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAAAYC+ K+  EVL++  A  NL +ARG   LH+AARR +P +++ LL+ GA  ++  S
Sbjct  292  YAAAYCSPKVFKEVLNMDSAGLNLKDARGRAVLHVAARRNEPEVMVTLLSKGACASETTS  351

Query  558  NGQ  566
            +GQ
Sbjct  352  DGQ  354



>ref|XP_006484994.1| PREDICTED: regulatory protein NPR4-like isoform X3 [Citrus sinensis]
Length=492

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V + Q  L    E A +EDVIPIL+ A HC+L++L  CC+QR+ RS+LDN  LEKELP E
Sbjct  155  VSYFQCLLLILAENAPVEDVIPILVAALHCQLNRLHSCCIQRIARSNLDNVCLEKELPDE  214

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V S+IK+ R+K  +  E +  +VD + EKR+RRI +ALDS+D EL+ LLL+E  VTLDDA
Sbjct  215  VSSEIKSLRVKSNQESEANIKEVDPMHEKRVRRIHKALDSDDFELLNLLLNEYEVTLDDA  274

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYAAAYCN K+  EVL++G+AD NL +ARG T LH+AARRK+P+++  LL+ GA  +
Sbjct  275  FALHYAAAYCNPKVFKEVLNMGLADLNLKDARGRTVLHVAARRKEPAVLETLLSKGACAS  334

Query  546  DLASNGQ  566
            +  S+G+
Sbjct  335  ETTSDGR  341



>ref|XP_006484993.1| PREDICTED: regulatory protein NPR4-like isoform X2 [Citrus sinensis]
Length=508

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V + Q  L    E A +EDVIPIL+ A HC+L++L  CC+QR+ RS+LDN  LEKELP E
Sbjct  155  VSYFQCLLLILAENAPVEDVIPILVAALHCQLNRLHSCCIQRIARSNLDNVCLEKELPDE  214

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V S+IK+ R+K  +  E +  +VD + EKR+RRI +ALDS+D EL+ LLL+E  VTLDDA
Sbjct  215  VSSEIKSLRVKSNQESEANIKEVDPMHEKRVRRIHKALDSDDFELLNLLLNEYEVTLDDA  274

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYAAAYCN K+  EVL++G+AD NL +ARG T LH+AARRK+P+++  LL+ GA  +
Sbjct  275  FALHYAAAYCNPKVFKEVLNMGLADLNLKDARGRTVLHVAARRKEPAVLETLLSKGACAS  334

Query  546  DLASNGQ  566
            +  S+G+
Sbjct  335  ETTSDGR  341



>ref|XP_006484992.1| PREDICTED: regulatory protein NPR4-like isoform X1 [Citrus sinensis]
 gb|KDO40805.1| hypothetical protein CISIN_1g007758mg [Citrus sinensis]
Length=590

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V + Q  L    E A +EDVIPIL+ A HC+L++L  CC+QR+ RS+LDN  LEKELP E
Sbjct  155  VSYFQCLLLILAENAPVEDVIPILVAALHCQLNRLHSCCIQRIARSNLDNVCLEKELPDE  214

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V S+IK+ R+K  +  E +  +VD + EKR+RRI +ALDS+D EL+ LLL+E  VTLDDA
Sbjct  215  VSSEIKSLRVKSNQESEANIKEVDPMHEKRVRRIHKALDSDDFELLNLLLNEYEVTLDDA  274

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            +ALHYAAAYCN K+  EVL++G+AD NL +ARG T LH+AARRK+P+++  LL+ GA  +
Sbjct  275  FALHYAAAYCNPKVFKEVLNMGLADLNLKDARGRTVLHVAARRKEPAVLETLLSKGACAS  334

Query  546  DLASNGQ  566
            +  S+G+
Sbjct  335  ETTSDGR  341



>ref|XP_009101624.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3 [Brassica 
rapa]
Length=583

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 128/182 (70%), Gaps = 7/182 (4%)
 Frame = +3

Query  21   RRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDI  200
            RRL NFVEK+L+E+V+PIL+VA++C+L+QLL+ C++RV RSDL  F +EKE+P EV   I
Sbjct  180  RRLCNFVEKSLVENVLPILLVAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPLEVAEKI  239

Query  201  KANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhy  380
            K  RLK  +  E ++ +V         +IL+ALDS+DVELVKLLL E  +TLD+A   HY
Sbjct  240  KQIRLKSPQEEEENSPKVSD-------KILKALDSDDVELVKLLLTEXDITLDEANGHHY  292

Query  381  aaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASN  560
            +  Y + K+V E+L L M D N  N+RGYT LH+AA RK+PSII+ LL  GA+ +    +
Sbjct  293  SVVYSDPKVVAEILTLDMGDVNHRNSRGYTVLHLAAMRKEPSIIISLLKRGANASGFTCD  352

Query  561  GQ  566
            G+
Sbjct  353  GR  354



>ref|XP_006853358.1| hypothetical protein AMTR_s00032p00112510 [Amborella trichopoda]
 gb|ERN14825.1| hypothetical protein AMTR_s00032p00112510 [Amborella trichopoda]
Length=595

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  18   QRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSD  197
            QRRL ++VEKA +EDVIPIL+VA  C LS L   C+QR+ RSDLD+ +LEK    E+  +
Sbjct  191  QRRLLSYVEKAQVEDVIPILLVASSCHLSPLDTHCIQRMARSDLDDISLEKSFSREIVEE  250

Query  198  IKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalh  377
            I + RLK + + EP + + D L+ K  +RI +ALDS+D+ELVK+LL E   TLDDA ALH
Sbjct  251  ILSLRLKSRIDDEPLSPKKDPLQLKNFKRIHKALDSDDLELVKMLLMEGNTTLDDAEALH  310

Query  378  yaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLAS  557
            YAAAYC+SK+V E+L+LG AD N  N+RGYT LH+AA R++P++++ LL+  A   +L S
Sbjct  311  YAAAYCDSKVVAELLELGGADVNKRNSRGYTVLHVAAMRQEPAVLVALLSKEARACELTS  370

Query  558  NGQ  566
            +G+
Sbjct  371  DGR  373



>ref|XP_006437101.1| hypothetical protein CICLE_v10031310mg [Citrus clementina]
 gb|ESR50341.1| hypothetical protein CICLE_v10031310mg [Citrus clementina]
Length=502

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = +3

Query  45   KALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPEVFSDIKANRLKFQ  224
            +A++EDVIPIL+ A HC L+QL   C+QRV RS+LDN  LEKELP EV S+IK+ R+KF 
Sbjct  171  QAVVEDVIPILVAALHCHLNQLRSLCIQRVVRSNLDNIYLEKELPEEVSSEIKSIRIKFH  230

Query  225  RNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTlddayalhyaaayCNSK  404
            +  E +  +VD +  KR+RRI +ALDS D EL+ LLL+E  VTLDDAYALHYAAAYC+  
Sbjct  231  QESEDNAAEVDPVHAKRVRRIHKALDSYDFELLNLLLNEYEVTLDDAYALHYAAAYCSPN  290

Query  405  LVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVADLASNGQ  566
            +  EVL +G+AD NL +ARG+T LH+AA RK+P+++L LL+ GA  ++  S+GQ
Sbjct  291  VFVEVLSMGLADLNLKDARGHTVLHVAALRKEPAVLLALLSKGACASETTSDGQ  344



>ref|XP_006484986.1| PREDICTED: regulatory protein NPR4-like isoform X3 [Citrus sinensis]
Length=490

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   + RL     KA +EDVIPIL+ A+HC+L+ L   C+QR+  S+LDN  LEKELP E
Sbjct  165  VVLSEFRLLYMAGKAPVEDVIPILVAAFHCQLNMLHSYCIQRIAGSNLDNVCLEKELPDE  224

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R+K  +  E +  +VD +  K +R I +ALDS+DVEL+KLLLD S VTLDDA
Sbjct  225  VSREIKSLRVKSNQESEANIAEVDPMHAKIVRSIQKALDSDDVELLKLLLDVSNVTLDDA  284

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+ K+   VL++ +A  NL +ARG T LH+AARR +P +++ LL+ GA  +
Sbjct  285  YALHYAAAYCSPKVFKAVLNMDLAGLNLKDARGRTVLHVAARRNEPEVMVTLLSKGACAS  344

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  345  ETTSDGQ  351



>gb|EEE55442.1| hypothetical protein OsJ_03589 [Oryza sativa Japonica Group]
Length=357

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            +   QRRL NFV+K L+EDV+PIL VA+H EL+ +LE C++R+ RS+LDN +L+KELPPE
Sbjct  198  ISLFQRRLLNFVDKTLVEDVLPILQVAFHSELTPVLEKCIRRIARSNLDNVSLDKELPPE  257

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V   IK  R K Q N E DTV  D + EKR+RRI RALDS+DVELVKLLL+ES +TLDDA
Sbjct  258  VAVQIKEIRQKSQPN-EGDTVISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDA  316

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNAR  461
             ALHYAAAYC+SK+V+E+LDL +A+ NL N+R
Sbjct  317  NALHYAAAYCDSKVVSELLDLRLANLNLKNSR  348



>ref|XP_006484985.1| PREDICTED: regulatory protein NPR4-like isoform X2 [Citrus sinensis]
Length=518

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = +3

Query  6    VYFVQRRLYNFVEKALIEDVIPILMVAYHCELSQLLECCVQRVTRSDLDNFTLEKELPPE  185
            V   + RL     KA +EDVIPIL+ A+HC+L+ L   C+QR+  S+LDN  LEKELP E
Sbjct  165  VVLSEFRLLYMAGKAPVEDVIPILVAAFHCQLNMLHSYCIQRIAGSNLDNVCLEKELPDE  224

Query  186  VFSDIKANRLKFQRNLEPDTVQVDSLKEKRIRRILRALDSNDVELVKLLLDESMVTldda  365
            V  +IK+ R+K  +  E +  +VD +  K +R I +ALDS+DVEL+KLLLD S VTLDDA
Sbjct  225  VSREIKSLRVKSNQESEANIAEVDPMHAKIVRSIQKALDSDDVELLKLLLDVSNVTLDDA  284

Query  366  yalhyaaayCNSKLVNEVLDLGMADPNLPNARGYTALHIAARRKDPSIILGLLNNGASVA  545
            YALHYAAAYC+ K+   VL++ +A  NL +ARG T LH+AARR +P +++ LL+ GA  +
Sbjct  285  YALHYAAAYCSPKVFKAVLNMDLAGLNLKDARGRTVLHVAARRNEPEVMVTLLSKGACAS  344

Query  546  DLASNGQ  566
            +  S+GQ
Sbjct  345  ETTSDGQ  351



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920