BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J14

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770420.1|  PREDICTED: 26S protease regulatory subunit 8...    322   7e-106   Nicotiana sylvestris
ref|XP_009599866.1|  PREDICTED: 26S protease regulatory subunit 8...    321   2e-105   Nicotiana tomentosiformis
ref|XP_004239281.1|  PREDICTED: 26S protease regulatory subunit 8...    315   3e-103   Solanum lycopersicum
ref|XP_006338168.1|  PREDICTED: 26S protease regulatory subunit 8...    314   1e-102   Solanum tuberosum [potatoes]
ref|XP_004239282.1|  PREDICTED: 26S protease regulatory subunit 8...    313   3e-102   Solanum lycopersicum
gb|AGC54441.1|  26S proteasome ATPase regulatory subunit 6              312   6e-102   Capsicum annuum
emb|CDP03399.1|  unnamed protein product                                311   2e-101   Coffea canephora [robusta coffee]
ref|XP_009337249.1|  PREDICTED: 26S protease regulatory subunit 8...    309   1e-100   Pyrus x bretschneideri [bai li]
ref|XP_009590572.1|  PREDICTED: 26S protease regulatory subunit 8...    308   4e-100   Nicotiana tomentosiformis
ref|XP_008344058.1|  PREDICTED: 26S protease regulatory subunit 8...    306   1e-99    Malus domestica [apple tree]
ref|XP_007202157.1|  hypothetical protein PRUPE_ppa006323mg             306   2e-99    Prunus persica
ref|XP_009376844.1|  PREDICTED: 26S protease regulatory subunit 8...    305   6e-99    Pyrus x bretschneideri [bai li]
ref|XP_008375711.1|  PREDICTED: 26S protease regulatory subunit 8...    303   2e-98    Malus domestica [apple tree]
ref|XP_002529369.1|  26S protease regulatory subunit, putative          301   6e-98    
gb|KDO80362.1|  hypothetical protein CISIN_1g014743mg                   299   2e-97    Citrus sinensis [apfelsine]
ref|XP_006451010.1|  hypothetical protein CICLE_v10008422mg             300   3e-97    Citrus clementina [clementine]
ref|XP_004490469.1|  PREDICTED: 26S protease regulatory subunit 8...    300   4e-97    Cicer arietinum [garbanzo]
ref|XP_010254305.1|  PREDICTED: 26S protease regulatory subunit 8...    299   8e-97    Nelumbo nucifera [Indian lotus]
ref|XP_004504777.1|  PREDICTED: 26S protease regulatory subunit 8...    299   8e-97    Cicer arietinum [garbanzo]
ref|XP_010249967.1|  PREDICTED: 26S protease regulatory subunit 8...    298   2e-96    Nelumbo nucifera [Indian lotus]
gb|AFK34159.1|  unknown                                                 298   3e-96    Medicago truncatula
gb|KEH31238.1|  26S proteasome regulatory particle triple-A ATPas...    298   3e-96    Medicago truncatula
gb|KJB83167.1|  hypothetical protein B456_013G232600                    296   3e-96    Gossypium raimondii
ref|XP_010098977.1|  26S protease regulatory subunit 8-A-like pro...    296   5e-96    
gb|KJB83166.1|  hypothetical protein B456_013G232600                    296   8e-96    Gossypium raimondii
ref|XP_002285273.1|  PREDICTED: 26S protease regulatory subunit 8...    296   1e-95    Vitis vinifera
ref|XP_007013331.1|  Regulatory particle triple-A ATPase 6A             296   1e-95    Theobroma cacao [chocolate]
gb|KDP32350.1|  hypothetical protein JCGZ_13275                         296   2e-95    Jatropha curcas
ref|XP_008464995.1|  PREDICTED: 26S protease regulatory subunit 8...    296   2e-95    Cucumis melo [Oriental melon]
emb|CDY35832.1|  BnaC09g37640D                                          295   4e-95    Brassica napus [oilseed rape]
ref|XP_010454291.1|  PREDICTED: 26S protease regulatory subunit 8...    294   7e-95    Camelina sativa [gold-of-pleasure]
ref|NP_568389.1|  regulatory particle triple-A ATPase 6A                294   8e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126408.1|  PREDICTED: 26S protease regulatory subunit 8...    293   1e-94    Brassica rapa
ref|XP_007135859.1|  hypothetical protein PHAVU_010G164000g             289   3e-94    Phaseolus vulgaris [French bean]
ref|XP_006287833.1|  hypothetical protein CARUB_v10001052mg             292   5e-94    
ref|XP_010420826.1|  PREDICTED: 26S protease regulatory subunit 8...    292   5e-94    Camelina sativa [gold-of-pleasure]
ref|XP_009120838.1|  PREDICTED: 26S protease regulatory subunit 8...    292   6e-94    Brassica rapa
gb|KJB64819.1|  hypothetical protein B456_010G066600                    291   1e-93    Gossypium raimondii
ref|XP_004149888.1|  PREDICTED: 26S protease regulatory subunit 8...    291   2e-93    Cucumis sativus [cucumbers]
ref|XP_010454292.1|  PREDICTED: 26S protease regulatory subunit 8...    291   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_007135858.1|  hypothetical protein PHAVU_010G164000g             290   2e-93    Phaseolus vulgaris [French bean]
ref|XP_002871914.1|  ATSUG1                                             291   2e-93    Arabidopsis lyrata subsp. lyrata
gb|KJB54106.1|  hypothetical protein B456_009G020800                    290   4e-93    Gossypium raimondii
gb|KHG30505.1|  26S protease regulatory subunit 8 A -like protein       289   6e-93    Gossypium arboreum [tree cotton]
ref|XP_006400565.1|  hypothetical protein EUTSA_v10013657mg             289   7e-93    Eutrema salsugineum [saltwater cress]
ref|XP_010493091.1|  PREDICTED: 26S protease regulatory subunit 8...    288   1e-92    Camelina sativa [gold-of-pleasure]
ref|NP_001242190.1|  uncharacterized protein LOC100776268               288   1e-92    
ref|XP_006584548.1|  PREDICTED: uncharacterized protein LOC100776...    288   2e-92    
ref|XP_006293475.1|  hypothetical protein CARUB_v10023291mg             288   3e-92    Capsella rubella
gb|KHG13670.1|  26S protease regulatory subunit 8 A -like protein       287   4e-92    Gossypium arboreum [tree cotton]
emb|CDY42324.1|  BnaC02g09300D                                          295   4e-92    Brassica napus [oilseed rape]
gb|KFK26248.1|  hypothetical protein AALP_AA8G222400                    287   6e-92    Arabis alpina [alpine rockcress]
ref|XP_010914939.1|  PREDICTED: 26S protease regulatory subunit 8...    286   9e-92    
ref|XP_010520598.1|  PREDICTED: 26S protease regulatory subunit 8...    286   1e-91    Tarenaya hassleriana [spider flower]
ref|XP_008785391.1|  PREDICTED: 26S protease regulatory subunit 8...    286   1e-91    Phoenix dactylifera
gb|ACN40682.1|  unknown                                                 286   2e-91    Picea sitchensis
ref|XP_002315825.2|  26S proteasome subunit 8 family protein            286   2e-91    Populus trichocarpa [western balsam poplar]
dbj|BAA87070.2|  TAT-binding protein homolog                            285   2e-91    Matricaria chamomilla
emb|CAB63651.1|  26S proteasome subunit 8                               285   3e-91    Fagus sylvatica
ref|XP_002871915.1|  ATSUG1                                             285   4e-91    
dbj|BAJ85508.1|  predicted protein                                      284   7e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002284747.1|  PREDICTED: 26S protease regulatory subunit 8...    284   7e-91    Vitis vinifera
emb|CDY44958.1|  BnaA02g04630D                                          292   7e-91    Brassica napus [oilseed rape]
ref|XP_011021674.1|  PREDICTED: 26S protease regulatory subunit 8...    284   1e-90    Populus euphratica
ref|XP_006840553.1|  hypothetical protein AMTR_s00045p00217520          283   1e-90    Amborella trichopoda
gb|KHN39373.1|  26S protease regulatory subunit 8 like A                283   1e-90    Glycine soja [wild soybean]
emb|CDX70903.1|  BnaC03g09870D                                          283   1e-90    
ref|XP_006843919.1|  hypothetical protein AMTR_s00007p00269350          282   2e-90    Amborella trichopoda
ref|XP_008792112.1|  PREDICTED: 26S protease regulatory subunit 8...    283   2e-90    Phoenix dactylifera
gb|KHN38098.1|  26S protease regulatory subunit 8 like A                288   2e-90    Glycine soja [wild soybean]
ref|XP_002311569.2|  26S proteasome subunit 8 family protein            283   3e-90    
ref|XP_011025256.1|  PREDICTED: 26S protease regulatory subunit 8...    283   3e-90    Populus euphratica
ref|XP_006379809.1|  hypothetical protein POPTR_0008s14310g             283   3e-90    Populus trichocarpa [western balsam poplar]
ref|XP_009131763.1|  PREDICTED: 26S protease regulatory subunit 8...    282   3e-90    Brassica rapa
ref|XP_010420827.1|  PREDICTED: 26S protease regulatory subunit 8...    283   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006400566.1|  hypothetical protein EUTSA_v10013659mg             282   5e-90    Eutrema salsugineum [saltwater cress]
gb|AIZ74339.1|  26S proteasome regulatory subunit                       282   5e-90    Pinus massoniana [Chinese red pine]
gb|AAG42150.1|  26S proteasome RPT6a subunit                            283   5e-90    Dactylis glomerata [cocksfoot]
gb|AAF27916.1|AF220199_1  26S proteasome regulatory subunit 8           282   6e-90    Pinus taeda
ref|XP_003571095.2|  PREDICTED: 26S protease regulatory subunit 8...    281   6e-90    Brachypodium distachyon [annual false brome]
ref|NP_001241552.1|  uncharacterized protein LOC100812783               281   7e-90    Glycine max [soybeans]
ref|XP_010541726.1|  PREDICTED: 26S protease regulatory subunit 8...    283   9e-90    Tarenaya hassleriana [spider flower]
ref|XP_004287374.1|  PREDICTED: 26S protease regulatory subunit 8...    281   1e-89    Fragaria vesca subsp. vesca
ref|XP_010049955.1|  PREDICTED: 26S protease regulatory subunit 8...    280   2e-89    Eucalyptus grandis [rose gum]
ref|XP_009408962.1|  PREDICTED: 26S protease regulatory subunit 8...    280   3e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381131.1|  PREDICTED: 26S protease regulatory subunit 8...    279   6e-89    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACH63226.1|  putative 26S proteasome AAA-ATPase subunit RPT6a        278   6e-89    Rheum australe [Himalayan rhubarb]
gb|AAF22526.1|AF123395_1  26S proteasome AAA-ATPase subunit RPT6a       278   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002453516.1|  hypothetical protein SORBIDRAFT_04g007170          279   9e-89    Sorghum bicolor [broomcorn]
gb|ACF88052.1|  unknown                                                 270   3e-88    Zea mays [maize]
ref|XP_003563677.1|  PREDICTED: 26S protease regulatory subunit 8...    277   3e-88    Brachypodium distachyon [annual false brome]
dbj|BAJ99861.1|  predicted protein                                      276   8e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010925261.1|  PREDICTED: 26S protease regulatory subunit 8...    276   1e-87    Elaeis guineensis
ref|XP_010688096.1|  PREDICTED: 26S protease regulatory subunit 8...    275   1e-87    Beta vulgaris subsp. vulgaris [field beet]
emb|CDX88865.1|  BnaA03g07840D                                          280   3e-87    
ref|XP_010535884.1|  PREDICTED: 26S protease regulatory subunit 8...    274   6e-87    Tarenaya hassleriana [spider flower]
ref|NP_197500.1|  AAA-type ATPase family protein                        274   7e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140953.1|  hypothetical protein                               273   2e-86    Zea mays [maize]
gb|ACL53562.1|  unknown                                                 273   2e-86    Zea mays [maize]
ref|XP_006647057.1|  PREDICTED: 26S protease regulatory subunit 8...    273   2e-86    Oryza brachyantha
ref|NP_001142276.1|  uncharacterized protein LOC100274445               273   2e-86    Zea mays [maize]
ref|NP_001046248.1|  Os02g0205300                                       272   3e-86    
gb|AFW66094.1|  hypothetical protein ZEAMMB73_419750                    274   3e-86    
ref|XP_004951510.1|  PREDICTED: 26S protease regulatory subunit 8...    272   4e-86    Setaria italica
ref|XP_001778777.1|  26S proteasome regulatory complex, ATPase RPT6     266   3e-84    
ref|XP_008457948.1|  PREDICTED: 26S protease regulatory subunit 8...    267   3e-84    Cucumis melo [Oriental melon]
emb|CDO98106.1|  unnamed protein product                                266   5e-84    Coffea canephora [robusta coffee]
ref|XP_004139327.1|  PREDICTED: 26S protease regulatory subunit 8...    265   1e-83    Cucumis sativus [cucumbers]
ref|XP_004163594.1|  PREDICTED: 26S protease regulatory subunit 8...    265   2e-83    
gb|EYU24670.1|  hypothetical protein MIMGU_mgv1a007142mg                261   8e-82    Erythranthe guttata [common monkey flower]
gb|EPS65331.1|  hypothetical protein M569_09445                         260   1e-81    Genlisea aurea
ref|XP_011081123.1|  PREDICTED: 26S protease regulatory subunit 8...    260   2e-81    Sesamum indicum [beniseed]
ref|XP_011072258.1|  PREDICTED: 26S protease regulatory subunit 8...    257   2e-80    Sesamum indicum [beniseed]
ref|XP_006656207.1|  PREDICTED: 26S protease regulatory subunit 8...    254   4e-79    Oryza brachyantha
gb|EYU21600.1|  hypothetical protein MIMGU_mgv1a006333mg                254   6e-79    Erythranthe guttata [common monkey flower]
ref|XP_010670712.1|  PREDICTED: 26S protease regulatory subunit 8...    250   6e-78    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002970508.1|  hypothetical protein SELMODRAFT_441130             246   1e-76    Selaginella moellendorffii
gb|EMS56105.1|  26S protease regulatory subunit 8-like protein A        245   5e-76    Triticum urartu
ref|NP_001057999.1|  Os06g0600100                                       246   7e-76    
gb|EMT18785.1|  26S protease regulatory subunit 8                       243   2e-75    
gb|EEC80919.1|  hypothetical protein OsI_23597                          243   5e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_002437236.1|  hypothetical protein SORBIDRAFT_10g023320          239   3e-73    Sorghum bicolor [broomcorn]
gb|AAP80641.1|AF475120_1  26S proteasome ATPase subunit                 234   6e-73    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002951010.1|  26S proteasome regulatory complex                  234   1e-71    Volvox carteri f. nagariensis
gb|KIZ02012.1|  26S proteasome regulatory subunit T6                    230   1e-68    Monoraphidium neglectum
tpg|DAA34390.1|  TPA: 26S proteasome regulatory complex ATPase RPT6     220   2e-68    Amblyomma variegatum
gb|EWM22455.1|  26s protease regulatory subunit 8                       224   1e-67    Nannochloropsis gaditana
ref|XP_002501348.1|  proteasomal ATPase                                 221   1e-66    Micromonas commoda
ref|NP_001279851.1|  proteasome (prosome, macropain) 26S subunit,...    221   2e-66    Callorhinchus milii [Australian ghost shark]
gb|EFX79350.1|  hypothetical protein DAPPUDRAFT_52572                   220   3e-66    Daphnia pulex
gb|KFM60482.1|  26S protease regulatory subunit 8                       220   5e-66    Stegodyphus mimosarum
gb|AFM89751.1|  26S protease regulatory subunit 8-like protein          219   5e-66    Callorhinchus milii [Australian ghost shark]
gb|AFU72269.1|  proteasome 26S subunit                                  212   4e-65    Solen grandis [grand jackknife clam]
ref|XP_004965964.1|  PREDICTED: 26S protease regulatory subunit 8...    217   6e-65    Setaria italica
ref|XP_004535085.1|  PREDICTED: 26S protease regulatory subunit 8...    216   7e-65    
ref|XP_003740119.1|  PREDICTED: 26S protease regulatory subunit 8...    217   7e-65    Galendromus occidentalis
ref|XP_005181458.1|  PREDICTED: 26S protease regulatory subunit 8       216   7e-65    Musca domestica
ref|XP_001649429.1|  AAEL014723-PA                                      216   1e-64    Aedes aegypti
ref|XP_009077704.1|  PREDICTED: 26S protease regulatory subunit 8       216   1e-64    Acanthisitta chloris
ref|XP_001870728.1|  26S protease regulatory subunit 8                  216   1e-64    Culex quinquefasciatus
ref|XP_001991849.1|  GH11847                                            216   1e-64    Drosophila grimshawi
ref|XP_001967051.1|  GF21725                                            216   1e-64    Drosophila ananassae
ref|XP_001355733.1|  GA13327                                            216   1e-64    Drosophila pseudoobscura pseudoobscura
gb|ETN68121.1|  26S protease regulatory subunit                         216   1e-64    Anopheles darlingi [American malaria mosquito]
ref|XP_002055458.1|  GJ19383                                            216   1e-64    Drosophila virilis
ref|XP_001641587.1|  predicted protein                                  216   2e-64    Nematostella vectensis
ref|XP_010082942.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    215   2e-64    Pterocles gutturalis
ref|XP_011435912.1|  PREDICTED: 26S protease regulatory subunit 8       216   2e-64    Crassostrea gigas
ref|XP_009047076.1|  hypothetical protein LOTGIDRAFT_138721             215   2e-64    Lottia gigantea
gb|KFB40364.1|  AGAP007243-PA-like protein                              215   2e-64    Anopheles sinensis
ref|XP_007509172.1|  26S protease regulatory subunit 8                  215   3e-64    Bathycoccus prasinos
ref|XP_009494505.1|  26S protease regulatory subunit 8                  215   4e-64    Fonticula alba
ref|XP_308557.2|  AGAP007243-PA                                         214   4e-64    Anopheles gambiae str. PEST
ref|XP_001978679.1|  GG19719                                            214   5e-64    Drosophila erecta
ref|XP_001608055.1|  PREDICTED: 26S protease regulatory subunit 8       214   5e-64    Nasonia vitripennis
ref|XP_002067234.1|  GK16292                                            214   6e-64    Drosophila willistoni
ref|XP_003062429.1|  proteasomal ATPase                                 214   7e-64    Micromonas pusilla CCMP1545
ref|XP_011497497.1|  PREDICTED: 26S protease regulatory subunit 8       214   7e-64    Ceratosolen solmsi marchali
ref|NP_608447.1|  regulatory particle triple-A ATPase 6                 214   7e-64    Drosophila melanogaster
ref|XP_008545433.1|  PREDICTED: 26S protease regulatory subunit 8       214   9e-64    Microplitis demolitor
ref|XP_005091123.1|  PREDICTED: 26S protease regulatory subunit 8...    213   1e-63    
ref|XP_003702455.1|  PREDICTED: 26S protease regulatory subunit 8...    213   1e-63    Megachile rotundata
gb|KDR20973.1|  hypothetical protein L798_04485                         213   2e-63    Zootermopsis nevadensis
ref|XP_006564449.1|  PREDICTED: 26S protease regulatory subunit 8...    213   2e-63    
ref|XP_011059922.1|  PREDICTED: 26S protease regulatory subunit 8       213   2e-63    Acromyrmex echinatior
ref|XP_011341411.1|  PREDICTED: 26S protease regulatory subunit 8       213   2e-63    Ooceraea biroi
ref|XP_003398987.1|  PREDICTED: 26S protease regulatory subunit 8...    213   2e-63    Bombus terrestris [large earth bumblebee]
ref|XP_011260528.1|  PREDICTED: 26S protease regulatory subunit 8       213   2e-63    Camponotus floridanus
ref|XP_003698467.1|  PREDICTED: 26S protease regulatory subunit 8...    213   2e-63    
ref|XP_006814082.1|  PREDICTED: 26S protease regulatory subunit 8...    212   2e-63    Saccoglossus kowalevskii
ref|XP_008487286.1|  PREDICTED: 26S protease regulatory subunit 8...    209   3e-63    
ref|XP_002588921.1|  hypothetical protein BRAFLDRAFT_125428             212   3e-63    Branchiostoma floridae
ref|XP_005719372.1|  26S proteasome ATP-dependent regulatory subunit    212   4e-63    Chondrus crispus [carageen]
ref|XP_002011885.1|  GI14329                                            212   4e-63    Drosophila mojavensis
ref|XP_011154641.1|  PREDICTED: 26S protease regulatory subunit 8       212   5e-63    Harpegnathos saltator
gb|EGI70168.1|  26S protease regulatory subunit 8                       213   5e-63    Acromyrmex echinatior
ref|XP_972551.1|  PREDICTED: 26S protease regulatory subunit 8          212   5e-63    Tribolium castaneum [rust-red flour beetle]
gb|AAC48284.1|  DUG                                                     212   5e-63    Drosophila melanogaster
ref|XP_011303291.1|  PREDICTED: 26S protease regulatory subunit 8       212   5e-63    Fopius arisanus
gb|ACO12128.1|  26S protease regulatory subunit 8                       212   5e-63    Lepeophtheirus salmonis
ref|XP_009928195.1|  PREDICTED: 26S protease regulatory subunit 8       211   1e-62    Haliaeetus albicilla
ref|XP_002423806.1|  26S protease regulatory subunit, putative          211   1e-62    Pediculus humanus corporis [human body lice]
gb|AEE62443.1|  unknown                                                 211   1e-62    Dendroctonus ponderosae
gb|EFA09518.1|  hypothetical protein TcasGA2_TC011620                   211   1e-62    
emb|CBN80092.1|  conserved unknown protein                              210   2e-62    Ectocarpus siliculosus
ref|XP_009166026.1|  hypothetical protein T265_13205                    210   3e-62    Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_001750050.1|  hypothetical protein                               210   3e-62    Monosiga brevicollis MX1
ref|XP_008866523.1|  26S protease regulatory subunit 8                  209   4e-62    Aphanomyces invadans
ref|XP_008471380.1|  PREDICTED: 26S protease regulatory subunit 8       209   4e-62    Diaphorina citri
sp|P54814.1|PRS8_MANSE  RecName: Full=26S protease regulatory sub...    209   5e-62    Manduca sexta [Carolina sphinx]
gb|EHJ76020.1|  26S protease regulatory subunit 8                       209   5e-62    
ref|XP_009823671.1|  26S protease regulatory subunit 8                  209   6e-62    Aphanomyces astaci
ref|XP_004926152.1|  PREDICTED: 26S protease regulatory subunit 8...    209   6e-62    Bombyx mori [silk moth]
dbj|BAM18224.1|  26S protease regulatory subunit                        209   7e-62    Papilio xuthus [Chinese swallowtail]
dbj|GAM29492.1|  hypothetical protein SAMD00019534_126680               207   2e-61    Acytostelium subglobosum LB1
ref|XP_005644732.1|  26S proteasome AAA-ATPase subunit RPT6a            207   3e-61    Coccomyxa subellipsoidea C-169
ref|XP_784151.3|  PREDICTED: 26S protease regulatory subunit 8-like     207   3e-61    
ref|XP_005705074.1|  AAA-type ATPase                                    207   4e-61    Galdieria sulphuraria
ref|XP_005782841.1|  hypothetical protein EMIHUDRAFT_456589             206   5e-61    Emiliania huxleyi CCMP1516
ref|XP_001384165.1|  protease regulatory subunit 8 homolog (SUG1 ...    206   5e-61    Scheffersomyces stipitis CBS 6054
gb|EFN65582.1|  26S protease regulatory subunit 8                       212   7e-61    Camponotus floridanus
gb|KFD51250.1|  hypothetical protein M513_07850                         206   7e-61    Trichuris suis
gb|EFA79359.1|  26S proteasome subunit ATPase 5                         206   8e-61    Heterostelium album PN500
ref|XP_004350825.1|  26S proteasome subunit ATPase 5                    205   1e-60    Cavenderia fasciculata
ref|XP_002909803.1|  26S protease regulatory subunit 8                  203   1e-60    Phytophthora infestans T30-4
ref|XP_002895455.1|  26S protease regulatory subunit 8                  203   1e-60    Phytophthora infestans T30-4
gb|KHJ42528.1|  26S proteasome subunit P45 family protein               206   2e-60    Trichuris suis
gb|KGK36604.1|  hypothetical protein JL09_g4259                         205   2e-60    Pichia kudriavzevii
ref|XP_009529425.1|  hypothetical protein PHYSODRAFT_546373             205   2e-60    Phytophthora sojae
ref|XP_003287255.1|  26S proteasome subunit ATPase 5                    204   3e-60    Dictyostelium purpureum
ref|XP_002909192.1|  26S protease regulatory subunit 8                  204   3e-60    Phytophthora infestans T30-4
ref|XP_502931.1|  YALI0D17204p                                          204   3e-60    Yarrowia lipolytica CLIB122
dbj|GAA49709.1|  26S proteasome regulatory subunit T6                   210   3e-60    Clonorchis sinensis [oriental liver fluke]
emb|CAX70911.1|  Tat-binding protein 10                                 201   4e-60    Schistosoma japonicum
emb|CDW58348.1|  26S protease regulatory subunit 8                      205   4e-60    Trichuris trichiura
gb|KFD64651.1|  hypothetical protein M514_07850                         205   4e-60    Trichuris suis
ref|XP_629632.1|  26S proteasome subunit ATPase 5                       204   5e-60    Dictyostelium discoideum AX4
ref|XP_005949342.1|  PREDICTED: 26S protease regulatory subunit 8...    205   6e-60    
gb|ETI52811.1|  26S protease regulatory subunit 8                       203   1e-59    Phytophthora parasitica P1569
ref|XP_008901335.1|  26S protease regulatory subunit 8                  203   1e-59    Phytophthora parasitica INRA-310
ref|NP_595870.1|  19S proteasome regulatory subunit Rpt6 (predicted)    203   1e-59    Schizosaccharomyces pombe
ref|XP_001009196.2|  26S proteasome subunit P45 family protein          202   1e-59    Tetrahymena thermophila SB210
ref|XP_009807227.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    202   2e-59    Gavia stellata
emb|CDS31889.1|  26S protease regulatory subunit 8                      204   2e-59    Hymenolepis microstoma
ref|XP_005535327.1|  26S proteasome ATP-dependent regulatory subunit    202   3e-59    Cyanidioschyzon merolae strain 10D
gb|AAW27345.1|  SJCHGC09272 protein                                     202   3e-59    Schistosoma japonicum
emb|CAX76058.1|  Tat-binding protein 10                                 201   5e-59    Schistosoma japonicum
emb|CAX76060.1|  Tat-binding protein 10                                 202   5e-59    Schistosoma japonicum
emb|CAX76059.1|  Tat-binding protein 10                                 202   5e-59    Schistosoma japonicum
ref|XP_011397854.1|  26S protease regulatory subunit 8-like prote...    201   6e-59    Auxenochlorella protothecoides
ref|XP_002172384.1|  19S proteasome regulatory subunit Rpt6             201   6e-59    Schizosaccharomyces japonicus yFS275
ref|XP_001526037.1|  26S protease regulatory subunit 8                  201   8e-59    Lodderomyces elongisporus NRRL YB-4239
ref|XP_006690280.1|  26S proteasome subunit P45                         201   9e-59    Yamadazyma tenuis ATCC 10573
ref|XP_005949341.1|  PREDICTED: 26S protease regulatory subunit 8...    202   9e-59    
ref|XP_004194697.1|  Piso0_005206                                       201   1e-58    
ref|XP_458104.1|  DEHA2C09658p                                          200   1e-58    Debaryomyces hansenii CBS767
ref|XP_002013930.1|  GL24409                                            204   2e-58    
emb|CCE44632.1|  hypothetical protein CPAR2_404360                      200   2e-58    Candida parapsilosis
emb|CCA23809.1|  conserved unknown protein putative                     200   2e-58    Albugo laibachii Nc14
ref|XP_003868648.1|  Rpt6 ATPase of the 19S regulatory particle o...    200   2e-58    Candida orthopsilosis Co 90-125
ref|XP_002054061.1|  GJ23001                                            199   2e-58    
emb|CCD79213.1|  putative 26s protease regulatory subunit               200   3e-58    Schistosoma mansoni
gb|KGU12869.1|  26S protease regulatory subunit 8                       199   3e-58    Candida albicans 19F
ref|XP_002547633.1|  26S protease regulatory subunit 8                  199   3e-58    Candida tropicalis MYA-3404
ref|XP_004195789.1|  Piso0_005206                                       199   3e-58    
gb|KGQ89399.1|  26S protease regulatory subunit 8                       199   4e-58    Candida albicans P94015
emb|CDP93275.1|  Protein Bm13756, isoform a                             199   4e-58    Brugia malayi [agent of lymphatic filariasis]
gb|ERG85894.1|  26s protease regulatory subunit 8                       199   5e-58    
ref|XP_003138569.1|  26S protease regulatory subunit 8                  199   6e-58    Loa loa
ref|XP_004997758.1|  peptidase 26S subunit                              199   7e-58    Salpingoeca rosetta
ref|XP_001484363.1|  hypothetical protein PGUG_03744                    199   7e-58    Meyerozyma guilliermondii ATCC 6260
gb|EDK39646.2|  hypothetical protein PGUG_03744                         199   7e-58    Meyerozyma guilliermondii ATCC 6260
gb|EEQ47387.1|  26S protease regulatory subunit 8                       198   8e-58    Candida albicans WO-1
ref|XP_714488.1|  likely 26S proteasome regulatory particle ATPas...    198   9e-58    
ref|XP_714440.1|  likely 26S proteasome regulatory particle ATPas...    198   9e-58    
gb|KDD77137.1|  AAA+ ATPase                                             198   9e-58    Helicosporidium sp. ATCC 50920
ref|XP_007374392.1|  protease regulatory subunit 8 (TAT-binding p...    198   9e-58    Spathaspora passalidarum NRRL Y-27907
ref|XP_002131047.2|  PREDICTED: 26S protease regulatory subunit 8       200   1e-57    Ciona intestinalis [sea vase]
gb|KFQ22861.1|  26S protease regulatory subunit 8                       192   1e-57    Mesitornis unicolor
gb|ACI69824.1|  26S protease regulatory subunit 8                       192   1e-57    Salmo salar
gb|ENN73378.1|  hypothetical protein YQE_10005                          198   1e-57    Dendroctonus ponderosae
gb|AAA33254.1|  HIV1 TAT-binding protein                                197   1e-57    Dictyostelium discoideum
ref|XP_010182778.1|  PREDICTED: 26S protease regulatory subunit 8       192   1e-57    Mesitornis unicolor
ref|XP_002001184.1|  GI10644                                            197   2e-57    Drosophila mojavensis
gb|EJT45284.1|  26S protease regulatory subunit 6B                      197   2e-57    Trichosporon asahii var. asahii CBS 2479
ref|XP_002418769.1|  26S protease regulatory subunit, putative          199   2e-57    Candida dubliniensis CD36
ref|XP_006807591.1|  PREDICTED: 26S protease regulatory subunit 8...    197   3e-57    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005753575.1|  PREDICTED: 26S protease regulatory subunit 8...    197   3e-57    Pundamilia nyererei
ref|XP_005753574.1|  PREDICTED: 26S protease regulatory subunit 8...    197   3e-57    Pundamilia nyererei
ref|XP_011486302.1|  PREDICTED: 26S protease regulatory subunit 8...    197   3e-57    
gb|EYB84771.1|  hypothetical protein Y032_0310g2099                     192   3e-57    Ancylostoma ceylanicum
ref|XP_003961613.1|  PREDICTED: 26S protease regulatory subunit 8...    197   3e-57    Takifugu rubripes [tiger puffer]
ref|XP_004575488.1|  PREDICTED: 26S protease regulatory subunit 8...    196   4e-57    Maylandia zebra
ref|XP_004080302.1|  PREDICTED: 26S protease regulatory subunit 8...    196   4e-57    
ref|XP_005858700.1|  PREDICTED: 26S protease regulatory subunit 8...    197   4e-57    Myotis brandtii
gb|KIH46298.1|  proteasome-activating nucleotidase domain protein       192   4e-57    Ancylostoma duodenale
emb|CEF97024.1|  26S proteasome subunit P45                             196   4e-57    Ostreococcus tauri
ref|XP_003441913.1|  PREDICTED: 26S protease regulatory subunit 8...    196   4e-57    Oreochromis niloticus
gb|KIH55146.1|  proteasome-activating nucleotidase domain protein       192   4e-57    Ancylostoma duodenale
gb|KFH10647.1|  putative tat-binding family protein                     193   4e-57    
gb|KFH15302.1|  putative tat-binding family protein                     193   4e-57    
ref|XP_008882965.1|  tat-binding family protein, putative               196   4e-57    
gb|KFH70245.1|  26S protease regulatory subunit 8                       196   4e-57    
gb|EPX75039.1|  19S proteasome regulatory subunit Rpt6                  196   4e-57    
ref|XP_001416582.1|  predicted protein                                  196   4e-57    
ref|XP_008922253.1|  PREDICTED: 26S protease regulatory subunit 8       194   5e-57    
ref|XP_011486301.1|  PREDICTED: 26S protease regulatory subunit 8...    197   5e-57    
gb|EPY49601.1|  19S proteasome regulatory subunit Rpt6                  196   5e-57    
ref|XP_005812784.1|  PREDICTED: 26S protease regulatory subunit 8...    196   5e-57    
ref|NP_001279996.1|  proteasome (prosome, macropain) 26S subunit,...    196   6e-57    
emb|CBN81418.1|  26S protease regulatory subunit 8                      196   6e-57    
ref|XP_004575486.1|  PREDICTED: 26S protease regulatory subunit 8...    197   6e-57    
ref|XP_008311950.1|  PREDICTED: 26S protease regulatory subunit 8...    196   6e-57    
gb|EDM06372.1|  peptidase (prosome, macropain) 26S subunit, ATPas...    195   6e-57    
ref|XP_004575485.1|  PREDICTED: 26S protease regulatory subunit 8...    197   6e-57    
ref|XP_007543031.1|  PREDICTED: 26S protease regulatory subunit 8       196   6e-57    
ref|XP_008434961.1|  PREDICTED: 26S protease regulatory subunit 8       196   7e-57    
gb|ACQ58243.1|  26S protease regulatory subunit 8                       196   7e-57    
gb|KFG65359.1|  putative tat-binding family protein                     194   8e-57    
ref|XP_567479.1|  endopeptidase                                         196   8e-57    
ref|XP_007255206.1|  PREDICTED: 26S protease regulatory subunit 8...    196   8e-57    
ref|XP_004575484.1|  PREDICTED: 26S protease regulatory subunit 8...    196   8e-57    
ref|XP_004575483.1|  PREDICTED: 26S protease regulatory subunit 8...    196   8e-57    
gb|AFR97551.1|  26S protease regulatory subunit 8                       196   8e-57    
ref|XP_008281791.1|  PREDICTED: 26S protease regulatory subunit 8       196   9e-57    
ref|XP_010743473.1|  PREDICTED: 26S protease regulatory subunit 8...    195   1e-56    
ref|XP_008311949.1|  PREDICTED: 26S protease regulatory subunit 8...    195   1e-56    
ref|XP_010778828.1|  PREDICTED: 26S protease regulatory subunit 8       195   1e-56    
ref|XP_010743472.1|  PREDICTED: 26S protease regulatory subunit 8...    195   1e-56    
gb|EDM06373.1|  peptidase (prosome, macropain) 26S subunit, ATPas...    196   1e-56    
ref|XP_007255205.1|  PREDICTED: 26S protease regulatory subunit 8...    195   1e-56    
ref|NP_001003740.1|  26S protease regulatory subunit 8                  195   1e-56    
gb|AAH77223.1|  Unknown (protein for MGC:79055)                         195   1e-56    
ref|NP_001278998.1|  26S protease regulatory subunit 8                  195   1e-56    
ref|XP_010124904.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    194   1e-56    
ref|NP_001232710.1|  proteasome (prosome, macropain) 26S subunit,...    195   1e-56    
gb|AAH30840.1|  Psmc5 protein                                           193   1e-56    
ref|XP_003501915.2|  PREDICTED: 26S protease regulatory subunit 8       195   2e-56    
ref|XP_005369493.1|  PREDICTED: 26S protease regulatory subunit 8       195   2e-56    
ref|XP_003193908.1|  26S protease regulatory subunit 6B                 195   2e-56    
gb|KFG49256.1|  putative tat-binding family protein                     194   2e-56    
ref|XP_006833639.1|  PREDICTED: 26S protease regulatory subunit 8       194   2e-56    
ref|XP_005070074.1|  PREDICTED: 26S protease regulatory subunit 8       195   2e-56    
ref|XP_008633469.1|  PREDICTED: 26S protease regulatory subunit 8       194   2e-56    
ref|XP_005496491.1|  PREDICTED: 26S protease regulatory subunit 8...    194   2e-56    
gb|ELR44943.1|  26S protease regulatory subunit 8                       195   2e-56    
ref|NP_001279977.1|  proteasome (prosome, macropain) 26S subunit,...    194   2e-56    
ref|XP_009481850.1|  PREDICTED: 26S protease regulatory subunit 8       194   2e-56    
emb|CDQ57027.1|  unnamed protein product                                194   2e-56    
gb|ERE69241.1|  26S protease regulatory subunit 8-like protein          194   2e-56    
ref|XP_002365254.1|  26S protease regulatory subunit 8, putative        194   2e-56    
gb|KIR49607.1|  26S protease regulatory subunit 8                       194   2e-56    
ref|XP_004948567.1|  PREDICTED: 26S protease regulatory subunit 8...    196   2e-56    
ref|XP_010207663.1|  PREDICTED: 26S protease regulatory subunit 8       194   3e-56    
gb|ACO09830.1|  26S protease regulatory subunit 8                       194   3e-56    
ref|XP_005624306.1|  PREDICTED: 26S protease regulatory subunit 8...    196   3e-56    
dbj|BAD92273.1|  proteasome 26S ATPase subunit 5 variant                192   3e-56    
ref|NP_001279980.1|  proteasome (prosome, macropain) 26S subunit,...    194   3e-56    
emb|CCU98996.1|  unnamed protein product                                194   3e-56    
ref|NP_001186092.1|  26S protease regulatory subunit 8 isoform 2        194   3e-56    
ref|XP_011366835.1|  PREDICTED: 26S protease regulatory subunit 8...    194   3e-56    
ref|XP_006638172.1|  PREDICTED: 26S protease regulatory subunit 8...    194   3e-56    
ref|XP_010862883.1|  PREDICTED: 26S protease regulatory subunit 8       194   3e-56    
ref|XP_007104591.1|  PREDICTED: 26S protease regulatory subunit 8...    194   3e-56    
ref|NP_499609.1|  Protein RPT-6                                         194   4e-56    
ref|XP_006886352.1|  PREDICTED: 26S protease regulatory subunit 8...    194   4e-56    
ref|XP_008691830.1|  PREDICTED: 26S protease regulatory subunit 8...    194   4e-56    
ref|XP_009643835.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    194   4e-56    
ref|XP_006722043.1|  PREDICTED: 26S protease regulatory subunit 8...    194   4e-56    
ref|XP_009574083.1|  PREDICTED: 26S protease regulatory subunit 8       194   4e-56    
ref|XP_006134866.1|  PREDICTED: 26S protease regulatory subunit 8       193   4e-56    
ref|XP_006940547.1|  PREDICTED: 26S protease regulatory subunit 8...    194   4e-56    
ref|XP_006638171.1|  PREDICTED: 26S protease regulatory subunit 8...    194   4e-56    
ref|NP_001279985.1|  proteasome (prosome, macropain) 26S subunit,...    194   4e-56    
gb|ERZ95868.1|  hypothetical protein GLOINDRAFT_13200                   187   4e-56    
gb|AAC41735.1|  thyroid receptor interactor                             194   4e-56    
ref|XP_003414376.1|  PREDICTED: 26S protease regulatory subunit 8       194   4e-56    
ref|XP_003222519.1|  PREDICTED: 26S protease regulatory subunit 8       194   4e-56    
ref|NP_001134720.1|  26S protease regulatory subunit 8                  190   5e-56    
ref|XP_007104593.1|  PREDICTED: 26S protease regulatory subunit 8...    194   5e-56    
ref|XP_010615042.1|  PREDICTED: 26S protease regulatory subunit 8...    194   5e-56    
ref|XP_002641019.1|  C. briggsae CBR-RPT-6 protein                      194   5e-56    
dbj|BAA07919.1|  26S proteasome subunit p45                             194   5e-56    
ref|NP_032976.1|  26S protease regulatory subunit 8                     194   5e-56    
gb|AAV38531.1|  proteasome (prosome, macropain) 26S subunit, ATPa...    194   5e-56    
ref|XP_009694446.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    194   5e-56    
dbj|BAB26990.1|  unnamed protein product                                194   5e-56    
gb|ETE70098.1|  26S protease regulatory subunit 8                       194   5e-56    
ref|XP_004013072.1|  PREDICTED: 26S protease regulatory subunit 8       193   5e-56    
ref|XP_001376943.2|  PREDICTED: 26S protease regulatory subunit 8...    193   5e-56    
ref|XP_004456847.1|  PREDICTED: 26S protease regulatory subunit 8...    194   6e-56    
ref|XP_006000216.1|  PREDICTED: 26S protease regulatory subunit 8...    193   6e-56    
ref|NP_989358.1|  proteasome (prosome, macropain) 26S subunit, AT...    193   6e-56    
ref|XP_006000215.1|  PREDICTED: 26S protease regulatory subunit 8...    193   7e-56    
ref|XP_007088322.1|  PREDICTED: 26S protease regulatory subunit 8...    194   7e-56    
ref|XP_004802501.1|  PREDICTED: 26S protease regulatory subunit 8...    194   7e-56    
ref|NP_001280016.1|  proteasome (prosome, macropain) 26S subunit,...    193   7e-56    
ref|XP_006776774.1|  PREDICTED: 26S protease regulatory subunit 8...    193   8e-56    
ref|XP_004749242.1|  PREDICTED: 26S protease regulatory subunit 8...    194   9e-56    
gb|EGT53541.1|  hypothetical protein CAEBREN_19051                      193   1e-55    
gb|EGT47270.1|  hypothetical protein CAEBREN_10399                      193   1e-55    
ref|XP_007957923.1|  PREDICTED: 26S protease regulatory subunit 8       193   1e-55    
emb|CEF68527.1|  Proteasome (Prosome, macropain) 26S subunit, ATP...    193   1e-55    
ref|XP_004802500.1|  PREDICTED: 26S protease regulatory subunit 8...    194   1e-55    
gb|ELU08778.1|  hypothetical protein CAPTEDRAFT_183959                  192   1e-55    
gb|EXX51898.1|  proteasome regulatory particle base subunit RPT6        187   1e-55    
ref|NP_001081635.1|  26S protease regulatory subunit 8                  194   1e-55    
emb|CDR43118.1|  CYFA0S11e00408g1_1                                     192   1e-55    
ref|XP_004364706.2|  tat-binding protein 10                             193   1e-55    
ref|XP_003093824.1|  CRE-RPT-6 protein                                  192   2e-55    
ref|NP_001127417.1|  26S protease regulatory subunit 8                  192   2e-55    
gb|ELK12471.1|  26S protease regulatory subunit 8                       194   2e-55    
emb|CAH91432.1|  hypothetical protein                                   192   2e-55    
emb|CDJ40582.1|  26S protease regulatory subunit 8, putative            200   2e-55    
ref|XP_001732083.1|  hypothetical protein MGL_0676                      192   2e-55    
ref|NP_001270686.1|  uncharacterized protein LOC101865051               192   2e-55    
ref|NP_001085482.1|  proteasome (prosome, macropain) 26S subunit,...    192   2e-55    
gb|EMG50533.1|  26S protease regulatory subunit, putative               199   2e-55    
gb|ABB13463.1|  26S proteasome subunit RPT6                             191   4e-55    
ref|XP_009286152.1|  PREDICTED: 26S protease regulatory subunit 8...    191   4e-55    
gb|EXX51897.1|  proteasome regulatory particle base subunit RPT6        187   8e-55    
gb|EHB07350.1|  26S protease regulatory subunit 8                       193   8e-55    
gb|EXX51896.1|  proteasome regulatory particle base subunit RPT6        187   1e-54    
gb|EHH58251.1|  hypothetical protein EGM_08055                          190   1e-54    
ref|XP_002137338.1|  GA26607                                            190   1e-54    
ref|XP_004037554.1|  hypothetical protein IMG5_049440                   189   1e-54    
ref|XP_005834377.1|  26S proteasome regulatory complex, ATPase RPT6     189   2e-54    
ref|XP_002183738.1|  predicted protein                                  189   2e-54    
gb|EXX51895.1|  proteasome regulatory particle base subunit RPT6        189   3e-54    
ref|XP_009014724.1|  hypothetical protein HELRODRAFT_76345              188   5e-54    
gb|AEB61039.1|  26S protease regulatory subunit 8-like protein          187   5e-54    
ref|NP_001188134.1|  26S protease regulatory subunit 8                  189   7e-54    
ref|XP_001433035.1|  hypothetical protein                               187   9e-54    
ref|XP_004179325.1|  hypothetical protein TBLA_0B09880                  187   1e-53    
gb|EJK56278.1|  hypothetical protein THAOC_23874                        187   1e-53    
gb|EJY64820.1|  hypothetical protein OXYTRI_15032                       187   2e-53    
ref|XP_003669842.1|  hypothetical protein NDAI_0D02850                  187   2e-53    
ref|XP_007337518.1|  26S proteasome regulatory complex, ATPase RPT6     186   2e-53    
ref|XP_675910.1|  tat-binding protein                                   187   3e-53    
gb|KIM78235.1|  hypothetical protein PILCRDRAFT_75787                   186   3e-53    
ref|XP_001451508.1|  hypothetical protein                               186   3e-53    
ref|XP_008045499.1|  26S proteasome regulatory complex ATPase RPT6      186   3e-53    
gb|EMD34732.1|  hypothetical protein CERSUDRAFT_86159                   186   3e-53    
gb|KDQ59992.1|  hypothetical protein JAAARDRAFT_152532                  186   3e-53    
gb|KIM34059.1|  hypothetical protein M408DRAFT_36988                    183   4e-53    
emb|CDW87136.1|  26s protease regulatory subunit 8 homolog a-like       186   4e-53    
ref|XP_003882870.1|  26S proteasome regulatory subunit S4 like AA...    185   4e-53    
ref|XP_001429255.1|  hypothetical protein                               186   4e-53    
ref|XP_007363277.1|  endopeptidase                                      186   4e-53    
ref|XP_008622617.1|  26S protease regulatory subunit 8 like A           186   4e-53    
ref|XP_010311616.1|  PREDICTED: 26S protease regulatory subunit 8       185   5e-53    
ref|XP_007313687.1|  hypothetical protein SERLADRAFT_457206             186   5e-53    
gb|EUD74697.1|  26S protease regulatory subunit 8 like A                186   5e-53    
ref|WP_028830662.1|  hypothetical protein                               185   6e-53    
ref|XP_003028539.1|  hypothetical protein SCHCODRAFT_85835              185   7e-53    
emb|CDQ58837.1|  unnamed protein product                                194   7e-53    
gb|ETB62047.1|  26S protease regulatory subunit 8                       185   1e-52    
emb|CDU20987.1|  26S protease regulatory subunit 8, putative            185   1e-52    
ref|XP_730846.1|  hypothetical protein                                  185   2e-52    
gb|EPS96889.1|  26S proteasome regulatory complex ATPase RPT6           184   2e-52    
ref|XP_002498946.1|  ZYRO0G22330p                                       184   2e-52    
emb|CDJ94258.1|  ATPase domain containing protein                       182   3e-52    
ref|XP_004225252.1|  26S protease regulatory subunit 8                  184   3e-52    
gb|KIK69790.1|  hypothetical protein GYMLUDRAFT_34189                   184   3e-52    
gb|KDQ08798.1|  hypothetical protein BOTBODRAFT_37657                   183   4e-52    
ref|XP_002287160.1|  26S proteasome ATPase regulatory subunit 6         183   4e-52    
emb|CCI49769.1|  unnamed protein product                                183   4e-52    
ref|XP_007842827.1|  26s protease regulatory subunit 8                  183   5e-52    
ref|XP_001614014.1|  26S protease regulatory subunit 8                  183   5e-52    
ref|XP_004832929.1|  26S protease regulatory subunit, putative          182   6e-52    
ref|XP_003673529.1|  hypothetical protein NCAS_0A05880                  183   6e-52    
ref|XP_008818762.1|  26S protease regulatory subunit 8 like A           183   7e-52    
ref|XP_011271412.1|  26S protease regulatory subunit                    182   7e-52    
gb|EHN02423.1|  Rpt6p                                                   181   7e-52    
ref|XP_009551844.1|  putative 26S proteasome regulatory complex, ...    182   9e-52    
emb|CEL60391.1|  26S proteasome regulatory subunit T6                   179   9e-52    
emb|CDK29156.1|  unnamed protein product                                182   1e-51    
gb|KGG53111.1|  AAA-type ATPase                                         182   1e-51    
gb|ESW98631.1|  26S protease regulatory subunit 8                       182   1e-51    
gb|KDR68387.1|  hypothetical protein GALMADRAFT_129463                  182   1e-51    
gb|ERL90778.1|  hypothetical protein D910_08124                         182   1e-51    
ref|XP_001350873.1|  tat-binding protein homolog                        183   1e-51    
emb|CDO65761.1|  26S protease regulatory subunit 8, putative            182   1e-51    
pir||S51042  tat-binding protein homolog - malaria parasite (Plas...    182   1e-51 
gb|KII91295.1|  hypothetical protein PLICRDRAFT_89620                   182   1e-51    
ref|XP_007394802.1|  hypothetical protein PHACADRAFT_119097             182   1e-51    
ref|XP_007308890.1|  26S proteasome regulatory complex ATPase RPT6      182   1e-51    
emb|CCA36512.1|  26S protease regulatory subunit 8                      182   2e-51    
emb|CCO32239.1|  26S protease regulatory subunit 8 homolog A AltN...    179   2e-51    
gb|KHJ96628.1|  26S proteasome subunit P45 family protein               182   2e-51    
ref|NP_011467.1|  proteasome regulatory particle base subunit RPT6      182   2e-51    
gb|EEU06395.1|  Rpt6p                                                   182   2e-51    
gb|AJS27254.1|  Rpt6p                                                   182   2e-51    
ref|XP_002262561.1|  tat-binding-like protein                           182   2e-51    
gb|AJR78548.1|  Rpt6p                                                   182   2e-51    
gb|EJT44848.1|  RPT6-like protein                                       182   2e-51    
gb|AJR76564.1|  Rpt6p                                                   181   2e-51    
gb|AAU84927.1|  putative 26S protease regulatory subunit 8              181   2e-51    
ref|XP_001943740.1|  PREDICTED: 26S protease regulatory subunit 8       181   3e-51    
ref|XP_010138601.1|  PREDICTED: 26S protease regulatory subunit 8...    174   3e-51    
gb|EUC55326.1|  26S proteasome regulatory complex ATPase RPT6           181   3e-51    
ref|XP_001644842.1|  hypothetical protein Kpol_1041p42                  181   4e-51    
gb|AEQ35009.1|  proteasome 26S subunit, atpase 5                        172   4e-51    
ref|XP_011103466.1|  rpt6p                                              181   4e-51    
ref|XP_001884799.1|  26S proteasome regulatory complex, ATPase RPT6     181   4e-51    
ref|XP_002411084.1|  26S proteasome regulatory complex, ATPase RP...    179   5e-51    
gb|AJS03723.1|  Rpt6p                                                   180   5e-51    
ref|XP_001451984.1|  hypothetical protein                               180   5e-51    
emb|CCA69384.1|  probable RPT6-26S proteasome regulatory subunit        183   6e-51    
gb|KIJ29271.1|  hypothetical protein M422DRAFT_188704                   180   6e-51    
emb|CDS35918.1|  26S protease regulatory subunit 8                      181   6e-51    
gb|KIM42199.1|  hypothetical protein M413DRAFT_444647                   180   7e-51    
emb|CAA47023.1|  sug1                                                   180   8e-51    
gb|KJA26824.1|  hypothetical protein HYPSUDRAFT_132211                  180   8e-51    
prf||1813279A  SUG1 gene                                                180   9e-51 
ref|XP_006682141.1|  26S protease subunit                               179   1e-50    
ref|XP_001964693.1|  GF23322                                            179   1e-50    
gb|ABI14281.1|  ATP-dependent 26S proteasome regulatory subunit         179   1e-50    
gb|KEP50037.1|  26S proteasome regulatory complex ATPase RPT6           179   1e-50    
gb|ETN74985.1|  26S proteasome subunit P45 family protein               180   1e-50    



>ref|XP_009770420.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Nicotiana 
sylvestris]
 gb|AGC54442.1| 26S proteasome ATPase regulatory subunit 6 [Nicotiana tabacum]
Length=417

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA+A VEK+R E EREESCSAK  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN
Sbjct  1    MASADVEKSRREIEREESCSAKATKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITP
Sbjct  61   ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_009599866.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Nicotiana 
tomentosiformis]
Length=417

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA+A VEK++ E EREESCSAK  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN
Sbjct  1    MASADVEKSKREIEREESCSAKATKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITP
Sbjct  61   ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_004239281.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Solanum 
lycopersicum]
Length=417

 Score =   315 bits (808),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA+A VEK+R + EREE+CSAKP KQGEGLRQYYMQHIHDLQLQVR KTHNLNRLEAQRN
Sbjct  1    MASADVEKSRIDMEREEACSAKPTKQGEGLRQYYMQHIHDLQLQVRVKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+ K+IDITKITP
Sbjct  61   ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIGKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_006338168.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Solanum 
tuberosum]
 ref|XP_006365620.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Solanum 
tuberosum]
Length=417

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA+  VEK+R + EREE+CSAKP KQGEGLRQYYMQHIHDLQLQVR KTHNLNRLEAQRN
Sbjct  1    MASVDVEKSRSDMEREEACSAKPTKQGEGLRQYYMQHIHDLQLQVRVKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+ K+IDITKITP
Sbjct  61   ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIGKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_004239282.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Solanum 
lycopersicum]
Length=417

 Score =   313 bits (802),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA+  VEK R + EREE+CSAKP KQGEGLRQYYMQHIHDLQLQVR KTHNLNRLEAQRN
Sbjct  1    MASVDVEKRRSDMEREEACSAKPTKQGEGLRQYYMQHIHDLQLQVRVKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+ K+IDITKITP
Sbjct  61   ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIGKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>gb|AGC54441.1| 26S proteasome ATPase regulatory subunit 6 [Capsicum annuum]
Length=417

 Score =   312 bits (800),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA+  V ++R E+EREE CSAK  KQGEGLRQYYMQHIHDLQLQVR KTHNLNRLEAQRN
Sbjct  1    MASVDVGRSRMEAEREEICSAKATKQGEGLRQYYMQHIHDLQLQVRHKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITKITP
Sbjct  61   ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKTIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>emb|CDP03399.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   311 bits (797),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 161/169 (95%), Gaps = 3/169 (2%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP---MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEA  265
            MATA VEK R  +EREESCS+K    +KQGEGLRQYY+QHIHDLQLQVRQK+HNLNRLEA
Sbjct  1    MATAEVEKNRSGAEREESCSSKGTMMVKQGEGLRQYYLQHIHDLQLQVRQKSHNLNRLEA  60

Query  266  QRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITK  445
            QRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITK
Sbjct  61   QRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDITK  120

Query  446  ITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            ITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  ITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  169



>ref|XP_009337249.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Pyrus 
x bretschneideri]
 ref|XP_009339862.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Pyrus 
x bretschneideri]
Length=417

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA AGVE  RP++  EE+CSAK  KQGEGLRQYY+QHIH+LQLQVRQKTHNLNRLEAQRN
Sbjct  1    MAAAGVEIKRPDAAPEETCSAKASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_009590572.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Nicotiana 
tomentosiformis]
Length=418

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 158/167 (95%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSA-KPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MA+A VEK+R E EREESCSA K  KQGEGLRQYYMQHIHDLQLQVR KTHNLNRLEAQR
Sbjct  1    MASAEVEKSRTEMEREESCSAAKGTKQGEGLRQYYMQHIHDLQLQVRLKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNSKVRMLKEELQLLQEPGSYVGEVVK+MGKSKVLVKVHPEGKY VD+DK+IDITKIT
Sbjct  61   NELNSKVRMLKEELQLLQEPGSYVGEVVKMMGKSKVLVKVHPEGKYAVDIDKNIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            P TRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PLTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_008344058.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Malus 
domestica]
Length=417

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA AGVE   P++  EE+CSAK  KQGEGLRQYY+QHIH+LQLQVRQKTHNLNRLEAQRN
Sbjct  1    MAAAGVEIKHPDAAPEETCSAKASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_007202157.1| hypothetical protein PRUPE_ppa006323mg [Prunus persica]
 ref|XP_008242710.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Prunus 
mume]
 gb|EMJ03356.1| hypothetical protein PRUPE_ppa006323mg [Prunus persica]
Length=417

 Score =   306 bits (783),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA  GVE   PE+  EE+CSAK  KQGEGLRQYY+QHIH+LQLQVRQKTHNLNRLEAQRN
Sbjct  1    MAAVGVEIKHPEAVPEEACSAKATKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+ID+TKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDVTKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_009376844.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Pyrus 
x bretschneideri]
 ref|XP_009350288.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Pyrus 
x bretschneideri]
Length=417

 Score =   305 bits (780),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA  GVE   P++  EE+CSAK  KQGEGLRQYY+QHIH+LQLQVRQKTHNLNRLEAQRN
Sbjct  1    MAAVGVEIKHPDAAPEETCSAKASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_008375711.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Malus 
domestica]
Length=417

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA AGVE   P++  EE+CSAK  KQGEGLRQYY+QHIH+ QLQVRQKTHNLNRLEAQRN
Sbjct  1    MAAAGVEIKHPDAAPEETCSAKASKQGEGLRQYYLQHIHEHQLQVRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_002529369.1| 26S protease regulatory subunit, putative [Ricinus communis]
 gb|EEF33036.1| 26S protease regulatory subunit, putative [Ricinus communis]
Length=382

 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESE-REESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MAT G+E+  PES   +E+CSAKP +KQGEGLRQYY+QHIH+ QLQVRQKTHNLNRLEAQ
Sbjct  1    MATVGIERKHPESMIADETCSAKPAVKQGEGLRQYYLQHIHEHQLQVRQKTHNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>gb|KDO80362.1| hypothetical protein CISIN_1g014743mg [Citrus sinensis]
Length=374

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 157/168 (93%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESER-EESCSAK-PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  G+E  +PES   EE C+AK   KQGEGLRQYY+QHIH+LQLQVRQKTHNLNRLEAQ
Sbjct  1    MAAVGIETKQPESAAPEEVCAAKGASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRMLKEELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_006451010.1| hypothetical protein CICLE_v10008422mg [Citrus clementina]
 ref|XP_006475777.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Citrus 
sinensis]
 gb|ESR64250.1| hypothetical protein CICLE_v10008422mg [Citrus clementina]
 gb|KDO80360.1| hypothetical protein CISIN_1g014743mg [Citrus sinensis]
Length=419

 Score =   300 bits (769),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 157/168 (93%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESER-EESCSAK-PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  G+E  +PES   EE C+AK   KQGEGLRQYY+QHIH+LQLQVRQKTHNLNRLEAQ
Sbjct  1    MAAVGIETKQPESAAPEEVCAAKGASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRMLKEELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_004490469.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cicer 
arietinum]
Length=417

 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MAT GVE  + +   EE+CSAKP K GEGLRQYY QHIHDLQL +RQKTHNLNRLEAQRN
Sbjct  1    MATVGVEVKQAQGALEENCSAKPTKSGEGLRQYYSQHIHDLQLLLRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            +LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITK+TP
Sbjct  61   DLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDITKLTP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_010254305.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Nelumbo 
nucifera]
Length=418

 Score =   299 bits (766),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 156/167 (93%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVE-KTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MATA ++ K    +  EE CS+K  KQGEGLRQYY+QHIHDLQLQVRQKTHNLNRLEAQR
Sbjct  1    MATAAIDSKQAAAATPEEMCSSKTTKQGEGLRQYYLQHIHDLQLQVRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            N+LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITKIT
Sbjct  61   NDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_004504777.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cicer 
arietinum]
Length=417

 Score =   299 bits (766),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA  GVE    E   EE CSAKP KQGEGLRQYY QHIH+LQL +RQKTHNLNRLEAQRN
Sbjct  1    MAAVGVEVKHAEGAPEEHCSAKPTKQGEGLRQYYTQHIHELQLLLRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_010249967.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Nelumbo 
nucifera]
Length=418

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 156/167 (93%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKT-RPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MATA V+      +  ++ CS+K MKQGEGLRQYY+QHIHDLQLQVRQKTHNLNRLEAQR
Sbjct  1    MATAAVDTNLAATATSDDMCSSKTMKQGEGLRQYYLQHIHDLQLQVRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            N+LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITKIT
Sbjct  61   NDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>gb|AFK34159.1| unknown [Medicago truncatula]
Length=417

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA  GVE    E   EE CSAKP KQGEGLRQYY QHIH+LQL  RQKTHNLNRLEAQRN
Sbjct  1    MAAVGVEVKHAEGAPEEHCSAKPTKQGEGLRQYYTQHIHELQLLQRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>gb|KEH31238.1| 26S proteasome regulatory particle triple-A ATPase protein [Medicago 
truncatula]
Length=417

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA  GVE    E   EE CSAKP KQGEGLRQYY QHIH+LQL  RQKTHNLNRLEAQRN
Sbjct  1    MAAVGVEVKHAEGAPEEHCSAKPTKQGEGLRQYYTQHIHELQLLQRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>gb|KJB83167.1| hypothetical protein B456_013G232600 [Gossypium raimondii]
Length=390

 Score =   296 bits (759),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 157/167 (94%), Gaps = 2/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT GVE+ +P +  EE C+AK   KQGEGLRQYY+QHIH+LQL +RQKTHNLNRLEAQR
Sbjct  1    MATVGVERKQPATA-EEMCTAKSGAKQGEGLRQYYLQHIHELQLNLRQKTHNLNRLEAQR  59

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  60   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  119

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_010098977.1| 26S protease regulatory subunit 8-A-like protein [Morus notabilis]
 gb|EXB76279.1| 26S protease regulatory subunit 8-A-like protein [Morus notabilis]
Length=397

 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MA  G E  + ++  EE+CSAK  +KQGEGLRQYY+QHIH+LQLQVRQKTHNLNRLEAQR
Sbjct  1    MAAGGGESKQADAMPEETCSAKAAVKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>gb|KJB83166.1| hypothetical protein B456_013G232600 [Gossypium raimondii]
Length=417

 Score =   296 bits (759),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 157/167 (94%), Gaps = 2/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT GVE+ +P +  EE C+AK   KQGEGLRQYY+QHIH+LQL +RQKTHNLNRLEAQR
Sbjct  1    MATVGVERKQPATA-EEMCTAKSGAKQGEGLRQYYLQHIHELQLNLRQKTHNLNRLEAQR  59

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  60   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  119

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_002285273.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Vitis 
vinifera]
 emb|CBI36245.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MATA  E++  E   EE C+AK  +QGEGL+QYY+QH HDLQLQVRQK HNLNRLEAQRN
Sbjct  1    MATASTERSLAEPMAEERCTAKTKQQGEGLKQYYLQHNHDLQLQVRQKAHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            +LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITKITP
Sbjct  61   DLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_007013331.1| Regulatory particle triple-A ATPase 6A [Theobroma cacao]
 gb|EOY30950.1| Regulatory particle triple-A ATPase 6A [Theobroma cacao]
Length=417

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 157/167 (94%), Gaps = 2/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT G+E+ +P S  EE C+AK   KQGEGLRQYY+QHIH+LQL +RQKTHNLNRLEAQR
Sbjct  1    MATVGIERKQPAST-EEMCTAKSGAKQGEGLRQYYLQHIHELQLNLRQKTHNLNRLEAQR  59

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKIT
Sbjct  60   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKIT  119

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>gb|KDP32350.1| hypothetical protein JCGZ_13275 [Jatropha curcas]
Length=419

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESE-REESCSAK-PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MAT  VE  +PES   EE+CSAK  +KQGEGLRQYY+QHIH+LQLQVRQK +NLNRLEAQ
Sbjct  1    MATVAVENKQPESMIAEETCSAKGAVKQGEGLRQYYLQHIHELQLQVRQKNNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_008464995.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Cucumis 
melo]
Length=418

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 155/167 (93%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK-PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  VE  +  S   ++CSAK   KQGEGLRQYY+QHIH+LQLQVRQKTHNLNRLEAQR
Sbjct  1    MATMEVETQKVASASLDACSAKQATKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNSKVRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSKVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>emb|CDY35832.1| BnaC09g37640D [Brassica napus]
Length=419

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM--KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GVE  RPE+  EE+C+AK    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVGVEARRPETAMEETCNAKGAVAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDI KI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDINKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_010454291.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Camelina 
sativa]
Length=419

 Score =   294 bits (753),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GV+  RPE   EE+C+AK    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVGVDTRRPELAMEETCNAKGAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|NP_568389.1| regulatory particle triple-A ATPase 6A [Arabidopsis thaliana]
 sp|Q9C5U3.1|PRS8A_ARATH RecName: Full=26S protease regulatory subunit 8 homolog A; AltName: 
Full=26S proteasome AAA-ATPase subunit RPT6a; AltName: 
Full=26S proteasome subunit 8 homolog A; AltName: Full=Regulatory 
particle triple-A ATPase subunit 6a [Arabidopsis thaliana]
 dbj|BAB40755.1| AtSUG1 [Arabidopsis thaliana]
 gb|AAL38350.1| unknown protein [Arabidopsis thaliana]
 gb|AAP78936.1| At5g19990 [Arabidopsis thaliana]
 gb|AED92777.1| regulatory particle triple-A ATPase 6A [Arabidopsis thaliana]
Length=419

 Score =   294 bits (753),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GV+  RPE+  EE+C+ K    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVGVDSRRPETAMEETCNVKGAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_009126408.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Brassica 
rapa]
Length=419

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GVE  RPE+  EE+C+ K    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVGVESMRPETAMEETCNVKIAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDI KI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDINKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_007135859.1| hypothetical protein PHAVU_010G164000g [Phaseolus vulgaris]
 gb|ESW07853.1| hypothetical protein PHAVU_010G164000g [Phaseolus vulgaris]
Length=319

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA AGVE    E+  EE+CSAKP KQGEGLR YY  +IH+ QL +RQKTHNLNRLEAQRN
Sbjct  1    MALAGVEVKHVEAVPEENCSAKPTKQGEGLRHYYSLNIHEHQLLLRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_006287833.1| hypothetical protein CARUB_v10001052mg [Capsella rubella]
 gb|EOA20731.1| hypothetical protein CARUB_v10001052mg [Capsella rubella]
Length=419

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GV+  R ES  EE+C+ K    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVGVDTRRAESAMEETCNVKGAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_010420826.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Camelina 
sativa]
 ref|XP_010493090.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Camelina 
sativa]
Length=419

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GV+  RPE   EE+C+ K    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVGVDTRRPELAMEETCNVKGAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_009120838.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Brassica 
rapa]
Length=419

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM--KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GVE  RPE+  EE+C+AK    KQGEGL+QYY+QHIH+LQ  +RQKT+NLNRLEAQ
Sbjct  1    MAAVGVEARRPETAMEETCNAKGAVAKQGEGLKQYYLQHIHELQRLLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDI KI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDINKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>gb|KJB64819.1| hypothetical protein B456_010G066600 [Gossypium raimondii]
Length=417

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 156/167 (93%), Gaps = 2/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  +E+ + ++  EE C+AK   KQGEGLRQYY+QHIH+LQL +RQKTHNLNRLEAQR
Sbjct  1    MATVAIER-KQQASAEEMCTAKSGAKQGEGLRQYYLQHIHELQLNLRQKTHNLNRLEAQR  59

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKIT
Sbjct  60   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKIT  119

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_004149888.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cucumis 
sativus]
 ref|XP_004167971.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cucumis 
sativus]
 gb|KGN65291.1| hypothetical protein Csa_1G302180 [Cucumis sativus]
Length=418

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK-PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MA   VE  +  S   ++CSAK   KQGEGLRQYY+QHIH+ QLQVRQKTHNLNRLEAQR
Sbjct  1    MAIMEVETQQAASASLDACSAKQATKQGEGLRQYYLQHIHEHQLQVRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNSKVRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSKVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_010454292.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Camelina 
sativa]
Length=419

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 154/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MAT GV+  RPE   EE+C+ K    KQGEGL+QYY QHIH+ Q Q+RQKT+NLNRLEAQ
Sbjct  1    MATVGVDARRPEMAMEETCNVKGAAAKQGEGLKQYYFQHIHENQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVDVDKSIDITK+
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDVDKSIDITKL  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_007135858.1| hypothetical protein PHAVU_010G164000g [Phaseolus vulgaris]
 gb|ESW07852.1| hypothetical protein PHAVU_010G164000g [Phaseolus vulgaris]
Length=417

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA AGVE    E+  EE+CSAKP KQGEGLR YY  +IH+ QL +RQKTHNLNRLEAQRN
Sbjct  1    MALAGVEVKHVEAVPEENCSAKPTKQGEGLRHYYSLNIHEHQLLLRQKTHNLNRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKITP
Sbjct  61   ELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_002871914.1| ATSUG1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48173.1| ATSUG1 [Arabidopsis lyrata subsp. lyrata]
Length=419

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA   V+  RPE+  EE+C+ K    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVEVDSRRPETAMEETCNVKGAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>gb|KJB54106.1| hypothetical protein B456_009G020800 [Gossypium raimondii]
 gb|KJB54107.1| hypothetical protein B456_009G020800 [Gossypium raimondii]
Length=417

 Score =   290 bits (741),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 155/167 (93%), Gaps = 2/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  +E+ +  S  EE C+AK   KQGEGLRQYY+QHIH+LQL +RQKTHNLNRLEAQR
Sbjct  1    MATVDIERKQAASA-EEICTAKSGAKQGEGLRQYYIQHIHELQLNLRQKTHNLNRLEAQR  59

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKIT
Sbjct  60   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKIT  119

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>gb|KHG30505.1| 26S protease regulatory subunit 8 A -like protein [Gossypium 
arboreum]
Length=417

 Score =   289 bits (740),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 155/167 (93%), Gaps = 2/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  +E+ +  S  EE C+AK   KQGEGLRQYY+QHIH+LQL +RQKTHNLNRLEAQR
Sbjct  1    MATVDIERKQAASA-EEICTAKSGAKQGEGLRQYYIQHIHELQLNLRQKTHNLNRLEAQR  59

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKIT
Sbjct  60   NELNSQVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKIT  119

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_006400565.1| hypothetical protein EUTSA_v10013657mg [Eutrema salsugineum]
 gb|ESQ42018.1| hypothetical protein EUTSA_v10013657mg [Eutrema salsugineum]
Length=419

 Score =   289 bits (740),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM--KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GV+  R E+  EE+C+ K    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVGVDSRRLETTMEETCNVKGAVAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_010493091.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Camelina 
sativa]
Length=420

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 153/169 (91%), Gaps = 3/169 (2%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCS---AKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEA  265
            MAT GVE  RPE   EE+C+   A   KQGEGL+QYY QHIH+ Q Q+RQKT NLNR+EA
Sbjct  1    MATVGVEARRPEMAMEETCNVKGAAAAKQGEGLKQYYFQHIHENQRQLRQKTINLNRVEA  60

Query  266  QRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITK  445
            QRNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVDVDKSIDITK
Sbjct  61   QRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDVDKSIDITK  120

Query  446  ITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            +TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  LTPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  169



>ref|NP_001242190.1| uncharacterized protein LOC100776268 [Glycine max]
 gb|ACU17766.1| unknown [Glycine max]
Length=395

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVE-KTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MA  GVE K   E   EE+CSAKP KQGEGLR YY  +IH+ QL +RQKTHNLNRLEAQR
Sbjct  1    MALVGVEVKHAAEGAPEENCSAKPTKQGEGLRHYYSHNIHEHQLLLRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_006584548.1| PREDICTED: uncharacterized protein LOC100776268 isoform X1 [Glycine 
max]
Length=418

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVE-KTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MA  GVE K   E   EE+CSAKP KQGEGLR YY  +IH+ QL +RQKTHNLNRLEAQR
Sbjct  1    MALVGVEVKHAAEGAPEENCSAKPTKQGEGLRHYYSHNIHEHQLLLRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_006293475.1| hypothetical protein CARUB_v10023291mg [Capsella rubella]
 gb|ABW81135.1| unknown [Capsella rubella]
 gb|EOA26373.1| hypothetical protein CARUB_v10023291mg [Capsella rubella]
Length=419

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 154/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MAT G++  RPE   EE+C+ K    KQGEGL+QYY QHIH+ Q Q+RQKT+NLNRLEAQ
Sbjct  1    MATIGLDPMRPEIGMEETCNVKGAAAKQGEGLKQYYFQHIHEHQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVDVDKSIDITK+
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDVDKSIDITKL  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>gb|KHG13670.1| 26S protease regulatory subunit 8 A -like protein [Gossypium 
arboreum]
Length=417

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 154/167 (92%), Gaps = 2/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            M T  +E+ + ++  EE C+AK   KQGEGLR YY+QHIH+LQL +RQKTHNLNRLEAQR
Sbjct  1    MGTVAIER-KQQASAEEMCTAKSGAKQGEGLRHYYLQHIHELQLNLRQKTHNLNRLEAQR  59

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKIT
Sbjct  60   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKIT  119

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>emb|CDY42324.1| BnaC02g09300D [Brassica napus]
Length=717

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GVE  RPES  EE+C+ K    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVGVESMRPESAMEETCNVKIAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>gb|KFK26248.1| hypothetical protein AALP_AA8G222400 [Arabis alpina]
Length=419

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 154/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP--MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GV+  RPE+  EE C+ K    KQGEGL+QYY+QHIH+ Q Q+RQKT+NLNRLEAQ
Sbjct  1    MAGVGVDARRPETAMEEICNVKGSVAKQGEGLKQYYLQHIHEHQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RN+LNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVDVDKSIDITKI
Sbjct  61   RNDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDVDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_010914939.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Elaeis 
guineensis]
Length=427

 Score =   286 bits (733),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 154/176 (88%), Gaps = 10/176 (6%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK------PMK----QGEGLRQYYMQHIHDLQLQVRQKTH  244
            MAT  VEK  P +  E+   A+      P K     GEGLRQYY+QHIHDLQLQ+RQKTH
Sbjct  1    MATVAVEKQVPAAAGEKRAEAEGEMFSPPAKVRGGGGEGLRQYYLQHIHDLQLQLRQKTH  60

Query  245  NLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVD  424
            NLNRLEAQRNELNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+D
Sbjct  61   NLNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDID  120

Query  425  KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            K+IDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  KNIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  176



>ref|XP_010520598.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Tarenaya 
hassleriana]
Length=418

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 3/168 (2%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM--KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MAT GV+  RPE+  EE+C+AK +  KQGEGL+ YY+Q+I +LQ  +RQKTHNLNRLEAQ
Sbjct  1    MATVGVDARRPEAS-EETCNAKAVAAKQGEGLKHYYLQNILELQRLLRQKTHNLNRLEAQ  59

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVDVDKSIDITKI
Sbjct  60   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDVDKSIDITKI  119

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_008785391.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Phoenix 
dactylifera]
Length=427

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 154/170 (91%), Gaps = 2/170 (1%)
 Frame = +2

Query  89   EKMATAGVEKTRPESEREESCSAKPMKQG--EGLRQYYMQHIHDLQLQVRQKTHNLNRLE  262
            EK A A + + +  +E E   SA  ++ G  EGLRQYY+QHIHDLQLQ+RQKTHNLNRLE
Sbjct  7    EKQAAAAMGEKQAVAEGELFSSAAKVRGGGGEGLRQYYLQHIHDLQLQLRQKTHNLNRLE  66

Query  263  AQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDIT  442
            AQRNELNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDIT
Sbjct  67   AQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDIT  126

Query  443  KITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            KITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  127  KITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  176



>gb|ACN40682.1| unknown [Picea sitchensis]
Length=433

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  80   QESEKMATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRL  259
            Q S+  A A  ++   E  +    S K +KQGEGLRQYY+QHIHDLQLQVRQKTHNLNRL
Sbjct  12   QASDLEAAANAKEKLKEKHQLLKESNKMVKQGEGLRQYYLQHIHDLQLQVRQKTHNLNRL  71

Query  260  EAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDI  439
            EAQRN+LNSKVR L+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDK+IDI
Sbjct  72   EAQRNDLNSKVRALREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKNIDI  131

Query  440  TKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  132  TKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  182



>ref|XP_002315825.2| 26S proteasome subunit 8 family protein [Populus trichocarpa]
 gb|ABK95350.1| unknown [Populus trichocarpa]
 gb|EEF01996.2| 26S proteasome subunit 8 family protein [Populus trichocarpa]
Length=426

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 156/175 (89%), Gaps = 9/175 (5%)
 Frame = +2

Query  95   MATAGVEKTRPESER-------EESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHN  247
            MAT GVE+ + +          EESCSAK   ++QGEGL+QYY+QHIH+LQL VRQK+HN
Sbjct  1    MATVGVERKQQQQTESTMTMIAEESCSAKTGAVRQGEGLKQYYLQHIHELQLLVRQKSHN  60

Query  248  LNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDK  427
            LNRLEAQRN LNS+VRML+EE QLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK
Sbjct  61   LNRLEAQRNGLNSRVRMLREESQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDK  120

Query  428  SIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            SIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  SIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  175



>dbj|BAA87070.2| TAT-binding protein homolog [Matricaria chamomilla]
Length=414

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 146/151 (97%), Gaps = 1/151 (1%)
 Frame = +2

Query  143  ESCSAKPM-KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQL  319
            ESCS+K + K GEGLRQYY+QHIHD QLQVRQKTHNLNRLEAQRNELNS+V MLKEELQL
Sbjct  13   ESCSSKGVAKTGEGLRQYYLQHIHDAQLQVRQKTHNLNRLEAQRNELNSRVGMLKEELQL  72

Query  320  LQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHL  499
            LQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSYVLHL
Sbjct  73   LQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYVLHL  132

Query  500  ILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            +LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  133  VLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  163



>emb|CAB63651.1| 26S proteasome subunit 8 [Fagus sylvatica]
Length=418

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = +2

Query  107  GVEKTRPES-EREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELN  283
             +E   PE+   +E+CSAK  KQGEGL+QYY+QHIH+ QLQVRQKTHNLNRLEAQRNE N
Sbjct  2    AIETKHPEAVPADETCSAKCSKQGEGLKQYYLQHIHEHQLQVRQKTHNLNRLEAQRNEFN  61

Query  284  SKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTR  463
            S+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVH EGKYVVD+DK+IDITKITPSTR
Sbjct  62   SRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHSEGKYVVDIDKNIDITKITPSTR  121

Query  464  VALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            VALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  122  VALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  164



>ref|XP_002871915.1| ATSUG1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48174.1| ATSUG1 [Arabidopsis lyrata subsp. lyrata]
Length=419

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 153/168 (91%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GVE   P +  EE+C+ K    KQGEGL+QYY+QHIH+LQ  +RQKT+NLNRLEAQ
Sbjct  1    MAAVGVEARPPVTAMEETCNVKGAAAKQGEGLKQYYLQHIHELQRLLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITK+
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKL  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>dbj|BAJ85508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   284 bits (727),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQG-EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  ++ ++P        SAK  + G EGLRQYY+QHIHDLQLQ+RQKTHNLNRLEAQR
Sbjct  1    MATVAMDISKPPPAASGDESAKGARGGGEGLRQYYLQHIHDLQLQIRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            N+LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSY+LHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYMLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_002284747.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Vitis 
vinifera]
 emb|CBI20968.3| unnamed protein product [Vitis vinifera]
Length=420

 Score =   284 bits (727),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 2/152 (1%)
 Frame = +2

Query  143  ESCSAKPM--KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQ  316
            E C+AK    KQG+GLRQYY+QHIHDLQLQVRQK+HNLNRLEAQRN+LNS+VRML+EELQ
Sbjct  18   EVCTAKTTSSKQGDGLRQYYLQHIHDLQLQVRQKSHNLNRLEAQRNDLNSRVRMLREELQ  77

Query  317  LLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLH  496
            LLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITKITPSTRVALRNDSYVLH
Sbjct  78   LLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDITKITPSTRVALRNDSYVLH  137

Query  497  LILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            LILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  138  LILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  169



>emb|CDY44958.1| BnaA02g04630D [Brassica napus]
Length=721

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GVE  RPE+  EE+C+ K    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQ
Sbjct  1    MAAVGVESMRPETAMEETCNVKIAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDI KI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDINKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_011021674.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Populus 
euphratica]
Length=426

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 154/175 (88%), Gaps = 9/175 (5%)
 Frame = +2

Query  95   MATAGVEKTRPESER-------EESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHN  247
            MAT GVE+ + +          EE CSAK    +QGEGL+QYY+QHIH+LQL VRQK+HN
Sbjct  1    MATVGVERKQQQQTESTMTMIAEEGCSAKTGAARQGEGLKQYYLQHIHELQLLVRQKSHN  60

Query  248  LNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDK  427
            LNRLEAQRN LNS+VRML+EE QLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK
Sbjct  61   LNRLEAQRNGLNSRVRMLREESQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDK  120

Query  428  SIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            SIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  SIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  175



>ref|XP_006840553.1| hypothetical protein AMTR_s00045p00217520 [Amborella trichopoda]
 gb|ERN02228.1| hypothetical protein AMTR_s00045p00217520 [Amborella trichopoda]
Length=395

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +2

Query  164  MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYV  343
            +KQGEGLRQYY+QHIHDLQLQVRQKTHNLNRLEAQRN+LNSKVRML+EELQLLQEPGSYV
Sbjct  2    VKQGEGLRQYYVQHIHDLQLQVRQKTHNLNRLEAQRNDLNSKVRMLREELQLLQEPGSYV  61

Query  344  GEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDP  523
            GEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITKITPSTRVALRNDSYVLHLILPSKVDP
Sbjct  62   GEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDITKITPSTRVALRNDSYVLHLILPSKVDP  121

Query  524  LVNLMKVEKVPDSTYDMIGGLDQ  592
            LVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  122  LVNLMKVEKVPDSTYDMIGGLDQ  144



>gb|KHN39373.1| 26S protease regulatory subunit 8 like A [Glycine soja]
Length=418

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVE-KTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MA  GVE K   E   EE+CSAKP KQGEGLR YY  +IH+ QL +RQKTHNLNRLEAQR
Sbjct  1    MALVGVELKHAAEGVPEENCSAKPTKQGEGLRHYYSLNIHEHQLLLRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            N+LNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKIT
Sbjct  61   NDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>emb|CDX70903.1| BnaC03g09870D [Brassica napus]
Length=416

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 1/166 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA  G+E  RPE   EE+C+ K   QGEGL+QYY+QHI +LQ  +RQKT+NLNRLEAQRN
Sbjct  1    MAAVGIETRRPEGAMEETCNVKG-AQGEGLKQYYLQHIDELQRLLRQKTNNLNRLEAQRN  59

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            +LNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITK+TP
Sbjct  60   DLNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKLTP  119

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  165



>ref|XP_006843919.1| hypothetical protein AMTR_s00007p00269350 [Amborella trichopoda]
 gb|ERN05594.1| hypothetical protein AMTR_s00007p00269350 [Amborella trichopoda]
Length=395

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +2

Query  164  MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYV  343
            +KQGEGLRQYY+QHIHDLQLQVRQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYV
Sbjct  2    VKQGEGLRQYYLQHIHDLQLQVRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYV  61

Query  344  GEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDP  523
            GEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITKITPSTRVALRNDSYVLHLILPSKVDP
Sbjct  62   GEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDITKITPSTRVALRNDSYVLHLILPSKVDP  121

Query  524  LVNLMKVEKVPDSTYDMIGGLDQ  592
            LVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  122  LVNLMKVEKVPDSTYDMIGGLDQ  144



>ref|XP_008792112.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Phoenix 
dactylifera]
Length=427

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 153/176 (87%), Gaps = 10/176 (6%)
 Frame = +2

Query  95   MATAGVEK--------TRPESEREESCSAKPMKQG--EGLRQYYMQHIHDLQLQVRQKTH  244
            MATA VEK         R E+E E       ++ G  EGLRQYY+QHIHDLQL +RQKTH
Sbjct  1    MATAAVEKQVAAAAGDKRAEAEGEMFSPPAKVRGGGGEGLRQYYLQHIHDLQLHLRQKTH  60

Query  245  NLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVD  424
            NLNRLEAQRNELNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+D
Sbjct  61   NLNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDID  120

Query  425  KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            K+IDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  KNIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  176



>gb|KHN38098.1| 26S protease regulatory subunit 8 like A [Glycine soja]
Length=623

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVE-KTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MA  GVE K   E   EE+CSAKP KQGEGLR YY  +IH+ QL +RQKTHNLNRLEAQR
Sbjct  1    MALVGVEVKHAAEGAPEENCSAKPTKQGEGLRHYYSHNIHEHQLLLRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_002311569.2| 26S proteasome subunit 8 family protein [Populus trichocarpa]
 gb|EEE88936.2| 26S proteasome subunit 8 family protein [Populus trichocarpa]
Length=427

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 154/176 (88%), Gaps = 10/176 (6%)
 Frame = +2

Query  95   MATAGVE--------KTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTH  244
            MAT GVE        ++      EESC AK    KQGEGL+QYY+QHIH+L L VRQKTH
Sbjct  1    MATVGVERRQQQQQTESTMTMTAEESCLAKTGAAKQGEGLKQYYIQHIHELLLHVRQKTH  60

Query  245  NLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVD  424
            NLNRLEAQRN++NS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+D
Sbjct  61   NLNRLEAQRNDINSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDID  120

Query  425  KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  176



>ref|XP_011025256.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Populus 
euphratica]
Length=427

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 154/176 (88%), Gaps = 10/176 (6%)
 Frame = +2

Query  95   MATAGVE--------KTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTH  244
            MAT GVE        ++      EESC AK    KQGEGL+QYY+QHIH+L L VRQKTH
Sbjct  1    MATVGVERRQQQQQTESTMTMTAEESCLAKTGAAKQGEGLKQYYIQHIHELLLHVRQKTH  60

Query  245  NLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVD  424
            NLNRLEAQRN++NS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+D
Sbjct  61   NLNRLEAQRNDINSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDID  120

Query  425  KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  176



>ref|XP_006379809.1| hypothetical protein POPTR_0008s14310g [Populus trichocarpa]
 gb|ERP57606.1| hypothetical protein POPTR_0008s14310g [Populus trichocarpa]
Length=427

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 154/176 (88%), Gaps = 10/176 (6%)
 Frame = +2

Query  95   MATAGVE--------KTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTH  244
            MAT GVE        ++      EESC AK    KQGEGL+QYY+QHIH+L L VRQKTH
Sbjct  1    MATVGVERRQQQQQTESTMTMTAEESCLAKTGAAKQGEGLKQYYIQHIHELLLHVRQKTH  60

Query  245  NLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVD  424
            NLNRLEAQRN++NS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+D
Sbjct  61   NLNRLEAQRNDINSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDID  120

Query  425  KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  KSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  176



>ref|XP_009131763.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Brassica 
rapa]
Length=419

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM--KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  G+E  RPE   EE+C+ K    KQGEGL+QYY+QHI +LQ  +R KT+NLNRLEAQ
Sbjct  1    MAAVGIETRRPEGAMEETCNVKGAVAKQGEGLKQYYLQHIDELQRLLRHKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RN+LNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITK+
Sbjct  61   RNDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKL  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_010420827.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Camelina 
sativa]
Length=426

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 153/175 (87%), Gaps = 9/175 (5%)
 Frame = +2

Query  95   MATAGVEKTRPESER------EESCS---AKPMKQGEGLRQYYMQHIHDLQLQVRQKTHN  247
            MAT GVE  RPE  R      EE+C+   A   KQGEGL+QYY QHIH+ Q Q+R KT+N
Sbjct  1    MATVGVEARRPELARRPELAMEETCNVKGAAASKQGEGLKQYYFQHIHENQRQLRHKTNN  60

Query  248  LNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDK  427
            LNRLEAQRNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVDVDK
Sbjct  61   LNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDVDK  120

Query  428  SIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            SIDITK+ PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  SIDITKLIPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  175



>ref|XP_006400566.1| hypothetical protein EUTSA_v10013659mg [Eutrema salsugineum]
 gb|ESQ42019.1| hypothetical protein EUTSA_v10013659mg [Eutrema salsugineum]
Length=419

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKP--MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GVE   P +  EE+C+ K    KQGEGL+QYY+QHIH+ Q  +RQKT+NLNRLEAQ
Sbjct  1    MAAVGVEGRPPGTAMEETCNVKGTVAKQGEGLKQYYLQHIHENQRLLRQKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>gb|AIZ74339.1| 26S proteasome regulatory subunit [Pinus massoniana]
Length=433

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 148/160 (93%), Gaps = 5/160 (3%)
 Frame = +2

Query  113  EKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKV  292
            EK +P  E     S + +K GEGLRQYY+QHIHDLQLQVRQKTHNLNRLEAQRN+LNSKV
Sbjct  28   EKHQPPKE-----SNRMVKHGEGLRQYYLQHIHDLQLQVRQKTHNLNRLEAQRNDLNSKV  82

Query  293  RMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVAL  472
            R L+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDK+IDITKITPSTRVAL
Sbjct  83   RALREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKNIDITKITPSTRVAL  142

Query  473  RNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            RNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  143  RNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  182



>gb|AAG42150.1| 26S proteasome RPT6a subunit [Dactylis glomerata]
Length=452

 Score =   283 bits (723),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQG-EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  ++ ++P        SAK  + G EGLRQYY+QHIHDLQLQ+R KTHNLNRLEAQR
Sbjct  35   MATVAMDISKPPPAAAGDDSAKGARAGGEGLRQYYLQHIHDLQLQIRTKTHNLNRLEAQR  94

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            N+LNSKVR L+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  95   NDLNSKVRALREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKIT  154

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSY+LHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  155  PSTRVALRNDSYMLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  201



>gb|AAF27916.1|AF220199_1 26S proteasome regulatory subunit 8 [Pinus taeda]
Length=433

 Score =   282 bits (721),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  SAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEP  331
            S + +K GEGLRQYY+QHIHDLQLQVRQKTHNLNRLEAQRN+LNSKVR L+EELQLLQEP
Sbjct  36   SNRMVKHGEGLRQYYLQHIHDLQLQVRQKTHNLNRLEAQRNDLNSKVRALREELQLLQEP  95

Query  332  GSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPS  511
            GSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDK+IDITKITPSTRVALRNDSYVLHLILPS
Sbjct  96   GSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKNIDITKITPSTRVALRNDSYVLHLILPS  155

Query  512  KVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            KVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  156  KVDPLVNLMKVEKVPDSTYDMIGGLDQ  182



>ref|XP_003571095.2| PREDICTED: 26S protease regulatory subunit 8 homolog A [Brachypodium 
distachyon]
Length=418

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQG-EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  ++ + P        +AK  + G EGLRQYY+QHIHDLQLQ+RQKTHNLNRLEAQR
Sbjct  1    MATVAMDISNPLPVASGEDAAKGARGGGEGLRQYYLQHIHDLQLQIRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            N+LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSY+LHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYMLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|NP_001241552.1| uncharacterized protein LOC100812783 [Glycine max]
 gb|ACU20059.1| unknown [Glycine max]
Length=418

 Score =   281 bits (720),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVE-KTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MA  GVE K   E   E +CSAKP KQGEGLR YY  +IH+ QL +RQKTHNLNRLEAQR
Sbjct  1    MALVGVELKHAAEGVPEANCSAKPTKQGEGLRHYYSLNIHEHQLLLRQKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            N+LNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK+IDITKIT
Sbjct  61   NDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKNIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_010541726.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Tarenaya 
hassleriana]
Length=473

 Score =   283 bits (724),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 3/168 (2%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM--KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MATA V+  R E+  EE+C+AK +  KQGEGL+QYY+Q+I +LQ  +RQKTHNLNRLEAQ
Sbjct  1    MATADVDARRLEAS-EETCNAKAVAVKQGEGLKQYYLQNILELQRLLRQKTHNLNRLEAQ  59

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVDVDKSIDITKI
Sbjct  60   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDVDKSIDITKI  119

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  120  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_004287374.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Fragaria 
vesca subsp. vesca]
Length=419

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA    E    ++  EE+CS+K    K G+GLR YY+QHIH+LQLQVRQKTHNLNRLEAQ
Sbjct  1    MAAVAAETKPIDAVPEETCSSKLAASKLGDGLRPYYLQHIHELQLQVRQKTHNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVV VMGK+KVLVKVHPEGKYVVD+DK+IDITKI
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVNVMGKNKVLVKVHPEGKYVVDIDKNIDITKI  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_010049955.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Eucalyptus 
grandis]
 gb|KCW82784.1| hypothetical protein EUGRSUZ_C04160 [Eucalyptus grandis]
Length=426

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 152/175 (87%), Gaps = 9/175 (5%)
 Frame = +2

Query  95   MATAGVEKTRPE-----SEREESCSAK----PMKQGEGLRQYYMQHIHDLQLQVRQKTHN  247
            MA    +K +PE     S  E +C++       K GEGLRQYY+QH H+LQL VRQKTHN
Sbjct  1    MAATAFDKPQPELAPPPSAEEGACNSTRGPGAAKHGEGLRQYYLQHTHELQLLVRQKTHN  60

Query  248  LNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDK  427
            LNRLEAQRNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DK
Sbjct  61   LNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDK  120

Query  428  SIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            +IDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  NIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  175



>ref|XP_009408962.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Musa 
acuminata subsp. malaccensis]
Length=420

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 152/169 (90%), Gaps = 3/169 (2%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCS--AKPMKQG-EGLRQYYMQHIHDLQLQVRQKTHNLNRLEA  265
            MATA VEK +P     E C+  ++P   G EGLRQYY+QHIHDL LQ+RQKT+NL RLEA
Sbjct  1    MATAVVEKKQPMEAEGEMCAPPSRPRGGGGEGLRQYYLQHIHDLHLQIRQKTNNLQRLEA  60

Query  266  QRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITK  445
            QRN+LNS+VR L+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITK
Sbjct  61   QRNDLNSRVRALREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITK  120

Query  446  ITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            +TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  LTPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  169



>ref|XP_009381131.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Musa 
acuminata subsp. malaccensis]
Length=420

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 149/169 (88%), Gaps = 3/169 (2%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQG---EGLRQYYMQHIHDLQLQVRQKTHNLNRLEA  265
            MAT  VEK  P     E C+     +G   EGLRQYY+QHIHD QLQ+RQK++NL RLEA
Sbjct  1    MATVAVEKKHPAEAEGEMCAPAARVRGGGGEGLRQYYLQHIHDHQLQIRQKSNNLQRLEA  60

Query  266  QRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITK  445
            QRN+LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITK
Sbjct  61   QRNDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDLDKSIDITK  120

Query  446  ITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            +TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  LTPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  169



>gb|ACH63226.1| putative 26S proteasome AAA-ATPase subunit RPT6a [Rheum australe]
Length=395

 Score =   278 bits (711),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  104  AGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELN  283
            A V++ + ES  E  C+ KP K GEGLRQYY+Q IH+LQLQ+RQK +NL RLEAQRN+LN
Sbjct  2    AEVDRMQLESNSEGICATKPSKPGEGLRQYYLQRIHELQLQLRQKVNNLQRLEAQRNDLN  61

Query  284  SKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTR  463
            S+VR LKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTR
Sbjct  62   SRVRALKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTR  121

Query  464  VALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            VAL+NDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  122  VALKNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  164



>gb|AAF22526.1|AF123395_1 26S proteasome AAA-ATPase subunit RPT6a [Arabidopsis thaliana]
Length=405

 Score =   278 bits (712),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 147/153 (96%), Gaps = 2/153 (1%)
 Frame = +2

Query  140  EESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEEL  313
            EE+C+ K    KQGEGL+QYY+QHIH+LQ Q+RQKT+NLNRLEAQRNELNS+VRML+EEL
Sbjct  2    EETCNVKGAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQRNELNSRVRMLREEL  61

Query  314  QLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVL  493
            QLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSYVL
Sbjct  62   QLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYVL  121

Query  494  HLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            HL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  122  HLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  154



>ref|XP_002453516.1| hypothetical protein SORBIDRAFT_04g007170 [Sorghum bicolor]
 gb|EES06492.1| hypothetical protein SORBIDRAFT_04g007170 [Sorghum bicolor]
Length=422

 Score =   279 bits (713),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
            GEGLRQYY+QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEV
Sbjct  32   GEGLRQYYLQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEV  91

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            VKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHLILPSKVDPLVN
Sbjct  92   VKVMGKSKVLVKVHPEGKYVVDLDKSIDITKITPSTRVALRNDSYMLHLILPSKVDPLVN  151

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LMKVEKVPDSTYDMIGGLDQ
Sbjct  152  LMKVEKVPDSTYDMIGGLDQ  171



>gb|ACF88052.1| unknown [Zea mays]
 gb|AFW66096.1| hypothetical protein ZEAMMB73_419750 [Zea mays]
Length=204

 Score =   270 bits (690),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            LRQYY+QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKV
Sbjct  35   LRQYYLQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKV  94

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHLILPSKVDPLVNLMK
Sbjct  95   MGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMK  154

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLDQ
Sbjct  155  VEKVPDSTYDMIGGLDQ  171



>ref|XP_003563677.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Brachypodium 
distachyon]
Length=422

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  119  TRPESEREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVR  295
            T P  +   S +AK     GEGLRQYY QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VR
Sbjct  13   TLPGVDDPASSAAKGRAGGGEGLRQYYQQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVR  72

Query  296  MLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALR  475
            ML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALR
Sbjct  73   MLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDLDKSIDITKITPSTRVALR  132

Query  476  NDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            NDSY+LHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  133  NDSYMLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  171



>dbj|BAJ99861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92695.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS49046.1| 26S protease regulatory subunit 8-like protein A [Triticum urartu]
 gb|EMT18240.1| 26S protease regulatory subunit 8 [Aegilops tauschii]
Length=423

 Score =   276 bits (707),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 151/172 (88%), Gaps = 6/172 (3%)
 Frame = +2

Query  95   MATAGVEKTRPES-----EREESCSAKP-MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNR  256
            MA   ++  +P +     +   + SAK     GEGLRQYY+QHIHDLQLQ+R KTHNLNR
Sbjct  1    MAAVAMDIAKPSALPASVDDPSAASAKGRAGGGEGLRQYYLQHIHDLQLQIRTKTHNLNR  60

Query  257  LEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSID  436
            LEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSID
Sbjct  61   LEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDLDKSID  120

Query  437  ITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            ITKITPSTRVALRNDSY+LHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  ITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  172



>ref|XP_010925261.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Elaeis 
guineensis]
Length=428

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 152/171 (89%), Gaps = 3/171 (2%)
 Frame = +2

Query  89   EKMATAGVEKTRPESEREESCSAKPMKQGEG---LRQYYMQHIHDLQLQVRQKTHNLNRL  259
            EK A A + + +   E E   SA  ++ G G   LRQYY+QHIHDLQLQ+RQKTHNLNRL
Sbjct  7    EKQAVAAMGEKQAVVEGEMFSSAAKVRGGGGGEGLRQYYLQHIHDLQLQLRQKTHNLNRL  66

Query  260  EAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDI  439
            EAQRNELNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDI
Sbjct  67   EAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDI  126

Query  440  TKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  127  TKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  177



>ref|XP_010688096.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Beta 
vulgaris subsp. vulgaris]
Length=404

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 148/166 (89%), Gaps = 13/166 (8%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MATA VEK             K +KQGEGLRQYY+QHIH+LQL++R K+HNL RLEAQRN
Sbjct  1    MATAEVEK-------------KTVKQGEGLRQYYLQHIHELQLRIRDKSHNLQRLEAQRN  47

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VR LKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DK+IDITK+TP
Sbjct  48   ELNSRVRALKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKNIDITKLTP  107

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  108  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  153



>emb|CDX88865.1| BnaA03g07840D [Brassica napus]
Length=629

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM--KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  G+E  RPE   EE+C  K    KQGEGL+QYY+QHI +LQ  +R KT+NLNRLEAQ
Sbjct  1    MAAVGIETRRPEGAMEETCHVKGAVAKQGEGLKQYYLQHIDELQRLLRHKTNNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RN+LNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITK+
Sbjct  61   RNDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKL  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|XP_010535884.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Tarenaya 
hassleriana]
Length=418

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPE-SEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT GV+  RPE +E      A   KQGEGL+QYY+Q+I +LQ  +RQKT+NLNRLEAQR
Sbjct  1    MATVGVDARRPEGTEEACKAKAVAAKQGEGLKQYYLQNILELQRLLRQKTNNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|NP_197500.1| AAA-type ATPase family protein [Arabidopsis thaliana]
 sp|Q94BQ2.1|PRS8B_ARATH RecName: Full=26S protease regulatory subunit 8 homolog B; AltName: 
Full=26S proteasome AAA-ATPase subunit RPT6b; AltName: 
Full=26S proteasome subunit 8 homolog B; AltName: Full=Regulatory 
particle triple-A ATPase subunit 6b [Arabidopsis thaliana]
 gb|AAK64142.1| putative 26S proteasome AAA-ATPase subunit RPT6a [Arabidopsis 
thaliana]
 gb|AAL85134.1| putative 26S proteasome AAA-ATPase subunit RPT6a [Arabidopsis 
thaliana]
 gb|AAM65046.1| 26S proteasome AAA-ATPase subunit RPT6a-like protein [Arabidopsis 
thaliana]
 dbj|BAE98371.1| 26S proteasome AAA-ATPase subunit RPT6a - like protein [Arabidopsis 
thaliana]
 gb|AED92778.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=419

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 2/168 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAK--PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQ  268
            MA  GVE   P +  EE+C+ K    KQGEGL +YY+QH+ +LQ   R+K++NLNRLEAQ
Sbjct  1    MAAVGVEARPPVTAMEETCNVKGAAAKQGEGLNKYYLQHLDELQRLQREKSYNLNRLEAQ  60

Query  269  RNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKI  448
            RNELNS+VRML+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITK+
Sbjct  61   RNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKL  120

Query  449  TPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            TPSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  TPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  168



>ref|NP_001140953.1| hypothetical protein [Zea mays]
 gb|ACF85044.1| unknown [Zea mays]
 gb|ACF88222.1| unknown [Zea mays]
 gb|AFW71391.1| hypothetical protein ZEAMMB73_600751 [Zea mays]
 gb|AFW71392.1| hypothetical protein ZEAMMB73_600751 [Zea mays]
Length=422

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            LRQYY+QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKV
Sbjct  35   LRQYYLQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKV  94

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHLILPSKVDPLVNLMK
Sbjct  95   MGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMK  154

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLDQ
Sbjct  155  VEKVPDSTYDMIGGLDQ  171



>gb|ACL53562.1| unknown [Zea mays]
Length=422

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            LRQYY+QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKV
Sbjct  35   LRQYYLQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKV  94

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHLILPSKVDPLVNLMK
Sbjct  95   MGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMK  154

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLDQ
Sbjct  155  VEKVPDSTYDMIGGLDQ  171



>ref|XP_006647057.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Oryza 
brachyantha]
Length=420

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            LRQYY+QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKV
Sbjct  33   LRQYYLQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKV  92

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHLILPSKVDPLVNLMK
Sbjct  93   MGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMK  152

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLDQ
Sbjct  153  VEKVPDSTYDMIGGLDQ  169



>ref|NP_001142276.1| uncharacterized protein LOC100274445 [Zea mays]
 gb|ACF88067.1| unknown [Zea mays]
 gb|ACG38713.1| 26S protease regulatory subunit 8 [Zea mays]
 gb|AFW66095.1| 26S protease regulatory subunit 8 [Zea mays]
Length=422

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            LRQYY+QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKV
Sbjct  35   LRQYYLQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKV  94

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHLILPSKVDPLVNLMK
Sbjct  95   MGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMK  154

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLDQ
Sbjct  155  VEKVPDSTYDMIGGLDQ  171



>ref|NP_001046248.1| Os02g0205300 [Oryza sativa Japonica Group]
 dbj|BAB17626.1| 26S proteasome regulatory particle triple-A ATPase subunit6 [Oryza 
sativa Japonica Group]
 dbj|BAB19880.1| 26S proteasome ATPase subunit Rpt6 [Oryza sativa]
 dbj|BAD16017.1| 26S proteasome regulatory particle triple-A ATPase subunit6 [Oryza 
sativa Japonica Group]
 dbj|BAD38437.1| 26S proteasome regulatory particle triple-A ATPase subunit6 [Oryza 
sativa Japonica Group]
 dbj|BAF08162.1| Os02g0205300 [Oryza sativa Japonica Group]
 gb|EAY84939.1| hypothetical protein OsI_06305 [Oryza sativa Indica Group]
 gb|EAZ22161.1| hypothetical protein OsJ_05824 [Oryza sativa Japonica Group]
 dbj|BAG88097.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95480.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97646.1| unnamed protein product [Oryza sativa Japonica Group]
Length=424

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            LRQYY+QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKV
Sbjct  37   LRQYYLQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKV  96

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHLILPSKVDPLVNLMK
Sbjct  97   MGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMK  156

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLDQ
Sbjct  157  VEKVPDSTYDMIGGLDQ  173



>gb|AFW66094.1| hypothetical protein ZEAMMB73_419750 [Zea mays]
Length=477

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            LRQYY+QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKV
Sbjct  35   LRQYYLQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKV  94

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHLILPSKVDPLVNLMK
Sbjct  95   MGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMK  154

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLDQ
Sbjct  155  VEKVPDSTYDMIGGLDQ  171



>ref|XP_004951510.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Setaria 
italica]
Length=422

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            LRQYY+QHIHDLQLQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKV
Sbjct  35   LRQYYLQHIHDLQLQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKV  94

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVKVHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHL+LPSKVDPLVNLMK
Sbjct  95   MGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYMLHLVLPSKVDPLVNLMK  154

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLDQ
Sbjct  155  VEKVPDSTYDMIGGLDQ  171



>ref|XP_001778777.1| 26S proteasome regulatory complex, ATPase RPT6 [Physcomitrella 
patens]
 gb|EDQ56363.1| 26S proteasome regulatory complex, ATPase RPT6 [Physcomitrella 
patens]
Length=410

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  137  REESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQ  316
            R E    K  + GEGLR YY+ HIHDL LQ+R KTHNL+RLEAQRN+LNSKVRML+EELQ
Sbjct  3    RAEEVPNKSARSGEGLRHYYLSHIHDLLLQLRVKTHNLHRLEAQRNDLNSKVRMLREELQ  62

Query  317  LLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLH  496
            LLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDI KITP+TRVALRNDSYVLH
Sbjct  63   LLQEPGSYVGEVVKVMGKTKVLVKVHPEGKYVVDLDKSIDINKITPTTRVALRNDSYVLH  122

Query  497  LILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            LILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  123  LILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  154



>ref|XP_008457948.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cucumis 
melo]
Length=418

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM-KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  ++   PE+  EE+CSAKP  K GEGLR YY+QHI DLQLQ+R KTHNLNRLEAQR
Sbjct  1    MATMELDTKLPEAINEEACSAKPATKHGEGLRHYYLQHIQDLQLQLRLKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VR+L+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSRVRLLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>emb|CDO98106.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            LRQYY+QHIHDLQLQ+RQ+THNL RLEAQRN+LNS+VRMLKEELQLLQEPGSYVGEVVKV
Sbjct  39   LRQYYLQHIHDLQLQLRQRTHNLQRLEAQRNDLNSRVRMLKEELQLLQEPGSYVGEVVKV  98

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVKVHPEGKYVVD+DK+IDITKITPSTRVALRNDSYVLHL+LPSKVDPLVNLMK
Sbjct  99   MGKSKVLVKVHPEGKYVVDIDKNIDITKITPSTRVALRNDSYVLHLMLPSKVDPLVNLMK  158

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLDQ
Sbjct  159  VEKVPDSTYDMIGGLDQ  175



>ref|XP_004139327.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cucumis 
sativus]
 gb|KGN60651.1| hypothetical protein Csa_2G005970 [Cucumis sativus]
Length=418

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM-KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  ++   PE+  E++CSAKP  K GEGLR YY+QHI DLQLQ+R KTHNLNRLEAQR
Sbjct  1    MATMELDTKLPEAISEDTCSAKPATKHGEGLRHYYLQHIQDLQLQLRLKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VR+L+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSRVRLLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>ref|XP_004163594.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cucumis 
sativus]
Length=418

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPM-KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  ++   PE+  E++CSAKP  K GEGLR YY+QHI DLQLQ+R KTHNLNRLEAQR
Sbjct  1    MATMELDIKLPEAINEDTCSAKPATKHGEGLRHYYLQHIQDLQLQLRLKTHNLNRLEAQR  60

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELNS+VR+L+EELQLLQEPGSYVGEVVKVMGK+KVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  61   NELNSRVRLLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKIT  120

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  167



>gb|EYU24670.1| hypothetical protein MIMGU_mgv1a007142mg [Erythranthe guttata]
Length=417

 Score =   261 bits (666),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MATA +E  R +  +++         GEGLRQYY Q I D+QL VRQK H+L RLEAQRN
Sbjct  1    MATAAIETRRADELKQQHQQGAGTGGGEGLRQYYQQRIQDMQLLVRQKDHDLQRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            +LNS+VR LKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITP
Sbjct  61   DLNSRVRSLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>gb|EPS65331.1| hypothetical protein M569_09445 [Genlisea aurea]
Length=417

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MATA  E  + +              GEGLRQYY Q I D QL VRQK H+L RLEAQRN
Sbjct  1    MATAATEIRKADESSHPHHQLANSGGGEGLRQYYQQRIQDTQLLVRQKDHDLQRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            +LN +VR LKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITP
Sbjct  61   DLNGRVRSLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_011081123.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Sesamum 
indicum]
Length=417

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MATA +E  + +  +++         GEGLRQYY Q I D+QL VRQK H+L RLEAQRN
Sbjct  1    MATAAIETRQADESKQQPQQGAGAGGGEGLRQYYQQRIQDMQLLVRQKVHDLQRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            +LN++VR LKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITP
Sbjct  61   DLNARVRSLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_011072258.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Sesamum 
indicum]
Length=417

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA+A +E  + E  + +      +  GEGLRQYY Q I D+QL VRQK H+L RLEAQRN
Sbjct  1    MASAAMETRKVEDAKPQHHQGGGVGGGEGLRQYYQQRIQDMQLLVRQKVHDLQRLEAQRN  60

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            +LN +VR LKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKITP
Sbjct  61   DLNGRVRSLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITP  120

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  121  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  166



>ref|XP_006656207.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Oryza 
brachyantha]
Length=427

 Score =   254 bits (648),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  SAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEP  331
             +K   +GEGLR YY+Q I DLQLQ+R +T NL+RLEAQRN+LNS+VRM++EELQLL EP
Sbjct  30   GSKGRSRGEGLRLYYLQRIQDLQLQIRHETDNLSRLEAQRNDLNSRVRMMREELQLLYEP  89

Query  332  GSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPS  511
            GSYVGEVVKVMGKSKVLVKVHPEGK+VVD+DK+IDITK+TPSTRVALRNDSY LHLILPS
Sbjct  90   GSYVGEVVKVMGKSKVLVKVHPEGKFVVDIDKNIDITKLTPSTRVALRNDSYKLHLILPS  149

Query  512  KVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            KVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  150  KVDPLVNLMKVEKVPDSTYDMIGGLDQ  176



>gb|EYU21600.1| hypothetical protein MIMGU_mgv1a006333mg [Erythranthe guttata]
Length=448

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  92   KMATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            +MATA VE  + E              GEGLRQYY Q I D+QL  RQK H+L RLEAQR
Sbjct  59   EMATAAVENRQVEDPTAHRQQGGGAGGGEGLRQYYQQRIQDMQLLARQKNHDLQRLEAQR  118

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            N LN++VR LKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  119  NNLNARVRSLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKIT  178

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  179  PSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  225



>ref|XP_010670712.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Beta 
vulgaris subsp. vulgaris]
Length=411

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 140/166 (84%), Gaps = 6/166 (4%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MATA  E+  P      +        G+GLRQYY++ I+ L+   RQKT +L+RLEA RN
Sbjct  1    MATALTERNTP------ATMGGSTTHGDGLRQYYLKRINGLEHLHRQKTLDLSRLEAHRN  54

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELNS+VRMLKEEL LLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITK+TP
Sbjct  55   ELNSQVRMLKEELMLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKLTP  114

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            STRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  115  STRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  160



>ref|XP_002970508.1| hypothetical protein SELMODRAFT_441130 [Selaginella moellendorffii]
 ref|XP_002978590.1| hypothetical protein SELMODRAFT_177014 [Selaginella moellendorffii]
 gb|EFJ20576.1| hypothetical protein SELMODRAFT_177014 [Selaginella moellendorffii]
 gb|EFJ28638.1| hypothetical protein SELMODRAFT_441130 [Selaginella moellendorffii]
Length=395

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
            GEG   YY   IHD   Q+R K +NL RLEAQRN+LNSKVRML+EELQLLQEPGSYVGEV
Sbjct  5    GEGFHDYYTSRIHDASQQLRIKGNNLARLEAQRNDLNSKVRMLREELQLLQEPGSYVGEV  64

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            VKVMGKSKVLVKVHPEGKYVVDVDKSID++KITP+TRVALRNDSYVLHLILPSKVDPLVN
Sbjct  65   VKVMGKSKVLVKVHPEGKYVVDVDKSIDMSKITPTTRVALRNDSYVLHLILPSKVDPLVN  124

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LMKVEKVPDSTYDMIGGLDQ
Sbjct  125  LMKVEKVPDSTYDMIGGLDQ  144



>gb|EMS56105.1| 26S protease regulatory subunit 8-like protein A [Triticum urartu]
Length=405

 Score =   245 bits (626),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 139/167 (83%), Gaps = 14/167 (8%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQG-EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MAT  ++ ++P        +AK  + G EGL             Q+RQKTHNLNRLEAQR
Sbjct  1    MATVAMDISKPPPAASGDEAAKGARGGGEGL-------------QIRQKTHNLNRLEAQR  47

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            N+LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVD+DKSIDITKIT
Sbjct  48   NDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKIT  107

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSTRVALRNDSY+LHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ
Sbjct  108  PSTRVALRNDSYMLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  154



>ref|NP_001057999.1| Os06g0600100 [Oryza sativa Japonica Group]
 dbj|BAD32833.1| putative 26S proteasome regulatory particle triple-A ATPase subunit6 
[Oryza sativa Japonica Group]
 dbj|BAD32954.1| putative 26S proteasome regulatory particle triple-A ATPase subunit6 
[Oryza sativa Japonica Group]
 dbj|BAF19913.1| Os06g0600100 [Oryza sativa Japonica Group]
 dbj|BAG89590.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65971.1| hypothetical protein OsJ_21883 [Oryza sativa Japonica Group]
Length=423

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +G+GLR YY   IHDLQLQ+RQ T NL+RLEAQRN LNS+V  L EEL++L EPGSYVGE
Sbjct  32   RGDGLRPYYQSRIHDLQLQIRQGTDNLSRLEAQRNVLNSQVITLGEELKVLHEPGSYVGE  91

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITK++PSTRVALRNDSY+LHLILPSKVDPLV
Sbjct  92   VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKLSPSTRVALRNDSYMLHLILPSKVDPLV  151

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            NLMKVEKVPDSTYDMIGGLDQ
Sbjct  152  NLMKVEKVPDSTYDMIGGLDQ  172



>gb|EMT18785.1| 26S protease regulatory subunit 8 [Aegilops tauschii]
Length=378

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  221  LQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPE  400
            LQ+RQKTHNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVKVHPE
Sbjct  4    LQIRQKTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPE  63

Query  401  GKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIG  580
            GKYVVD+DKSIDITKITPSTRVALRNDSY+LHL+LPSKVDPLVNLMKVEKVPDSTYDMIG
Sbjct  64   GKYVVDIDKSIDITKITPSTRVALRNDSYMLHLVLPSKVDPLVNLMKVEKVPDSTYDMIG  123

Query  581  GLDQ  592
            GLDQ
Sbjct  124  GLDQ  127



>gb|EEC80919.1| hypothetical protein OsI_23597 [Oryza sativa Indica Group]
Length=423

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +G+GLR YY   IHDL+LQ+RQ T NL+RLEAQRN LNS+V  L EEL++L EPGSYVGE
Sbjct  32   RGDGLRPYYQSRIHDLELQIRQGTDNLSRLEAQRNVLNSQVITLGEELKVLHEPGSYVGE  91

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITK++PSTRVALRNDSY+LHLILPSKVDPLV
Sbjct  92   VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKLSPSTRVALRNDSYMLHLILPSKVDPLV  151

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            NLMKVEKVPDSTYDMIGGLDQ
Sbjct  152  NLMKVEKVPDSTYDMIGGLDQ  172



>ref|XP_002437236.1| hypothetical protein SORBIDRAFT_10g023320 [Sorghum bicolor]
 gb|EER88603.1| hypothetical protein SORBIDRAFT_10g023320 [Sorghum bicolor]
Length=419

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  95   MATAGVEKTRPES---EREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEA  265
            MAT  ++  +P +      E+ +AK    GEGL +YY QHI DL L V+Q+  +L+RLEA
Sbjct  1    MATVSMDIPKPSALTAAGHEAATAKTRGGGEGLGKYYNQHIQDLLLAVQQRISDLSRLEA  60

Query  266  QRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITK  445
            QRN+LNS+V+M +EEL LLQEPGS+VGEVVKVM KSKVLVKVHPEGKY+VDVDKSIDI K
Sbjct  61   QRNDLNSQVKMCREELHLLQEPGSHVGEVVKVMSKSKVLVKVHPEGKYIVDVDKSIDIAK  120

Query  446  ITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            +TPSTRVALR+ SY+LH+ILPSKVDPLVNLMKVEKVP+STYDMIGGLDQ
Sbjct  121  LTPSTRVALRSGSYMLHVILPSKVDPLVNLMKVEKVPNSTYDMIGGLDQ  169



>gb|AAP80641.1|AF475120_1 26S proteasome ATPase subunit [Triticum aestivum]
Length=287

 Score =   234 bits (596),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 1/128 (1%)
 Frame = +2

Query  212  DLQLQV-RQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVK  388
            DLQLQ     THNLNRLEAQRN+LNS+VRML+EELQLLQEPGSYVGEVVKVMGKSKVLVK
Sbjct  3    DLQLQXPXPXTHNLNRLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVK  62

Query  389  VHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTY  568
            VHPEGKYVVD+DKSIDITKITPSTRVALRNDSY+LHLILPSKVDPLVNLMKVEKVPDSTY
Sbjct  63   VHPEGKYVVDLDKSIDITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMKVEKVPDSTY  122

Query  569  DMIGGLDQ  592
            DMIGGLDQ
Sbjct  123  DMIGGLDQ  130



>ref|XP_002951010.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
 gb|EFJ47904.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
Length=396

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
            GEGL+ YY   I +L+LQV+ KTHNL RLEAQRNELNS+VRMLKEE+QLLQEPGSYVGEV
Sbjct  6    GEGLKGYYRAKIEELELQVKDKTHNLRRLEAQRNELNSQVRMLKEEIQLLQEPGSYVGEV  65

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            +K+MGK+KVLVKVHPEGKYVVD+DK I I K+ P  RVALRNDSY LHL+LP+KVDPLV+
Sbjct  66   IKLMGKNKVLVKVHPEGKYVVDIDKDISIDKLNPGARVALRNDSYTLHLVLPTKVDPLVS  125

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LMKVEKVPDSTYDMIGG DQ
Sbjct  126  LMKVEKVPDSTYDMIGGADQ  145



>gb|KIZ02012.1| 26S proteasome regulatory subunit T6, partial [Monoraphidium 
neglectum]
Length=539

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            KQ EGL   + Q +  L+L V+++THNL RLEAQRNELN++VR L+EELQLLQEPGSYVG
Sbjct  391  KQQEGLTWVFQQKVEQLELLVKERTHNLRRLEAQRNELNTQVRQLREELQLLQEPGSYVG  450

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EV+KVMGKSKVLVKVHPEGKYVVD+DKSID  K+TP  RVALR+DSY LH++LP+KVDPL
Sbjct  451  EVIKVMGKSKVLVKVHPEGKYVVDLDKSIDAGKLTPGARVALRSDSYTLHILLPTKVDPL  510

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LMKVEKVPDSTYDMIGGLDQ
Sbjct  511  VSLMKVEKVPDSTYDMIGGLDQ  532



>tpg|DAA34390.1| TPA_inf: 26S proteasome regulatory complex ATPase RPT6 [Amblyomma 
variegatum]
Length=225

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 135/167 (81%), Gaps = 6/167 (4%)
 Frame = +2

Query  95   MATAG-VEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQR  271
            MA AG VE + P     ++ S     +G+GL+QYY+  I +LQL V  KT NL RL+AQR
Sbjct  1    MAAAGAVESSAPVKMEVDAPS-----KGDGLKQYYITKIEELQLVVSDKTQNLRRLQAQR  55

Query  272  NELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKIT  451
            NELN+KVRML+EELQLLQE GSYVGEVVK M K KVLVKVHPEGK+VVD+DK+IDI  +T
Sbjct  56   NELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDIANVT  115

Query  452  PSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            P++RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+M+GGLD+
Sbjct  116  PNSRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDK  162



>gb|EWM22455.1| 26s protease regulatory subunit 8 [Nannochloropsis gaditana]
Length=435

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 138/184 (75%), Gaps = 11/184 (6%)
 Frame = +2

Query  47   FAVELSPET*NQESEKMATAGVEKTRPESEREESCSAKPMKQGE--GLRQYYMQHIHDLQ  220
            F  ELS     +    MATA V  +RP           P   GE  G+R YY+  I +L+
Sbjct  11   FRRELSNCAYLRGGTDMATAKVMSSRPTG---------PTTSGEDKGVRSYYLSKIDELE  61

Query  221  LQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPE  400
            + VR++T NL RL+AQRNE N+KVR+L+EEL  LQEPGSYVGEVVK MGK+KVLVKV+PE
Sbjct  62   VVVRERTQNLQRLKAQRNEWNAKVRLLREELHHLQEPGSYVGEVVKAMGKTKVLVKVNPE  121

Query  401  GKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIG  580
            GKYVVD+DK +DITK TP+TRVALRNDSY LH ILP+KVDPLV+LMKVE VPDSTYDMIG
Sbjct  122  GKYVVDLDKDVDITKCTPNTRVALRNDSYTLHKILPTKVDPLVSLMKVEAVPDSTYDMIG  181

Query  581  GLDQ  592
            GLD+
Sbjct  182  GLDK  185



>ref|XP_002501348.1| proteasomal ATPase [Micromonas sp. RCC299]
 gb|ACO62606.1| proteasomal ATPase [Micromonas sp. RCC299]
Length=399

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
            G+GLR YY   I + ++ VR KT NL RLEAQRNELN KVRML+EE+QLLQEPGSYVGEV
Sbjct  12   GDGLRSYYRAKIEEYEVAVRDKTQNLRRLEAQRNELNHKVRMLREEIQLLQEPGSYVGEV  71

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            VKVMGK+KVLVKVHPEGKYVVDV K I+I K++   RVAL+NDSY LHL+LPS VDPLV+
Sbjct  72   VKVMGKTKVLVKVHPEGKYVVDVAKDIEIEKLSTGQRVALKNDSYTLHLVLPSLVDPLVS  131

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LMKVEKVPDST+DMIGGLDQ
Sbjct  132  LMKVEKVPDSTFDMIGGLDQ  151



>ref|NP_001279851.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Callorhinchus 
milii]
 gb|AFM85802.1| 26S protease regulatory subunit 8-like isoform 2 [Callorhinchus 
milii]
 gb|AFM90117.1| 26S protease regulatory subunit 8-like isoform 2 [Callorhinchus 
milii]
Length=406

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 129/161 (80%), Gaps = 6/161 (4%)
 Frame = +2

Query  110  VEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSK  289
            V  +R + E EE       K G GLRQYY+  I +LQL V  K+ NL RL+AQRNELN+K
Sbjct  2    VADSRAQMEVEEG------KGGTGLRQYYLSKIEELQLTVNDKSQNLRRLQAQRNELNAK  55

Query  290  VRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVA  469
            VRML+EELQLLQE GSYVGEVV+ M K KVLVKVHPEGK+VVDVDK+IDI  +TP+ RVA
Sbjct  56   VRMLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVA  115

Query  470  LRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            LRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+
Sbjct  116  LRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDK  156



>gb|EFX79350.1| hypothetical protein DAPPUDRAFT_52572 [Daphnia pulex]
Length=399

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = +2

Query  152  SAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEP  331
            +A P  +GEGLRQYY+  I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE 
Sbjct  5    AASP--KGEGLRQYYITKIEELQLVVAEKAQNLRRLQAQRNELNAKVRMLREELQLLQEQ  62

Query  332  GSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPS  511
            GSYVGEVVK M K KVLVKVHPEGK+VVD+DK+IDI  I P+ RVALRNDSY LH ILPS
Sbjct  63   GSYVGEVVKAMDKKKVLVKVHPEGKFVVDIDKNIDINDIKPNCRVALRNDSYTLHKILPS  122

Query  512  KVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            KVDPLV+LM VEKVPDSTY+M+GGLD+
Sbjct  123  KVDPLVSLMMVEKVPDSTYEMVGGLDK  149



>gb|KFM60482.1| 26S protease regulatory subunit 8, partial [Stegodyphus mimosarum]
Length=415

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEGL+QYY+  I +LQL V +KT NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  25   KGEGLKQYYITKIEELQLIVSEKTQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  84

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRNDSY LH ILP+KVDPLV
Sbjct  85   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNDSYTLHKILPNKVDPLV  144

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  145  SLMMVEKVPDSTYEMVGGLDK  165



>gb|AFM89751.1| 26S protease regulatory subunit 8-like protein [Callorhinchus 
milii]
Length=406

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            K G GLRQYY+  I +LQL V  K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  15   KGGTGLRQYYLSKIEELQLTVNDKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  74

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVV+ M K KVLVKVHPEGK+VVDVDK+IDI  +TP+ RVALRNDSY LH ILP+KVDPL
Sbjct  75   EVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPL  134

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+MIGGLD+
Sbjct  135  VSLMMVEKVPDSTYEMIGGLDK  156



>gb|AFU72269.1| proteasome 26S subunit, partial [Solen grandis]
Length=244

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +2

Query  161  PMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSY  340
            P    EG++QYY   I  LQL V  KT NL RLEAQRNELN+KVRML+EELQLLQE GSY
Sbjct  12   PPPNHEGIKQYYGSKIETLQLVVTDKTQNLRRLEAQRNELNAKVRMLREELQLLQEQGSY  71

Query  341  VGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVD  520
            VGEVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRNDSY LH ILP+KVD
Sbjct  72   VGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVD  131

Query  521  PLVNLMKVEKVPDSTYDMIGGLDQ  592
            PLV+LM VEKVPDSTY+M+GGLD+
Sbjct  132  PLVSLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_004965964.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Setaria 
italica]
Length=420

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
            G+GL +YY Q IHD+ L + QK  +L R EAQRN +NS+V+  ++EL+LLQEP S+VGEV
Sbjct  30   GKGLERYYKQQIHDVDLGLLQKIKDLRRQEAQRNVINSRVKFCRDELRLLQEPASHVGEV  89

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            VKVM KSKVLVKVHPEGKY+VDVDKSIDI K+ PSTRVALR+ SY+LH+ILPSKVDPLVN
Sbjct  90   VKVMSKSKVLVKVHPEGKYIVDVDKSIDIAKLMPSTRVALRSGSYMLHVILPSKVDPLVN  149

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LMKVEKVPDSTYDMIGGLDQ
Sbjct  150  LMKVEKVPDSTYDMIGGLDQ  169



>ref|XP_004535085.1| PREDICTED: 26S protease regulatory subunit 8-like [Ceratitis 
capitata]
 ref|XP_011179924.1| PREDICTED: 26S protease regulatory subunit 8 [Bactrocera cucurbitae]
 ref|XP_011198519.1| PREDICTED: 26S protease regulatory subunit 8 [Bactrocera dorsalis]
Length=404

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  14   KGEGFRSYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  73

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPLV
Sbjct  74   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLV  133

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  134  SLMMVEKVPDSTYEMVGGLDK  154



>ref|XP_003740119.1| PREDICTED: 26S protease regulatory subunit 8-like [Metaseiulus 
occidentalis]
Length=412

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            K+ EGL+QY++  I +LQL V +KT NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  21   KEREGLKQYFITKIEELQLVVAEKTQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  80

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+ID++++TP+ RVALRNDSY LH ILP+KVDPL
Sbjct  81   EVVKPMDKKKVLVKVHPEGKFVVDIDKNIDMSQVTPNCRVALRNDSYTLHKILPNKVDPL  140

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  141  VSLMMVEKVPDSTYEMVGGLDK  162



>ref|XP_005181458.1| PREDICTED: 26S protease regulatory subunit 8 [Musca domestica]
Length=404

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  14   KGEGFRSYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  73

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPLV
Sbjct  74   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLV  133

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  134  SLMMVEKVPDSTYEMVGGLDK  154



>ref|XP_001649429.1| AAEL014723-PA [Aedes aegypti]
 ref|XP_001663850.1| AAEL013676-PA [Aedes aegypti]
 gb|EAT33024.1| AAEL014723-PA [Aedes aegypti]
 gb|EAT34058.1| AAEL013676-PA [Aedes aegypti]
Length=403

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            ++GEG R YY+Q I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  12   QKGEGFRSYYIQKIEELQLIVAEKNQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  71

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPL
Sbjct  72   EVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPL  131

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  132  VSLMMVEKVPDSTYEMVGGLDK  153



>ref|XP_009077704.1| PREDICTED: 26S protease regulatory subunit 8 [Acanthisitta chloris]
Length=398

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            K G GLRQYY+  I +LQL V +K+ NL RL+AQRNELN+KVR+L+EE QLLQE GSYVG
Sbjct  7    KGGSGLRQYYLSKIEELQLIVNEKSQNLRRLQAQRNELNAKVRLLREERQLLQEQGSYVG  66

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVV+ M K KVLVKVHPEGK+VVDVDK+IDI  +TP+ RVALRNDSY LH ILP+KVDPL
Sbjct  67   EVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPL  126

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+MIGGLD+
Sbjct  127  VSLMMVEKVPDSTYEMIGGLDK  148



>ref|XP_001870728.1| 26S protease regulatory subunit 8 [Culex quinquefasciatus]
 gb|EDS34089.1| 26S protease regulatory subunit 8 [Culex quinquefasciatus]
Length=402

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            ++GEG R YY+Q I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  11   QKGEGFRSYYIQKIEELQLIVAEKNQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  70

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPL
Sbjct  71   EVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPL  130

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  131  VSLMMVEKVPDSTYEMVGGLDK  152



>ref|XP_001991849.1| GH11847 [Drosophila grimshawi]
 gb|EDW00474.1| GH11847 [Drosophila grimshawi]
Length=405

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            ++GEG R YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  14   QKGEGFRSYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  73

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPL
Sbjct  74   EVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPL  133

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  134  VSLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_001967051.1| GF21725 [Drosophila ananassae]
 gb|EDV38370.1| GF21725 [Drosophila ananassae]
Length=405

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            ++GEG R YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  14   QKGEGFRSYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  73

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPL
Sbjct  74   EVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPL  133

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  134  VSLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_001355733.1| GA13327 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL32792.1| GA13327 [Drosophila pseudoobscura pseudoobscura]
Length=405

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            ++GEG R YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  14   QKGEGFRSYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  73

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPL
Sbjct  74   EVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPL  133

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  134  VSLMMVEKVPDSTYEMVGGLDK  155



>gb|ETN68121.1| 26S protease regulatory subunit [Anopheles darlingi]
Length=403

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            ++GEG R YY+Q I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  12   QRGEGFRSYYVQKIEELQLIVAEKNQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  71

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPL
Sbjct  72   EVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPL  131

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  132  VSLMMVEKVPDSTYEMVGGLDK  153



>ref|XP_002055458.1| GJ19383 [Drosophila virilis]
 gb|EDW65659.1| GJ19383 [Drosophila virilis]
Length=405

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            ++GEG R YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  14   QKGEGFRSYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  73

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPL
Sbjct  74   EVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPL  133

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  134  VSLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_001641587.1| predicted protein [Nematostella vectensis]
 gb|EDO49524.1| predicted protein [Nematostella vectensis]
Length=398

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            KQ EG++QYY+  I +LQL V +K  NL RLEAQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  7    KQHEGIQQYYITKIEELQLVVTEKIKNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVG  66

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK ID+ ++TP+ RVALRNDSY LH ILP+KVDPL
Sbjct  67   EVVKPMDKKKVLVKVHPEGKFVVDIDKGIDMAEVTPNCRVALRNDSYTLHKILPNKVDPL  126

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  127  VSLMMVEKVPDSTYEMVGGLDK  148



>ref|XP_010082942.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 
8, partial [Pterocles gutturalis]
Length=387

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            K G GLRQYY+  I +LQL V +K+ NL RL+AQRNELN+KVR+ +EELQLLQE GSYVG
Sbjct  7    KGGTGLRQYYLSKIEELQLIVNEKSQNLRRLQAQRNELNAKVRLRREELQLLQEQGSYVG  66

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVV+ M K KVLVKVHPEGK+VVDVDK+IDI  +TP+ RVALRNDSY LH ILP+KVDPL
Sbjct  67   EVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPL  126

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+MIGGLD+
Sbjct  127  VSLMMVEKVPDSTYEMIGGLDK  148



>ref|XP_011435912.1| PREDICTED: 26S protease regulatory subunit 8 [Crassostrea gigas]
Length=407

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            EG++QYY+  I +LQL V  KT NL RLEAQRNELN+KVRML+EELQLLQE GSYVGEVV
Sbjct  19   EGIKQYYISKIEELQLVVTDKTQNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVV  78

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRNDSY LH ILP+KVDPLV+L
Sbjct  79   KPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSL  138

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+M+GGLD+
Sbjct  139  MMVEKVPDSTYEMVGGLDK  157



>ref|XP_009047076.1| hypothetical protein LOTGIDRAFT_138721 [Lottia gigantea]
 gb|ESP02249.1| hypothetical protein LOTGIDRAFT_138721 [Lottia gigantea]
Length=397

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            EG++QYY+  I + QL V +KT NL RLEAQRNELN+KVRML+EELQLLQE GSYVGEVV
Sbjct  9    EGIKQYYVSKIEEQQLIVTEKTQNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVV  68

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRNDSYVLH ILP+KVDPLV+L
Sbjct  69   KPMDKKKVLVKVHPEGKFVVDIDKNIDINSVTPNCRVALRNDSYVLHKILPNKVDPLVSL  128

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+M+GGLD+
Sbjct  129  MMVEKVPDSTYEMVGGLDK  147



>gb|KFB40364.1| AGAP007243-PA-like protein [Anopheles sinensis]
Length=397

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+Q I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  7    RGEGFRSYYVQKIEELQLIVAEKNQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  66

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPLV
Sbjct  67   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLV  126

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  127  SLMMVEKVPDSTYEMVGGLDK  147



>ref|XP_007509172.1| 26S protease regulatory subunit 8 [Bathycoccus prasinos]
 emb|CCO19629.1| 26S protease regulatory subunit 8 [Bathycoccus prasinos]
Length=406

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            GL+ ++   +  L++ VR  T NL RLEAQRNELNS+VR LKEEL LLQEPGSY+GEVVK
Sbjct  18   GLKPFFKGKVEALEIAVRDGTQNLRRLEAQRNELNSRVRALKEELSLLQEPGSYIGEVVK  77

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
            VMGK+KVLVK HP+GKYVVD D+SID+ K+TP  RVAL+NDSY LH ILPS +DPLV+LM
Sbjct  78   VMGKTKVLVKAHPDGKYVVDFDRSIDLAKLTPGVRVALKNDSYALHYILPSMIDPLVSLM  137

Query  539  KVEKVPDSTYDMIGGLDQ  592
            KVEKVPDST+DMIGGLDQ
Sbjct  138  KVEKVPDSTFDMIGGLDQ  155



>ref|XP_009494505.1| 26S protease regulatory subunit 8 [Fonticula alba]
 gb|KCV71382.1| 26S protease regulatory subunit 8 [Fonticula alba]
Length=416

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            L  Y+   I DLQ+ + +KT NL RLEAQRNELNSKVR L+EELQLLQEPGSYVGEVVKV
Sbjct  26   LAAYFRSRIEDLQVAIHEKTQNLRRLEAQRNELNSKVRSLREELQLLQEPGSYVGEVVKV  85

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MG  +VLVKVHPEGKY+V VDK+IDI+ +T +TRVALRNDSY LH ILP+K+DPLV+LM 
Sbjct  86   MGSDRVLVKVHPEGKYLVKVDKAIDISTLTATTRVALRNDSYTLHKILPNKIDPLVSLMM  145

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLD+
Sbjct  146  VEKVPDSTYDMIGGLDK  162



>ref|XP_308557.2| AGAP007243-PA [Anopheles gambiae str. PEST]
 gb|EAA04200.3| AGAP007243-PA [Anopheles gambiae str. PEST]
Length=403

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  137  REESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQ  316
            RE S       +GEG R Y++Q I +LQL V +K  NL RL+AQRNELN+KVRML+EELQ
Sbjct  2    RETSTMDVDPPRGEGFRSYFVQKIEELQLIVAEKNQNLRRLQAQRNELNAKVRMLREELQ  61

Query  317  LLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLH  496
            LLQE GSYVGEVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH
Sbjct  62   LLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLH  121

Query  497  LILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
             ILP+KVDPLV+LM VEKVPDSTY+M+GGLD+
Sbjct  122  KILPNKVDPLVSLMMVEKVPDSTYEMVGGLDK  153



>ref|XP_001978679.1| GG19719 [Drosophila erecta]
 ref|XP_002039625.1| GM23074 [Drosophila sechellia]
 ref|XP_002101976.1| GE17917 [Drosophila yakuba]
 ref|XP_002107540.1| GD17527 [Drosophila simulans]
 gb|EDV47606.1| GG19719 [Drosophila erecta]
 gb|EDW56367.1| GM23074 [Drosophila sechellia]
 gb|EDX03084.1| GE17917 [Drosophila yakuba]
 gb|EDX18526.1| GD17527 [Drosophila simulans]
Length=405

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            ++GEG R YY+Q I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  14   QKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  73

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPL
Sbjct  74   EVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPL  133

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  134  VSLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_001608055.1| PREDICTED: 26S protease regulatory subunit 8 [Nasonia vitripennis]
Length=405

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_002067234.1| GK16292 [Drosophila willistoni]
 gb|EDW78220.1| GK16292 [Drosophila willistoni]
Length=405

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            ++GEG R YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVG
Sbjct  14   QKGEGFRSYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVG  73

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK M K KVLVKVHPEGK+VVD+DK+IDI  + P+ RVALRN+SY LH ILP+KVDPL
Sbjct  74   EVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVAPNCRVALRNESYTLHKILPNKVDPL  133

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGLD+
Sbjct  134  VSLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_003062429.1| proteasomal ATPase [Micromonas pusilla CCMP1545]
 gb|EEH53248.1| proteasomal ATPase [Micromonas pusilla CCMP1545]
Length=402

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = +2

Query  152  SAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEP  331
            +++P K  +GLR YY   I + ++ VR KT NL RLEAQRNELN KVRML+EE+QLLQEP
Sbjct  7    TSQPAK--DGLRGYYSAKIEEYEIAVRDKTQNLRRLEAQRNELNHKVRMLREEIQLLQEP  64

Query  332  GSYVGEVVKVMGKSKVLVK---VHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLI  502
            GSYVGEVVKVMGK+KVL K   VHPEGKYVVD+ K IDI  +T   RVAL+NDSY LHLI
Sbjct  65   GSYVGEVVKVMGKTKVLCKARLVHPEGKYVVDIAKDIDINTLTTGARVALKNDSYALHLI  124

Query  503  LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            LPS VDPLV+LMKVEKVPDST+DMIGGLD+
Sbjct  125  LPSLVDPLVSLMKVEKVPDSTFDMIGGLDE  154



>ref|XP_011497497.1| PREDICTED: 26S protease regulatory subunit 8 [Ceratosolen solmsi 
marchali]
Length=405

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|NP_608447.1| regulatory particle triple-A ATPase 6 [Drosophila melanogaster]
 sp|O18413.2|PRS8_DROME RecName: Full=26S protease regulatory subunit 8 [Drosophila melanogaster]
 gb|AAC63219.1| Pros45 proteosome subunit homolog [Drosophila melanogaster]
 gb|AAF50835.1| regulatory particle triple-A ATPase 6 [Drosophila melanogaster]
 gb|AAK93156.1| LD26005p [Drosophila melanogaster]
 gb|ACL85442.1| Pros45-PA, partial [synthetic construct]
 gb|ACL90320.1| Pros45-PA [synthetic construct]
Length=405

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+Q I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_008545433.1| PREDICTED: 26S protease regulatory subunit 8 [Microplitis demolitor]
Length=405

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG +QYY+  I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKQYYITKIEELQLIVSEKGQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_005091123.1| PREDICTED: 26S protease regulatory subunit 8-like [Aplysia californica]
Length=397

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +G++QYY+  I +LQL V + T NL RLEAQRNELN+KVRML+EELQLLQE GSYVGEVV
Sbjct  9    QGIKQYYVSKIEELQLVVTEGTQNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVV  68

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKVHPEGK+VVD+DK+ID+ ++TP+ RVALRNDSYVLH ILP+KVDPLV+L
Sbjct  69   KPMDKKKVLVKVHPEGKFVVDIDKNIDMNQVTPNCRVALRNDSYVLHKILPNKVDPLVSL  128

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+M+GGLD+
Sbjct  129  MMVEKVPDSTYEMVGGLDK  147



>ref|XP_003702455.1| PREDICTED: 26S protease regulatory subunit 8-like [Megachile 
rotundata]
Length=405

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  164  MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYV  343
            + +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYV
Sbjct  13   IAKGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYV  72

Query  344  GEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDP  523
            GEVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDP
Sbjct  73   GEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKVDP  132

Query  524  LVNLMKVEKVPDSTYDMIGGLDQ  592
            LV+LM VEKVPDSTY+M+GGLD+
Sbjct  133  LVSLMMVEKVPDSTYEMVGGLDK  155



>gb|KDR20973.1| hypothetical protein L798_04485, partial [Zootermopsis nevadensis]
Length=399

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG RQYY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  9    KGEGFRQYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  68

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +T ++RVALRN+SY LH ILP+KVDPLV
Sbjct  69   VVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTANSRVALRNESYTLHKILPNKVDPLV  128

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  129  SLMMVEKVPDSTYEMVGGLDK  149



>ref|XP_006564449.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Apis 
mellifera]
 ref|XP_006564450.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Apis 
mellifera]
 ref|XP_006564451.1| PREDICTED: 26S protease regulatory subunit 8 isoform X3 [Apis 
mellifera]
 ref|XP_006564452.1| PREDICTED: 26S protease regulatory subunit 8 isoform X4 [Apis 
mellifera]
 ref|XP_006615913.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X1 
[Apis dorsata]
 ref|XP_006615914.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X2 
[Apis dorsata]
 ref|XP_006615915.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X3 
[Apis dorsata]
 ref|XP_006615916.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X4 
[Apis dorsata]
Length=405

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_011059922.1| PREDICTED: 26S protease regulatory subunit 8 [Acromyrmex echinatior]
 ref|XP_011168568.1| PREDICTED: 26S protease regulatory subunit 8 [Solenopsis invicta]
Length=405

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_011341411.1| PREDICTED: 26S protease regulatory subunit 8 [Cerapachys biroi]
Length=405

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_003398987.1| PREDICTED: 26S protease regulatory subunit 8-like [Bombus terrestris]
 ref|XP_003485515.1| PREDICTED: 26S protease regulatory subunit 8-like [Bombus impatiens]
Length=405

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_011260528.1| PREDICTED: 26S protease regulatory subunit 8 [Camponotus floridanus]
Length=405

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_003698467.1| PREDICTED: 26S protease regulatory subunit 8-like [Apis florea]
Length=414

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_006814082.1| PREDICTED: 26S protease regulatory subunit 8-like [Saccoglossus 
kowalevskii]
Length=381

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            EG++QYY+  I +LQL V  KT NL RL+AQRNELN+KVRML+EELQLLQE GSYVGEVV
Sbjct  22   EGIKQYYIAKIEELQLVVTDKTQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVV  81

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKVHPEGK+VVD+DK+ID+  +TP+ RVALRNDSY LH ILP+KVDPLV+L
Sbjct  82   KPMDKKKVLVKVHPEGKFVVDIDKNIDMGDVTPNCRVALRNDSYTLHKILPNKVDPLVSL  141

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+M+GGLD+
Sbjct  142  MMVEKVPDSTYEMVGGLDK  160



>ref|XP_008487286.1| PREDICTED: 26S protease regulatory subunit 8-like, partial [Diaphorina 
citri]
Length=283

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  164  MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYV  343
            +K  EG + YY+  I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYV
Sbjct  11   IKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYV  70

Query  344  GEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDP  523
            GEVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDP
Sbjct  71   GEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDP  130

Query  524  LVNLMKVEKVPDSTYDMIGGLD  589
            LV+LM VEKVPDSTY+M+GGLD
Sbjct  131  LVSLMMVEKVPDSTYEMVGGLD  152



>ref|XP_002588921.1| hypothetical protein BRAFLDRAFT_125428 [Branchiostoma floridae]
 gb|EEN44932.1| hypothetical protein BRAFLDRAFT_125428 [Branchiostoma floridae]
Length=405

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            EG++ Y+   I  L+L+V ++T NL RLEAQRNELN+KVRML+EELQLLQE GSYVGEVV
Sbjct  17   EGIQLYFQNKIEGLELEVAERTQNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVV  76

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKVHPEGK+VVDVDK+IDI  +TP+ RVALRNDSY LH ILP+KVDPLV+L
Sbjct  77   KPMDKKKVLVKVHPEGKFVVDVDKAIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSL  136

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  137  MMVEKVPDSTYEMIGGLDK  155



>ref|XP_005719372.1| 26S proteasome ATP-dependent regulatory subunit [Chondrus crispus]
 emb|CDF39461.1| 26S proteasome ATP-dependent regulatory subunit [Chondrus crispus]
Length=411

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            GLR YY   +  L+ ++R+K  NL RL+AQRNELNSKVR L+EELQLLQEPGS VGEVVK
Sbjct  22   GLRSYYQTKMDQLESKIREKQENLRRLQAQRNELNSKVRSLREELQLLQEPGSSVGEVVK  81

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
            VMGK KVLVKVHPEGKYVVD DKSIDITK++ + RVAL+NDSY LH +LPSKVDPLV+LM
Sbjct  82   VMGKLKVLVKVHPEGKYVVDFDKSIDITKLSSTARVALQNDSYTLHKVLPSKVDPLVSLM  141

Query  539  KVEKVPDSTYDMIGGLDQ  592
            +VE VPDSTY+MIGGLD+
Sbjct  142  RVENVPDSTYEMIGGLDE  159



>ref|XP_002011885.1| GI14329 [Drosophila mojavensis]
 gb|EDW08006.1| GI14329 [Drosophila mojavensis]
Length=405

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
            G G R YY+Q I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGEV
Sbjct  16   GVGFRSYYIQKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEV  75

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            VK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPLV+
Sbjct  76   VKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVS  135

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LM VEKVPDSTY+M+GGLD+
Sbjct  136  LMMVEKVPDSTYEMVGGLDK  155



>ref|XP_011154641.1| PREDICTED: 26S protease regulatory subunit 8 [Harpegnathos saltator]
 gb|EFN87947.1| 26S protease regulatory subunit 8 [Harpegnathos saltator]
Length=405

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>gb|EGI70168.1| 26S protease regulatory subunit 8 [Acromyrmex echinatior]
Length=427

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  37   KGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  96

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  97   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  156

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  157  SLMMVEKVPDSTYEMVGGLDK  177



>ref|XP_972551.1| PREDICTED: 26S protease regulatory subunit 8 [Tribolium castaneum]
Length=404

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EEL LLQE GSYVGE
Sbjct  14   KGEGFRSYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELMLLQEQGSYVGE  73

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPLV
Sbjct  74   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLV  133

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  134  SLMMVEKVPDSTYEMVGGLDK  154



>gb|AAC48284.1| DUG [Drosophila melanogaster]
Length=405

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+Q I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKSVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>ref|XP_011303291.1| PREDICTED: 26S protease regulatory subunit 8 [Fopius arisanus]
Length=405

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +2

Query  158  KPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGS  337
            KP K GEG + YY+  I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GS
Sbjct  12   KPSK-GEGFKPYYITKIEELQLIVAEKGQNLRRLQAQRNELNAKVRMLREELQLLQEQGS  70

Query  338  YVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKV  517
            YVGEVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KV
Sbjct  71   YVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKV  130

Query  518  DPLVNLMKVEKVPDSTYDMIGGLDQ  592
            DPLV+LM VEKVPDSTY+M+GGLD+
Sbjct  131  DPLVSLMMVEKVPDSTYEMVGGLDK  155



>gb|ACO12128.1| 26S protease regulatory subunit 8 [Lepeophtheirus salmonis]
 gb|ADD24295.1| 26S protease regulatory subunit 8 [Lepeophtheirus salmonis]
 gb|ADD38306.1| 26S protease regulatory subunit 8 [Lepeophtheirus salmonis]
Length=410

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            EGLR YY+  I +L   V  K  NL RLEAQRNELN+KVRML+EELQLLQE GSYVGEVV
Sbjct  21   EGLRTYYVTKIEELGQTVANKNQNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVV  80

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKVHPEGK+VVD+DK+IDI +ITP+ RVALRNDSY LH ILP+KVDPLV+L
Sbjct  81   KAMDKKKVLVKVHPEGKFVVDIDKNIDIGEITPNCRVALRNDSYALHKILPNKVDPLVSL  140

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+M+GGLD+
Sbjct  141  MMVEKVPDSTYEMVGGLDK  159



>ref|XP_009928195.1| PREDICTED: 26S protease regulatory subunit 8 [Haliaeetus albicilla]
Length=398

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            K G GLRQYY+  I +LQL V +K+ NL RL+AQRNELN+K  +L+EE QLLQE GSYVG
Sbjct  7    KGGTGLRQYYLSKIEELQLIVNEKSQNLRRLQAQRNELNAKXXLLREERQLLQEQGSYVG  66

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVV+ M K KVLVKVHPEGK+VVDVDK+IDI  +TP+ RVALRNDSY LH ILP+KVDPL
Sbjct  67   EVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPL  126

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+MIGGLD+
Sbjct  127  VSLMMVEKVPDSTYEMIGGLDK  148



>ref|XP_002423806.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
 gb|EEB11068.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
Length=414

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +2

Query  158  KPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGS  337
            KP K  EG R YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GS
Sbjct  21   KPHKD-EGFRPYYVTKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGS  79

Query  338  YVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKV  517
            YVGEVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KV
Sbjct  80   YVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKV  139

Query  518  DPLVNLMKVEKVPDSTYDMIGGLDQ  592
            DPLV+LM VEKVPDSTY+M+GGLD+
Sbjct  140  DPLVSLMMVEKVPDSTYEMVGGLDK  164



>gb|AEE62443.1| unknown [Dendroctonus ponderosae]
Length=405

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+  I +LQL V +K  NL RL+AQRNELN+KVRML+EEL LLQE GSYVGE
Sbjct  15   KGEGFRSYYITKIEELQLIVAEKGQNLRRLQAQRNELNAKVRMLREELMLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>gb|EFA09518.1| hypothetical protein TcasGA2_TC011620 [Tribolium castaneum]
Length=441

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EEL LLQE GSYVGE
Sbjct  51   KGEGFRSYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELMLLQEQGSYVGE  110

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDPLV
Sbjct  111  VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLV  170

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  171  SLMMVEKVPDSTYEMVGGLDK  191



>emb|CBN80092.1| conserved unknown protein [Ectocarpus siliculosus]
Length=398

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            G+  YY   I +++L VR +T NL RL+AQRNELN+KVR+L+EEL  LQE GSYVGEVVK
Sbjct  11   GVHSYYQGKIDEMELVVRDRTQNLERLKAQRNELNAKVRLLREELHHLQESGSYVGEVVK  70

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
             MGK KVLVKV+PEGKYVVD+DK ID+ K TP+TRVALRNDSYVLH ILP+KVDPLV+LM
Sbjct  71   AMGKKKVLVKVNPEGKYVVDIDKDIDVNKCTPNTRVALRNDSYVLHKILPTKVDPLVSLM  130

Query  539  KVEKVPDSTYDMIGGLDQ  592
            KVEKVPDSTYDMIGGL++
Sbjct  131  KVEKVPDSTYDMIGGLEK  148



>ref|XP_009166026.1| hypothetical protein T265_13205, partial [Opisthorchis viverrini]
 gb|KER30216.1| hypothetical protein T265_13205, partial [Opisthorchis viverrini]
Length=426

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = +2

Query  104  AGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELN  283
            AG    + + E E+  +  P    +G++ YYM  I + Q  V +K  NL RLEAQRNELN
Sbjct  14   AGDPSRKYKRELEKEVAELPAATTDGIKNYYMNKIDEHQFIVTEKLQNLRRLEAQRNELN  73

Query  284  SKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTR  463
            +KVRML+EELQLLQE GSYVGEVVK M K KVLVKV PEGK+VVD+DK+IDI++I+P+ R
Sbjct  74   AKVRMLREELQLLQELGSYVGEVVKAMDKKKVLVKVQPEGKFVVDIDKNIDISQISPNCR  133

Query  464  VALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            VALRN+SY LH ILPSK+DPLV+LM VEKVPDSTY+MIGGLD+
Sbjct  134  VALRNESYTLHKILPSKIDPLVSLMMVEKVPDSTYEMIGGLDK  176



>ref|XP_001750050.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85225.1| predicted protein [Monosiga brevicollis MX1]
Length=418

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +2

Query  95   MATAGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRN  274
            MA   V      + R+ S  A+P K   G+  Y++  I  L++ V +KT NL RLEAQRN
Sbjct  1    MAATAVAPAGRTASRQPSI-AEP-KSAAGVNDYFVTKIDALKVVVAEKTQNLRRLEAQRN  58

Query  275  ELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITP  454
            ELN+KVR L+EEL LLQEP SYVGEV KVMGK KVLVKV PEGKYVVD+DKSID+ K++P
Sbjct  59   ELNAKVRALREELVLLQEPASYVGEVAKVMGKKKVLVKVQPEGKYVVDLDKSIDVGKLSP  118

Query  455  STRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            +TRVALR+DSY LH ILP+K+DPLV+LM +EKVPDSTYDM+GGLD+
Sbjct  119  NTRVALRSDSYTLHKILPNKIDPLVSLMMLEKVPDSTYDMVGGLDK  164



>ref|XP_008866523.1| 26S protease regulatory subunit 8 [Aphanomyces invadans]
 gb|ETW05085.1| 26S protease regulatory subunit 8 [Aphanomyces invadans]
Length=395

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            EGL  YY Q I  L+L VR KT NL RL+AQRNELNSKVR+L+EELQLLQEPGSYVGEVV
Sbjct  9    EGLTSYYRQKIEHLELTVRDKTMNLRRLQAQRNELNSKVRLLREELQLLQEPGSYVGEVV  68

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K MGKSKVLVKV+PEGKYVVDVDK+IDITK TP+TRVALRNDSYVLH ILP+KVDPLV+L
Sbjct  69   KQMGKSKVLVKVNPEGKYVVDVDKAIDITKCTPNTRVALRNDSYVLHKILPTKVDPLVSL  128

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            MKVEKVPDSTYDMIGGLD+
Sbjct  129  MKVEKVPDSTYDMIGGLDK  147



>ref|XP_008471380.1| PREDICTED: 26S protease regulatory subunit 8 [Diaphorina citri]
Length=403

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  164  MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYV  343
            +K  EG + YY+  I +LQL V +K  NL RL+AQRNELN+KVRML+EELQLLQE GSYV
Sbjct  11   IKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYV  70

Query  344  GEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDP  523
            GEVVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP+ RVALRN+SY LH ILP+KVDP
Sbjct  71   GEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDP  130

Query  524  LVNLMKVEKVPDSTYDMIGGLD  589
            LV+LM VEKVPDSTY+M+GGLD
Sbjct  131  LVSLMMVEKVPDSTYEMVGGLD  152



>sp|P54814.1|PRS8_MANSE RecName: Full=26S protease regulatory subunit 8; AltName: Full=Protein 
18-56 [Manduca sexta]
 gb|AAC46996.1| 18-56 protein [Manduca sexta]
Length=402

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  12   KGEGFRPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  71

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK++DI  +T + RVALRN+SY LH ILP+KVDPLV
Sbjct  72   VVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLV  131

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  132  SLMMVEKVPDSTYEMVGGLDK  152



>gb|EHJ76020.1| 26S protease regulatory subunit 8 [Danaus plexippus]
Length=397

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  7    KGEGFRPYYITKIEELQLVVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  66

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK++DI  +T + RVALRN+SY LH ILP+KVDPLV
Sbjct  67   VVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLV  126

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  127  SLMMVEKVPDSTYEMVGGLDK  147



>ref|XP_009823671.1| 26S protease regulatory subunit 8 [Aphanomyces astaci]
 gb|ETV86872.1| 26S protease regulatory subunit 8 [Aphanomyces astaci]
Length=395

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            EGL  YY Q I  L+L VR KT NL RL+AQRNELNSKVR+L+EELQLLQEPGSYVGEVV
Sbjct  9    EGLTSYYRQKIEHLELTVRDKTMNLRRLQAQRNELNSKVRLLREELQLLQEPGSYVGEVV  68

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K MGKSKVLVKV+PEGKYVVDVDK+IDITK TP+TRVALRNDSYVLH ILP+KVDPLV+L
Sbjct  69   KQMGKSKVLVKVNPEGKYVVDVDKTIDITKCTPNTRVALRNDSYVLHKILPTKVDPLVSL  128

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            MKVEKVPDSTYDMIGGLD+
Sbjct  129  MKVEKVPDSTYDMIGGLDK  147



>ref|XP_004926152.1| PREDICTED: 26S protease regulatory subunit 8-like [Bombyx mori]
Length=403

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  13   KGEGFRPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  72

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK++DI  +T + RVALRN+SY LH ILP+KVDPLV
Sbjct  73   VVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLV  132

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  133  SLMMVEKVPDSTYEMVGGLDK  153



>dbj|BAM18224.1| 26S protease regulatory subunit [Papilio xuthus]
Length=402

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG R YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  12   KGEGFRPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  71

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK++DI  +T + RVALRN+SY LH ILP+KVDPLV
Sbjct  72   VVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLV  131

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  132  SLMMVEKVPDSTYEMVGGLDK  152



>dbj|GAM29492.1| hypothetical protein SAMD00019534_126680, partial [Acytostelium 
subglobosum LB1]
Length=396

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  164  MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYV  343
            +++ +G++ YY   I DL+++V +K+ +L RLEAQRNELN+KVRMLKEELQLL   GS+V
Sbjct  3    IEETKGIKSYYCSKIEDLEIKVNEKSQDLRRLEAQRNELNNKVRMLKEELQLLTNQGSHV  62

Query  344  GEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDP  523
             EVVK+MGK+KVLVKV+PEGK+VVD+D SIDI K+TPSTR AL+++SY LH ILP+K+DP
Sbjct  63   AEVVKLMGKNKVLVKVNPEGKFVVDIDPSIDIAKLTPSTRAALKHESYTLHRILPNKIDP  122

Query  524  LVNLMKVEKVPDSTYDMIGGLDQ  592
            LV+LMKVEK+PDSTYDMIGGLD+
Sbjct  123  LVSLMKVEKIPDSTYDMIGGLDK  145



>ref|XP_005644732.1| 26S proteasome AAA-ATPase subunit RPT6a [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20188.1| 26S proteasome AAA-ATPase subunit RPT6a [Coccomyxa subellipsoidea 
C-169]
Length=396

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
            G+GL+ YY   I +L++  R K HNL RLEAQRNELN+KVR+L+EELQLLQEPGSYVGEV
Sbjct  6    GDGLKSYYKTKIEELEILARDKQHNLRRLEAQRNELNTKVRLLREELQLLQEPGSYVGEV  65

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            +KVMGK+KVLVKVHPEGKYVVD+DKSIDIT++T   RVALRNDSY LHL+LP+KVDPLV+
Sbjct  66   LKVMGKNKVLVKVHPEGKYVVDLDKSIDITQVTTGARVALRNDSYTLHLLLPTKVDPLVS  125

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LMKVEKVPDSTYDMIGGLDQ
Sbjct  126  LMKVEKVPDSTYDMIGGLDQ  145



>ref|XP_784151.3| PREDICTED: 26S protease regulatory subunit 8-like [Strongylocentrotus 
purpuratus]
Length=422

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +G+++YY+  I +LQ+ V  KT NL RLEAQRNELN+KVRML+EELQLLQE GS+VGEVV
Sbjct  34   DGIQRYYITKIEELQMVVTDKTQNLRRLEAQRNELNAKVRMLREELQLLQEQGSHVGEVV  93

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKVHPEGK+VVD+DKSIDI  + P+ RVALRNDS+ LH ILP+KVDPLV+L
Sbjct  94   KAMDKKKVLVKVHPEGKFVVDIDKSIDINDVQPNCRVALRNDSHTLHKILPNKVDPLVSL  153

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+M+GGLD+
Sbjct  154  MMVEKVPDSTYEMVGGLDK  172



>ref|XP_005705074.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME28554.1| AAA-type ATPase [Galdieria sulphuraria]
Length=407

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            L  YY + + +L+  +R+K  NL RLEAQRN+LNSKV+ L+EEL +LQEPGSYVGEVVKV
Sbjct  19   LHSYYERKLDELEGFIREKEDNLRRLEAQRNDLNSKVKNLREELHILQEPGSYVGEVVKV  78

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MG+SKVLVKV PEGKYVVD+DK IDI  ITP+ RVALRNDSY LH ILPSKVDPLV+LM+
Sbjct  79   MGRSKVLVKVQPEGKYVVDLDKEIDINSITPNLRVALRNDSYSLHKILPSKVDPLVSLMR  138

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTYDMIGGLD+
Sbjct  139  VEKVPDSTYDMIGGLDK  155



>ref|XP_005782841.1| hypothetical protein EMIHUDRAFT_456589 [Emiliania huxleyi CCMP1516]
 gb|EOD30412.1| hypothetical protein EMIHUDRAFT_456589 [Emiliania huxleyi CCMP1516]
Length=376

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
            G G+  YY   I +L++ VR+KT NL RLEAQRNELNSKVR+L+EEL LLQEPGSYVGEV
Sbjct  8    GHGISNYYSSKIDELEVVVREKTQNLRRLEAQRNELNSKVRLLREELSLLQEPGSYVGEV  67

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            VKVMG+ KVLVKVHPEGKYVVD+DK+IDITK+  + RVALRNDSY LHL+LPSKVDPLV+
Sbjct  68   VKVMGRKKVLVKVHPEGKYVVDIDKTIDITKLNANDRVALRNDSYTLHLVLPSKVDPLVS  127

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LMK+EKVPDSTYDMIGG D+
Sbjct  128  LMKLEKVPDSTYDMIGGCDK  147



>ref|XP_001384165.1| protease regulatory subunit 8 homolog (SUG1 protein) (CIM3 protein) 
(TAT-binding protein TBY1) [Scheffersomyces stipitis 
CBS 6054]
 gb|ABN66136.1| protease regulatory subunit 8 homolog (SUG1 protein) (CIM3 protein) 
(TAT-binding protein TBY1) [Scheffersomyces stipitis 
CBS 6054]
Length=402

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +2

Query  155  AKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPG  334
             KP     G+R Y+ Q I D +++++Q T NL RLEAQRN+LN+KVR LK+EL+LLQEPG
Sbjct  7    GKPYVHEGGIRPYFEQQIQDTEIKIQQTTQNLRRLEAQRNKLNNKVRQLKDELRLLQEPG  66

Query  335  SYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSK  514
            SYVGEVVKVMG  KVLVK+HPEGKY+V+V K IDI K+TPS RV L++DSY LH ILP+K
Sbjct  67   SYVGEVVKVMGLKKVLVKIHPEGKYIVNVTKDIDIKKLTPSIRVCLKSDSYDLHKILPNK  126

Query  515  VDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            VDPLV+LM VEKVPDSTYDM+GGLD+
Sbjct  127  VDPLVSLMMVEKVPDSTYDMVGGLDK  152



>gb|EFN65582.1| 26S protease regulatory subunit 8 [Camponotus floridanus]
Length=694

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +GEG + YY+  I +LQL V +K+ NL RL+AQRNELN+KVRML+EELQLLQE GSYVGE
Sbjct  15   KGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGE  74

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK M K KVLVKVHPEGK+VVD+DK+IDI  +TP++RVALRN+SY LH ILP+KVDPLV
Sbjct  75   VVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKILPNKVDPLV  134

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  135  SLMMVEKVPDSTYEMVGGLDK  155



>gb|KFD51250.1| hypothetical protein M513_07850 [Trichuris suis]
Length=400

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +GL QY    + DL+ ++ +K H+L RL+AQRNELN+KVR+LKEE+ +L E GSYVGEV+
Sbjct  12   QGLWQYIAVKLEDLEYELNEKNHDLRRLQAQRNELNAKVRLLKEEISMLHEQGSYVGEVI  71

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            +VM K KVLVKVHPEGKYVVD+DK++DIT+ITP+ RVALR DSYVLH ILPSKVDPLV+L
Sbjct  72   RVMDKKKVLVKVHPEGKYVVDIDKNVDITQITPNARVALRADSYVLHKILPSKVDPLVSL  131

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  132  MMVEKVPDSTYEMIGGLDR  150



>gb|EFA79359.1| 26S proteasome subunit ATPase 5 [Polysphondylium pallidum PN500]
Length=412

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            + +G++ YY+  I +L+++V +K  +L RLEAQRNELN++VRMLKEELQLL  PGS+V E
Sbjct  5    ETKGIKSYYVSKIEELEIKVNEKAQDLRRLEAQRNELNNRVRMLKEELQLLTNPGSHVAE  64

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK+MGK+KVLVKV+PEGK+VVD+D SIDI K+TPSTR AL+++SY LH ILP+K+DPLV
Sbjct  65   VVKLMGKNKVLVKVNPEGKFVVDIDPSIDIAKLTPSTRAALKHESYTLHRILPNKIDPLV  124

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LMKVEK+PDSTYDM+GGLD+
Sbjct  125  SLMKVEKIPDSTYDMVGGLDK  145



>ref|XP_004350825.1| 26S proteasome subunit ATPase 5 [Dictyostelium fasciculatum]
 gb|EGG14117.1| 26S proteasome subunit ATPase 5 [Dictyostelium fasciculatum]
Length=396

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            + +G++ YY+  I +L+++V +K+ +L RLEAQRNELN++VRMLKEELQLL  PGS+V E
Sbjct  5    ETKGIKSYYVSKIEELEIRVNEKSQDLRRLEAQRNELNNRVRMLKEELQLLTNPGSHVAE  64

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK+MG++KVLVKV+PEGK+VVD+D SID++K+TPSTR AL+++SY LH ILP+K+DPLV
Sbjct  65   VVKLMGRNKVLVKVNPEGKFVVDIDPSIDVSKLTPSTRAALKHESYTLHRILPNKIDPLV  124

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LMKVEK+PDSTYDM+GGLD+
Sbjct  125  SLMKVEKIPDSTYDMVGGLDK  145



>ref|XP_002909803.1| 26S protease regulatory subunit 8 [Phytophthora infestans T30-4]
 gb|EEY62105.1| 26S protease regulatory subunit 8 [Phytophthora infestans T30-4]
Length=326

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            GL  YY Q I  L+L VR +T NL RL+AQRNELNSKVR+L+EELQLLQEPGSYVGEVVK
Sbjct  15   GLTSYYEQKIEHLELTVRDETQNLRRLQAQRNELNSKVRLLREELQLLQEPGSYVGEVVK  74

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
             MGKSKVLVKV+PEGKYVVDVDK+IDI K TP+TRVALRNDSYVLH ILP+KVDPLV+LM
Sbjct  75   QMGKSKVLVKVNPEGKYVVDVDKTIDIAKCTPNTRVALRNDSYVLHKILPTKVDPLVSLM  134

Query  539  KVEKVPDSTYDMIGGLDQ  592
            KVEKVPDSTYDMIGGLD+
Sbjct  135  KVEKVPDSTYDMIGGLDK  152



>ref|XP_002895455.1| 26S protease regulatory subunit 8 [Phytophthora infestans T30-4]
 gb|EEY56687.1| 26S protease regulatory subunit 8 [Phytophthora infestans T30-4]
Length=326

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            GL  YY Q I  L+L VR +T NL RL+AQRNELNSKVR+L+EELQLLQEPGSYVGEVVK
Sbjct  15   GLTSYYEQKIEHLELTVRDETQNLRRLQAQRNELNSKVRLLREELQLLQEPGSYVGEVVK  74

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
             MGKSKVLVKV+PEGKYVVDVDK+IDI K TP+TRVALRNDSYVLH ILP+KVDPLV+LM
Sbjct  75   QMGKSKVLVKVNPEGKYVVDVDKTIDIAKCTPNTRVALRNDSYVLHKILPTKVDPLVSLM  134

Query  539  KVEKVPDSTYDMIGGLDQ  592
            KVEKVPDSTYDMIGGLD+
Sbjct  135  KVEKVPDSTYDMIGGLDK  152



>gb|KHJ42528.1| 26S proteasome subunit P45 family protein [Trichuris suis]
Length=437

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +GL QY    + DL+ ++ +K H+L RL+AQRNELN+KVR+LKEE+ +L E GSYVGEV+
Sbjct  49   QGLWQYIAVKLEDLEYELNEKNHDLRRLQAQRNELNAKVRLLKEEISMLHEQGSYVGEVI  108

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            +VM K KVLVKVHPEGKYVVD+DK++DIT+ITP+ RVALR DSYVLH ILPSKVDPLV+L
Sbjct  109  RVMDKKKVLVKVHPEGKYVVDIDKNVDITQITPNARVALRADSYVLHKILPSKVDPLVSL  168

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  169  MMVEKVPDSTYEMIGGLDR  187



>gb|KGK36604.1| hypothetical protein JL09_g4259 [Pichia kudriavzevii]
Length=405

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +2

Query  146  SCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQ  325
            + +A P+    G+  ++ Q I D ++Q+  KT NL RLEAQRN LNSKVR LK+EL+LLQ
Sbjct  6    AITATPVTHKSGISSFFNQKIQDYEIQLAAKTQNLRRLEAQRNTLNSKVRALKDELKLLQ  65

Query  326  EPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLIL  505
            EPGSYVGE++KVMGK K LVKVHPEGKY+ ++   +DI K+TPS RV L++DSY LH IL
Sbjct  66   EPGSYVGELIKVMGKKKALVKVHPEGKYISNISPDVDIKKLTPSVRVCLKSDSYELHKIL  125

Query  506  PSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            PSKVDPLV+LM VEKVPDSTYDM+GGLD+
Sbjct  126  PSKVDPLVSLMMVEKVPDSTYDMVGGLDK  154



>ref|XP_009529425.1| hypothetical protein PHYSODRAFT_546373 [Phytophthora sojae]
 gb|EGZ15676.1| hypothetical protein PHYSODRAFT_546373 [Phytophthora sojae]
Length=401

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +  GL  YY Q I  L+L VR +T NL RL+AQRNELNSKVR+L+EELQLLQEPGSYVGE
Sbjct  12   ESAGLTSYYEQKIEHLELTVRDETQNLRRLQAQRNELNSKVRLLREELQLLQEPGSYVGE  71

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK MGKSKVLVKV+PEGKYVVDVDK+IDI K TP+TRVALRNDSYVLH ILP+KVDPLV
Sbjct  72   VVKQMGKSKVLVKVNPEGKYVVDVDKTIDIAKCTPNTRVALRNDSYVLHKILPTKVDPLV  131

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LMKVEKVPDSTYDMIGGLD+
Sbjct  132  SLMKVEKVPDSTYDMIGGLDK  152



>ref|XP_003287255.1| 26S proteasome subunit ATPase 5 [Dictyostelium purpureum]
 gb|EGC36188.1| 26S proteasome subunit ATPase 5 [Dictyostelium purpureum]
Length=398

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +G++ YY   I DL+++V +K  +L RLEAQRNELN++VRMLKEELQLL  PGS+V EVV
Sbjct  9    KGIKSYYCSKIEDLEIRVNEKAQDLRRLEAQRNELNNRVRMLKEELQLLTNPGSHVAEVV  68

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K+MGK+KVLVKV+PEGK+VVD+D  +D++K+TPSTR AL+++SY LH ILP+K+DPLV+L
Sbjct  69   KLMGKNKVLVKVNPEGKFVVDIDPQVDVSKLTPSTRAALKHESYTLHRILPNKIDPLVSL  128

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            MKVEK+PDSTYDM+GGLD+
Sbjct  129  MKVEKIPDSTYDMVGGLDK  147



>ref|XP_002909192.1| 26S protease regulatory subunit 8 [Phytophthora infestans T30-4]
 gb|EEY58006.1| 26S protease regulatory subunit 8 [Phytophthora infestans T30-4]
Length=401

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            GL  YY Q I  L+L VR +T NL RL+AQRNELNSKVR+L+EELQLLQEPGSYVGEVVK
Sbjct  15   GLTSYYEQKIEHLELTVRDETQNLRRLQAQRNELNSKVRLLREELQLLQEPGSYVGEVVK  74

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
             MGKSKVLVKV+PEGKYVVDVDK+IDI K TP+TRVALRNDSYVLH ILP+KVDPLV+LM
Sbjct  75   QMGKSKVLVKVNPEGKYVVDVDKTIDIAKCTPNTRVALRNDSYVLHKILPTKVDPLVSLM  134

Query  539  KVEKVPDSTYDMIGGLDQ  592
            KVEKVPDSTYDMIGGLD+
Sbjct  135  KVEKVPDSTYDMIGGLDK  152



>ref|XP_502931.1| YALI0D17204p [Yarrowia lipolytica]
 emb|CAG81122.1| YALI0D17204p [Yarrowia lipolytica CLIB122]
Length=406

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            G+  ++ Q I D +L++ +K  NL RLEAQRN LN+KVR+LK+EL +LQE GSYVGEV+K
Sbjct  16   GIAPFFAQQIEDFELKINKKLQNLRRLEAQRNALNTKVRLLKDELHVLQESGSYVGEVIK  75

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
            +MGK KVLVKVHPEGKYVVD+   +DI KITPS RV LR+DSY LH ILP+KVDPLV+LM
Sbjct  76   IMGKQKVLVKVHPEGKYVVDIAPDLDIKKITPSLRVCLRSDSYTLHQILPNKVDPLVSLM  135

Query  539  KVEKVPDSTYDMIGGLDQ  592
             VEKVPDSTYDM+GGLDQ
Sbjct  136  MVEKVPDSTYDMVGGLDQ  153



>dbj|GAA49709.1| 26S proteasome regulatory subunit T6, partial [Clonorchis sinensis]
Length=666

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = +2

Query  104  AGVEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELN  283
            AG    + + E E+  +  P    +G++ YYM  I + Q  V +K  NL RLEAQRNELN
Sbjct  14   AGDPSRKYKRELEKEVAELPAATTDGIKNYYMNKIDEHQFIVTEKLQNLRRLEAQRNELN  73

Query  284  SKVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTR  463
            +KVRML+EELQLLQE GSYVGEVVK M K KVLVKV PEGK+VVD+DK+IDI++I+P+ R
Sbjct  74   AKVRMLREELQLLQELGSYVGEVVKAMDKKKVLVKVQPEGKFVVDIDKNIDISQISPNCR  133

Query  464  VALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            VALRN+SY LH ILPSK+DPLV+LM VEKVPDSTY+MIGGLD+
Sbjct  134  VALRNESYTLHKILPSKIDPLVSLMMVEKVPDSTYEMIGGLDK  176



>emb|CAX70911.1| Tat-binding protein 10 [Schistosoma japonicum]
Length=282

 Score =   201 bits (510),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +G++ YYM  I + Q    +K  NL RLEAQRNELN+KVRML+EELQLLQE GS+VGEV+
Sbjct  42   DGIKNYYMNKIDEHQFIYTEKVLNLRRLEAQRNELNAKVRMLREELQLLQEQGSFVGEVI  101

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKV PEGKYVVD+DK+I++++I+P+ RVALR+DSY+LH ILPSKVDPLV+L
Sbjct  102  KAMDKKKVLVKVQPEGKYVVDIDKNIEMSQISPNCRVALRSDSYILHKILPSKVDPLVSL  161

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  162  MMVEKVPDSTYEMIGGLDK  180



>emb|CDW58348.1| 26S protease regulatory subunit 8 [Trichuris trichiura]
Length=429

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +GL QY    + DL+ ++ +K H+L RL+AQRNELN+KVR+LKEE+ +L E GSYVGEV+
Sbjct  12   QGLWQYIAVKLDDLEYELNEKNHDLRRLQAQRNELNAKVRLLKEEISMLHEQGSYVGEVI  71

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            +VM K KVLVKVHPEGKYVVD+DK++DIT+ITP+ RVALR DSYVLH ILPSKVDPLV+L
Sbjct  72   RVMDKKKVLVKVHPEGKYVVDIDKNVDITQITPNARVALRADSYVLHKILPSKVDPLVSL  131

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  132  MMVEKVPDSTYEMIGGLDR  150



>gb|KFD64651.1| hypothetical protein M514_07850, partial [Trichuris suis]
Length=454

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +GL QY    + DL+ ++ +K H+L RL+AQRNELN+KVR+LKEE+ +L E GSYVGEV+
Sbjct  12   QGLWQYIAVKLEDLEYELNEKNHDLRRLQAQRNELNAKVRLLKEEISMLHEQGSYVGEVI  71

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            +VM K KVLVKVHPEGKYVVD+DK++DIT+ITP+ RVALR DSYVLH ILPSKVDPLV+L
Sbjct  72   RVMDKKKVLVKVHPEGKYVVDIDKNVDITQITPNARVALRADSYVLHKILPSKVDPLVSL  131

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  132  MMVEKVPDSTYEMIGGLDR  150



>ref|XP_629632.1| 26S proteasome subunit ATPase 5 [Dictyostelium discoideum AX4]
 sp|P34124.2|PRS8_DICDI RecName: Full=26S protease regulatory subunit 8; AltName: Full=26S 
proteasome AAA-ATPase subunit RPT6; AltName: Full=Proteasome 
26S subunit ATPase 5; AltName: Full=Tat-binding protein 
homolog 10 [Dictyostelium discoideum]
 gb|EAL61170.1| 26S proteasome subunit ATPase 5 [Dictyostelium discoideum AX4]
Length=403

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            + +G++ YY   I +L+++V +K  +L RLEAQRNELN++VRMLKEELQLL  PGS+V E
Sbjct  12   ETKGIKSYYCSKIEELEIKVNEKAQDLRRLEAQRNELNNRVRMLKEELQLLTNPGSHVAE  71

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK+MGK+KVLVKV+PEGK+VVD+D ++DI K+TPSTR AL+++SY LH ILP+K+DPLV
Sbjct  72   VVKLMGKNKVLVKVNPEGKFVVDIDPTVDIAKLTPSTRAALKHESYTLHRILPNKIDPLV  131

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LMKVEK+PDSTYDM+GGLD+
Sbjct  132  SLMKVEKIPDSTYDMVGGLDK  152



>ref|XP_005949342.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X2 
[Haplochromis burtoni]
Length=447

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 142/192 (74%), Gaps = 2/192 (1%)
 Frame = +2

Query  23   RALSFFFLFAVELSPE--T*NQESEKMATAGVEKTRPESEREESCSAKPMKQGEGLRQYY  196
            R L F+ L+  E+  +  T N     +A  G    + E +  +       K G GLRQYY
Sbjct  6    RCLHFYILYIKEIPRKRCTGNSAWSAVALTGCRNFKMEVDGIDHMEMGESKGGSGLRQYY  65

Query  197  MQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKSK  376
            +  I +LQL V +K+ NL RL+AQRNELN+KVR+L+EELQLLQE GSYVGEVV+VM K K
Sbjct  66   LSKIEELQLTVNEKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRVMDKKK  125

Query  377  VLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVP  556
            VLVKVHPEGK+VVDVDK+IDI  +TP+ RVALRNDSY LH ILP+KVDPLV+LM VEKVP
Sbjct  126  VLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVP  185

Query  557  DSTYDMIGGLDQ  592
            DSTY+MIGGLD+
Sbjct  186  DSTYEMIGGLDK  197



>gb|ETI52811.1| 26S protease regulatory subunit 8 [Phytophthora parasitica P1569]
Length=401

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            GL  YY + I  L+L VR +T NL RL+AQRNELNSKVR+L+EELQLLQEPGSYVGEVVK
Sbjct  15   GLTSYYKKKIEHLELTVRDETQNLRRLQAQRNELNSKVRLLREELQLLQEPGSYVGEVVK  74

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
             MGKSKVLVKV+PEGKYVVDVDK+IDI K TP+TRVALRNDSYVLH ILP+KVDPLV+LM
Sbjct  75   QMGKSKVLVKVNPEGKYVVDVDKTIDIAKCTPNTRVALRNDSYVLHKILPTKVDPLVSLM  134

Query  539  KVEKVPDSTYDMIGGLDQ  592
            KVEKVPDSTYDMIGGLD+
Sbjct  135  KVEKVPDSTYDMIGGLDK  152



>ref|XP_008901335.1| 26S protease regulatory subunit 8 [Phytophthora parasitica INRA-310]
 gb|ETK92680.1| 26S protease regulatory subunit 8 [Phytophthora parasitica]
 gb|ETL46093.1| 26S protease regulatory subunit 8 [Phytophthora parasitica]
 gb|ETL99243.1| 26S protease regulatory subunit 8 [Phytophthora parasitica]
 gb|ETM52396.1| 26S protease regulatory subunit 8 [Phytophthora parasitica]
 gb|ETN13273.1| 26S protease regulatory subunit 8 [Phytophthora parasitica INRA-310]
 gb|ETO81504.1| 26S protease regulatory subunit 8 [Phytophthora parasitica P1976]
 gb|ETP22638.1| 26S protease regulatory subunit 8 [Phytophthora parasitica CJ01A1]
 gb|ETP50619.1| 26S protease regulatory subunit 8 [Phytophthora parasitica P10297]
Length=401

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            GL  YY + I  L+L VR +T NL RL+AQRNELNSKVR+L+EELQLLQEPGSYVGEVVK
Sbjct  15   GLTSYYEKKIEHLELTVRDETQNLRRLQAQRNELNSKVRLLREELQLLQEPGSYVGEVVK  74

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
             MGKSKVLVKV+PEGKYVVDVDK+IDI K TP+TRVALRNDSYVLH ILP+KVDPLV+LM
Sbjct  75   QMGKSKVLVKVNPEGKYVVDVDKTIDIAKCTPNTRVALRNDSYVLHKILPTKVDPLVSLM  134

Query  539  KVEKVPDSTYDMIGGLDQ  592
            KVEKVPDSTYDMIGGLD+
Sbjct  135  KVEKVPDSTYDMIGGLDK  152



>ref|NP_595870.1| 19S proteasome regulatory subunit Rpt6 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|P41836.1|PRS8_SCHPO RecName: Full=26S protease regulatory subunit 8 homolog; AltName: 
Full=Protein let1 [Schizosaccharomyces pombe 972h-]
 gb|AAA61615.1| Let1 [Schizosaccharomyces pombe]
 emb|CAA22628.1| 19S proteasome regulatory subunit Rpt6 (predicted) [Schizosaccharomyces 
pombe]
Length=403

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  164  MKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYV  343
            ++  E + QYY Q I D +L + QKT NL RLEAQRN LN++VR+L+EE+QLLQEPGSYV
Sbjct  10   LQSNENIVQYYTQKIQDAELAILQKTQNLRRLEAQRNGLNARVRLLREEIQLLQEPGSYV  69

Query  344  GEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDP  523
            GEV+K MGK+KVLVKVHPEGKYVVD+   IDI +I P+ RVALRNDSY L  ILP+KVDP
Sbjct  70   GEVIKTMGKNKVLVKVHPEGKYVVDISPDIDIKEIKPNIRVALRNDSYQLIKILPNKVDP  129

Query  524  LVNLMKVEKVPDSTYDMIGGLDQ  592
            LV+LM VEK+PDSTY+M+GGL++
Sbjct  130  LVSLMMVEKIPDSTYEMVGGLEK  152



>ref|XP_001009196.2| 26S proteasome subunit P45 family protein [Tetrahymena thermophila]
 gb|EAR88951.2| 26S proteasome ATPase regulatory subunit 6 [Tetrahymena thermophila 
SB210]
Length=395

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            QG GL+ +Y+  I +L L+V +K+ N+ RLEAQRNE N++VRMLKEE   LQ P SYVGE
Sbjct  5    QGAGLKAFYLSKIEELSLKVNEKSQNIKRLEAQRNEYNNQVRMLKEEFYSLQSPHSYVGE  64

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK MGKSKVLVK+ P+GKYVV++DKSI I    P+TRVAL+ DSYVLH +LP+KVDPLV
Sbjct  65   VVKPMGKSKVLVKISPDGKYVVNIDKSIKIEDCLPNTRVALKGDSYVLHKLLPTKVDPLV  124

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LMKVEKVPDSTYDMIGGLDQ
Sbjct  125  SLMKVEKVPDSTYDMIGGLDQ  145



>ref|XP_009807227.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 
8 [Gavia stellata]
Length=382

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            K G GLRQYY+  I +LQL V +K+ NL RL+AQRNELN+K       LQLLQE GSYVG
Sbjct  7    KGGTGLRQYYLSKIEELQLIVNEKSQNLRRLQAQRNELNAKGTARALFLQLLQEQGSYVG  66

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVV+ M K KVLVKVHPEGK+VVDVDK+IDI  +TP+ RVALRNDSY LH ILP+KVDPL
Sbjct  67   EVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPL  126

Query  527  VNLMKVEKVPDSTYDMIGGLD  589
            V+LM VEKVPDSTY+MIGGLD
Sbjct  127  VSLMMVEKVPDSTYEMIGGLD  147



>emb|CDS31889.1| 26S protease regulatory subunit 8 [Hymenolepis microstoma]
Length=458

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 124/161 (77%), Gaps = 9/161 (6%)
 Frame = +2

Query  110  VEKTRPESEREESCSAKPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSK  289
            +EK   ES +EE+         +G++ YY+  I +LQ  + +   NL RL AQRNELN+K
Sbjct  29   LEKDTKESIQEET---------DGIKDYYISKIDELQFTLTENMQNLRRLGAQRNELNAK  79

Query  290  VRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVA  469
            VR+L+EELQ LQE GSYVGEV+K M K KVLVKV PEGK+VVD+DK+IDI  +TP+ RVA
Sbjct  80   VRLLREELQFLQEQGSYVGEVIKPMDKKKVLVKVQPEGKFVVDIDKNIDIASVTPNCRVA  139

Query  470  LRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQ  592
            LRNDSY LH ILPSKVDPLV+LM VEKVPDSTY+MIGGLD+
Sbjct  140  LRNDSYTLHKILPSKVDPLVSLMMVEKVPDSTYEMIGGLDK  180



>ref|XP_005535327.1| 26S proteasome ATP-dependent regulatory subunit [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79041.1| 26S proteasome ATP-dependent regulatory subunit [Cyanidioschyzon 
merolae strain 10D]
Length=397

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            GLR YY   I + +  +++K   + RLEAQRNELN +VR L+EELQLLQEPGSYVGEVVK
Sbjct  9    GLRLYYQTKIDEFESLIQEKAETVRRLEAQRNELNGRVRGLREELQLLQEPGSYVGEVVK  68

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
             +GK+K LVKVHPEGKY+VDV+K +  + + P  RVALRNDSY LHL+LPSK DPLV+LM
Sbjct  69   PVGKNKALVKVHPEGKYIVDVEKQVAASSVKPGARVALRNDSYALHLVLPSKFDPLVSLM  128

Query  539  KVEKVPDSTYDMIGGLDQ  592
            KVEKVPDSTYDMIGGLD+
Sbjct  129  KVEKVPDSTYDMIGGLDE  146



>gb|AAW27345.1| SJCHGC09272 protein [Schistosoma japonicum]
Length=430

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
             +G++ YYM  I + Q    +K  NL RLEAQRNELN+KVRML+EELQLLQE GS+VGEV
Sbjct  41   ADGIKNYYMNKIDEHQFIYTEKVLNLRRLEAQRNELNAKVRMLREELQLLQEQGSFVGEV  100

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            +K M K KVLVKV PEGKYVVD+DK+I++++I+P+ RVALR+DSY+LH ILPSKVDPLV+
Sbjct  101  IKAMDKKKVLVKVQPEGKYVVDIDKNIEMSQISPNCRVALRSDSYILHKILPSKVDPLVS  160

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LM VEKVPDSTY+MIGGLD+
Sbjct  161  LMMVEKVPDSTYEMIGGLDK  180



>emb|CAX76058.1| Tat-binding protein 10 [Schistosoma japonicum]
Length=398

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +G++ YYM  I + Q    +K  NL RLEAQRNELN+KVRML+EELQLLQE GS+VGEV+
Sbjct  10   DGIKNYYMNKIDEHQFIYTEKVLNLRRLEAQRNELNAKVRMLREELQLLQEQGSFVGEVI  69

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKV PEGKYVVD+DK+I++++I+P+ RVALR+DSY+LH ILPSKVDPLV+L
Sbjct  70   KAMDKKKVLVKVQPEGKYVVDIDKNIEMSQISPNCRVALRSDSYILHKILPSKVDPLVSL  129

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  130  MMVEKVPDSTYEMIGGLDK  148



>emb|CAX76060.1| Tat-binding protein 10 [Schistosoma japonicum]
Length=431

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +G++ YYM  I + Q    +K  NL RLEAQRNELN+KVRML+EELQLLQE GS+VGEV+
Sbjct  42   DGIKNYYMNKIDEHQFIYTEKVLNLRRLEAQRNELNAKVRMLREELQLLQEQGSFVGEVI  101

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKV PEGKYVVD+DK+I++++I+P+ RVALR+DSY+LH ILPSKVDPLV+L
Sbjct  102  KAMDKKKVLVKVQPEGKYVVDIDKNIEMSQISPNCRVALRSDSYILHKILPSKVDPLVSL  161

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  162  MMVEKVPDSTYEMIGGLDK  180



>emb|CAX76059.1| Tat-binding protein 10 [Schistosoma japonicum]
 emb|CAX76061.1| Tat-binding protein 10 [Schistosoma japonicum]
 emb|CAX76062.1| Tat-binding protein 10 [Schistosoma japonicum]
Length=430

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +G++ YYM  I + Q    +K  NL RLEAQRNELN+KVRML+EELQLLQE GS+VGEV+
Sbjct  42   DGIKNYYMNKIDEHQFIYTEKVLNLRRLEAQRNELNAKVRMLREELQLLQEQGSFVGEVI  101

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKV PEGKYVVD+DK+I++++I+P+ RVALR+DSY+LH ILPSKVDPLV+L
Sbjct  102  KAMDKKKVLVKVQPEGKYVVDIDKNIEMSQISPNCRVALRSDSYILHKILPSKVDPLVSL  161

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  162  MMVEKVPDSTYEMIGGLDK  180



>ref|XP_011397854.1| 26S protease regulatory subunit 8-like protein A [Auxenochlorella 
protothecoides]
 gb|KFM24966.1| 26S protease regulatory subunit 8-like protein A [Auxenochlorella 
protothecoides]
Length=396

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  173  GEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEV  352
            GEGLR YY   I DL++++R + H L R++AQRN+LN+KVR+L+EELQLLQEPGSYVGEV
Sbjct  6    GEGLRAYYTSKIEDLEIEIRDRQHALQRMQAQRNDLNTKVRLLREELQLLQEPGSYVGEV  65

Query  353  VKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVN  532
            +K+MGKSKVLVKV+P+GKYVVD+DK ID T ITP  RVALRND+Y LH++LPSKVDPLV+
Sbjct  66   IKLMGKSKVLVKVNPDGKYVVDLDKEIDPTTITPGARVALRNDAYTLHVLLPSKVDPLVS  125

Query  533  LMKVEKVPDSTYDMIGGLDQ  592
            LMKVEKVPDSTYDM+GGLDQ
Sbjct  126  LMKVEKVPDSTYDMVGGLDQ  145



>ref|XP_002172384.1| 19S proteasome regulatory subunit Rpt6 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB06091.1| 19S proteasome regulatory subunit Rpt6 [Schizosaccharomyces japonicus 
yFS275]
 dbj|BAI77476.1| 19S protesome regulatory subunit Rpt6 [Schizosaccharomyces japonicus]
Length=403

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            + + L QYY Q I D++  + ++THNL RLEAQRNELN+KVR+L+EE+QLLQEPGSYVGE
Sbjct  12   ENKNLVQYYTQKIQDVEAAIIRRTHNLRRLEAQRNELNAKVRLLREEIQLLQEPGSYVGE  71

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            VVK+MGK+KVLVKVHPEGKYVVD+   +D+ +I P+ RVALRNDSY L  +LP+KVDPLV
Sbjct  72   VVKMMGKNKVLVKVHPEGKYVVDIAPDVDVREIKPNMRVALRNDSYQLIKVLPNKVDPLV  131

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEK+PDSTY M+GGL++
Sbjct  132  SLMMVEKIPDSTYSMVGGLEK  152



>ref|XP_001526037.1| 26S protease regulatory subunit 8 [Lodderomyces elongisporus 
NRRL YB-4239]
 gb|EDK44416.1| 26S protease regulatory subunit 8 [Lodderomyces elongisporus 
NRRL YB-4239]
Length=401

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +2

Query  158  KPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGS  337
            KP     G+R Y+ Q I D +++++Q T NL RLEAQRN+LN+ VR LK+EL+LLQEPGS
Sbjct  7    KPYTHESGIRPYFEQQIQDTEIEIQQTTQNLRRLEAQRNKLNNSVRQLKDELRLLQEPGS  66

Query  338  YVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKV  517
            YVGEV+KVMG  KVLVK+HPEGKY+V+V K +DI K+TPS RV L+ DS+ L+ ILP+KV
Sbjct  67   YVGEVIKVMGTKKVLVKIHPEGKYIVNVTKDVDIKKLTPSIRVCLKADSHDLYKILPNKV  126

Query  518  DPLVNLMKVEKVPDSTYDMIGGLDQ  592
            DPLV+LM VEKVPDSTYDM+GGLD+
Sbjct  127  DPLVSLMMVEKVPDSTYDMVGGLDK  151



>ref|XP_006690280.1| 26S proteasome subunit P45 [Candida tenuis ATCC 10573]
 ref|XP_006690281.1| hypothetical protein CANTEDRAFT_116302 [Candida tenuis ATCC 10573]
 gb|EGV61066.1| 26S proteasome subunit P45 [Candida tenuis ATCC 10573]
 gb|EGV61067.1| hypothetical protein CANTEDRAFT_116302 [Candida tenuis ATCC 10573]
Length=401

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            G++ Y+ Q I D ++ V+  T NL RLEAQRN+LN+KVR LK+EL+LLQEPGSYVGEV+K
Sbjct  14   GIKPYFEQQIQDTEISVQNTTENLRRLEAQRNKLNNKVRQLKDELRLLQEPGSYVGEVIK  73

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
            VMG +KVLVK+HPEGKY+V+V K IDI K+TPS RV L+ DSY LH ILP+KVDPLV+LM
Sbjct  74   VMGLNKVLVKIHPEGKYIVNVSKDIDIKKLTPSLRVCLKADSYDLHKILPNKVDPLVSLM  133

Query  539  KVEKVPDSTYDMIGGLDQ  592
             VEKVPDSTYDM+GGLD+
Sbjct  134  MVEKVPDSTYDMVGGLDK  151



>ref|XP_005949341.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X1 
[Haplochromis burtoni]
Length=448

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 142/193 (74%), Gaps = 3/193 (2%)
 Frame = +2

Query  23   RALSFFFLFAVELSPE--T*NQESEKMATAGVEKTRPESER-EESCSAKPMKQGEGLRQY  193
            R L F+ L+  E+  +  T N     +A  G    + E +  +        K G GLRQY
Sbjct  6    RCLHFYILYIKEIPRKRCTGNSAWSAVALTGCRNFKMEVDGIDHQMEMGESKGGSGLRQY  65

Query  194  YMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKVMGKS  373
            Y+  I +LQL V +K+ NL RL+AQRNELN+KVR+L+EELQLLQE GSYVGEVV+VM K 
Sbjct  66   YLSKIEELQLTVNEKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRVMDKK  125

Query  374  KVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKV  553
            KVLVKVHPEGK+VVDVDK+IDI  +TP+ RVALRNDSY LH ILP+KVDPLV+LM VEKV
Sbjct  126  KVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKV  185

Query  554  PDSTYDMIGGLDQ  592
            PDSTY+MIGGLD+
Sbjct  186  PDSTYEMIGGLDK  198



>ref|XP_004194697.1| Piso0_005206 [Millerozyma farinosa CBS 7064]
 emb|CCE86701.1| Piso0_005206 [Millerozyma farinosa CBS 7064]
Length=401

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            G++ Y+ Q I D +L+++  T NL RLEAQRN+LN+KVR LK+EL+LLQEPGSYVGEVVK
Sbjct  14   GIKPYFEQQIQDTELKIQGTTENLRRLEAQRNKLNNKVRQLKDELRLLQEPGSYVGEVVK  73

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
            VMG  KVLVK+HPEGKY+V++ K +DI K+TPS RV L+ DSY LH ILP+KVDPLV+LM
Sbjct  74   VMGLKKVLVKIHPEGKYIVNISKDVDIKKLTPSCRVCLKADSYDLHKILPNKVDPLVSLM  133

Query  539  KVEKVPDSTYDMIGGLDQ  592
             VEKVPDSTYDM+GGLD+
Sbjct  134  MVEKVPDSTYDMVGGLDK  151



>ref|XP_458104.1| DEHA2C09658p [Debaryomyces hansenii CBS767]
 emb|CAG86175.1| DEHA2C09658p [Debaryomyces hansenii CBS767]
Length=401

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            G++ Y+ Q I D +++++  T NL RLEAQRN+LN+KVR LK+EL+LLQEPGSYVGEVVK
Sbjct  14   GIKPYFEQQIQDAEIKIQTTTQNLRRLEAQRNKLNNKVRQLKDELRLLQEPGSYVGEVVK  73

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
            VMG  KVLVK+HPEGKY+V++ K IDI K+TPS RV L+ DSY LH ILP+KVDPLV+LM
Sbjct  74   VMGLKKVLVKIHPEGKYIVNISKDIDIKKLTPSLRVCLKADSYDLHKILPNKVDPLVSLM  133

Query  539  KVEKVPDSTYDMIGGLDQ  592
             VEKVPDSTYDM+GGLD+
Sbjct  134  MVEKVPDSTYDMVGGLDK  151



>ref|XP_002013930.1| GL24409 [Drosophila persimilis]
 gb|EDW24916.1| GL24409 [Drosophila persimilis]
Length=569

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +2

Query  170  QGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGE  349
            +G G + Y+MQ I +LQ  V +K  NL RL+AQRNELN  VRML+EELQ+L E GSYVGE
Sbjct  16   KGLGFQSYFMQKISELQFTVAEKNANLRRLQAQRNELNGNVRMLREELQMLLEQGSYVGE  75

Query  350  VVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLV  529
            V+K M K+KVLVKVHPEGKYVVDVDK IDI  + PS RVALRN+SY LH ILPSKVDPLV
Sbjct  76   VIKPMDKNKVLVKVHPEGKYVVDVDKGIDIKDVVPSCRVALRNESYTLHKILPSKVDPLV  135

Query  530  NLMKVEKVPDSTYDMIGGLDQ  592
            +LM VEKVPDSTY+M+GGLD+
Sbjct  136  SLMLVEKVPDSTYEMVGGLDK  156



>emb|CCE44632.1| hypothetical protein CPAR2_404360 [Candida parapsilosis]
Length=401

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  158  KPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGS  337
            KP     G+R Y+ Q I D +++++Q+T NL RLEAQRN+LN+ VR LK+EL+LLQEPGS
Sbjct  7    KPYVHEGGIRPYFEQQIQDTEIEIQQRTQNLRRLEAQRNKLNNSVRQLKDELRLLQEPGS  66

Query  338  YVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKV  517
            +VGEV+KVMG  KVLVK+HPEGKY+V+V K IDI K+TPS RV L+ DS+ L+ ILP+KV
Sbjct  67   FVGEVIKVMGTKKVLVKIHPEGKYIVNVTKDIDIKKLTPSIRVCLKADSHDLYKILPNKV  126

Query  518  DPLVNLMKVEKVPDSTYDMIGGLDQ  592
            DPLV+LM VEKVPDSTYDM+GGLD+
Sbjct  127  DPLVSLMMVEKVPDSTYDMVGGLDK  151



>emb|CCA23809.1| conserved unknown protein putative [Albugo laibachii Nc14]
Length=407

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            L  YY Q I  L+L VR+KT NL RL+AQRNELNSKVR+L+EELQLLQEPGSYVGEV+K 
Sbjct  22   LTSYYQQKIEQLELTVREKTQNLRRLQAQRNELNSKVRLLREELQLLQEPGSYVGEVIKQ  81

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            MGKSKVLVK++PEGKYVV+VD+SIDITK TP+TRVALRNDSY++H ILP+KVDPLV+LMK
Sbjct  82   MGKSKVLVKINPEGKYVVEVDRSIDITKCTPNTRVALRNDSYLIHKILPTKVDPLVSLMK  141

Query  542  VEKVPDSTYDMIGGL  586
            VEKVPDSTYDMIGGL
Sbjct  142  VEKVPDSTYDMIGGL  156



>ref|XP_003868648.1| Rpt6 ATPase of the 19S regulatory particle of the 26S proteasome 
[Candida orthopsilosis Co 90-125]
 emb|CCG25744.1| Rpt6 ATPase of the 19S regulatory particle of the 26S proteasome 
[Candida orthopsilosis]
Length=415

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  158  KPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGS  337
            KP     G+R Y+ Q I D +++++Q+T NL RLEAQRN+LN+ VR LK+EL+LLQEPGS
Sbjct  21   KPYVHEGGIRPYFEQQIQDTEIEIQQRTQNLRRLEAQRNKLNNSVRQLKDELRLLQEPGS  80

Query  338  YVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKV  517
            +VGEV+KVMG  KVLVK+HPEGKY+V+V K IDI K+TPS RV L+ DS+ L+ ILP+KV
Sbjct  81   FVGEVIKVMGTKKVLVKIHPEGKYIVNVTKDIDIKKLTPSIRVCLKADSHDLYKILPNKV  140

Query  518  DPLVNLMKVEKVPDSTYDMIGGLDQ  592
            DPLV+LM VEKVPDSTYDM+GGLD+
Sbjct  141  DPLVSLMMVEKVPDSTYDMVGGLDK  165



>ref|XP_002054061.1| GJ23001 [Drosophila virilis]
 gb|EDW67581.1| GJ23001 [Drosophila virilis]
Length=408

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +2

Query  167  KQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVG  346
            KQG+GL  ++ Q I +LQ  V +K  NL RLEAQRNELNSKVRML+EELQLLQE GSYVG
Sbjct  17   KQGDGLSSFFEQKIAELQFIVSEKQRNLQRLEAQRNELNSKVRMLREELQLLQEQGSYVG  76

Query  347  EVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPL  526
            EVVK + K KVLVKVH +GKYVVDV+K+IDI  +T ++RVALR+DSY LH ILP+KVDPL
Sbjct  77   EVVKPIDKKKVLVKVHHDGKYVVDVEKNIDINDVTTNSRVALRHDSYTLHKILPNKVDPL  136

Query  527  VNLMKVEKVPDSTYDMIGGLDQ  592
            V+LM VEKVPDSTY+M+GGL +
Sbjct  137  VSLMMVEKVPDSTYEMVGGLSK  158



>emb|CCD79213.1| putative 26s protease regulatory subunit [Schistosoma mansoni]
Length=431

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +G++ YYM  I + Q    +K  NL RLEAQRNELN+KVRML+EELQLLQE GS+VGEV+
Sbjct  42   DGIKNYYMNKIDEHQFIYTEKVLNLRRLEAQRNELNAKVRMLREELQLLQEQGSFVGEVI  101

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKV PEGKYVVD+DK+I++++I+P+ RVALR+DSY LH ILPSKVDPLV+L
Sbjct  102  KAMDKKKVLVKVQPEGKYVVDIDKNIEMSQISPNCRVALRSDSYTLHKILPSKVDPLVSL  161

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  162  MMVEKVPDSTYEMIGGLDK  180



>gb|KGU12869.1| 26S protease regulatory subunit 8 [Candida albicans 19F]
 gb|KGU15653.1| 26S protease regulatory subunit 8 [Candida albicans L26]
Length=401

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  158  KPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGS  337
            KP     G+R Y+ Q I D +++++Q T NL RLEAQRN+LN+KVR LK+EL+LLQEPGS
Sbjct  7    KPYVHEGGIRPYFEQQIQDTEIRIQQTTQNLRRLEAQRNKLNNKVRQLKDELKLLQEPGS  66

Query  338  YVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKV  517
            YVGEVVKVMG  KVLVK+HPEGK++V+V K ID+ K+TPS RV L+ DS+ L+ ILP+KV
Sbjct  67   YVGEVVKVMGLKKVLVKIHPEGKFIVNVTKDIDVKKLTPSIRVCLKADSHDLYKILPNKV  126

Query  518  DPLVNLMKVEKVPDSTYDMIGGLDQ  592
            DPLV+LM VEKVPDSTYDM+GGLD+
Sbjct  127  DPLVSLMMVEKVPDSTYDMVGGLDK  151



>ref|XP_002547633.1| 26S protease regulatory subunit 8 [Candida tropicalis MYA-3404]
 gb|EER35078.1| 26S protease regulatory subunit 8 [Candida tropicalis MYA-3404]
Length=419

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  158  KPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGS  337
            KP     G+R Y+ Q I D +++++Q T NL RLEAQRN+LN+KVR LK+EL+LLQEPGS
Sbjct  25   KPCVHEGGIRPYFEQQIQDTEIRIQQTTQNLRRLEAQRNKLNNKVRQLKDELRLLQEPGS  84

Query  338  YVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKV  517
            YVGEVVKVMG  KVLVK+HPEGK++V+V K ID+ K+TPS RV L+ DS+ L+ ILP+KV
Sbjct  85   YVGEVVKVMGLKKVLVKIHPEGKFIVNVTKDIDVKKLTPSIRVCLKADSHDLYKILPNKV  144

Query  518  DPLVNLMKVEKVPDSTYDMIGGLDQ  592
            DPLV+LM VEKVPDSTYDM+GGLD+
Sbjct  145  DPLVSLMMVEKVPDSTYDMVGGLDK  169



>ref|XP_004195789.1| Piso0_005206 [Millerozyma farinosa CBS 7064]
 emb|CCE85594.1| Piso0_005206 [Millerozyma farinosa CBS 7064]
Length=401

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +2

Query  179  GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVK  358
            G++ Y+ Q I D +L+++  T NL RLEAQRN+LN+KVR LK+EL+LLQEPGSYVGEVVK
Sbjct  14   GIKPYFEQQIQDTELKIQGTTENLRRLEAQRNKLNNKVRQLKDELRLLQEPGSYVGEVVK  73

Query  359  VMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLM  538
            VMG  KVLVK+HPEGKY+V++ K +DI K+TPS RV L+ DSY LH ILP+KVDPLV+LM
Sbjct  74   VMGLKKVLVKIHPEGKYIVNISKDVDIKKLTPSCRVCLKADSYDLHKILPNKVDPLVSLM  133

Query  539  KVEKVPDSTYDMIGGLD  589
             +EKVPDSTYDM+GGLD
Sbjct  134  MLEKVPDSTYDMVGGLD  150



>gb|KGQ89399.1| 26S protease regulatory subunit 8 [Candida albicans P94015]
 gb|KGQ95867.1| 26S protease regulatory subunit 8 [Candida albicans P37005]
 gb|KGR00466.1| 26S protease regulatory subunit 8 [Candida albicans GC75]
 gb|KGR11717.1| 26S protease regulatory subunit 8 [Candida albicans P57072]
 gb|KGR13849.1| 26S protease regulatory subunit 8 [Candida albicans P78048]
 gb|KGT70419.1| 26S protease regulatory subunit 8 [Candida albicans 12C]
 gb|KGU11169.1| 26S protease regulatory subunit 8 [Candida albicans P87]
 gb|KGU28930.1| 26S protease regulatory subunit 8 [Candida albicans P34048]
 gb|KGU32952.1| 26S protease regulatory subunit 8 [Candida albicans P75063]
 gb|KHC38468.1| 26S protease regulatory subunit 8 [Candida albicans P76055]
 gb|KHC39910.1| 26S protease regulatory subunit 8 [Candida albicans P76067]
 gb|KHC44583.1| 26S protease regulatory subunit 8 [Candida albicans Ca6]
 gb|KHC53943.1| 26S protease regulatory subunit 8 [Candida albicans P60002]
 gb|KHC65962.1| 26S protease regulatory subunit 8 [Candida albicans P75010]
 gb|KHC72755.1| 26S protease regulatory subunit 8 [Candida albicans P75016]
 gb|KHC80657.1| 26S protease regulatory subunit 8 [Candida albicans P78042]
 gb|KHC88230.1| 26S protease regulatory subunit 8 [Candida albicans SC5314]
Length=401

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  158  KPMKQGEGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGS  337
            KP     G+R Y+ Q I D +++++Q T NL RLEAQRN+LN+KVR LK+EL+LLQEPGS
Sbjct  7    KPYVHEGGIRPYFEQQIQDTEIRIQQTTQNLRRLEAQRNKLNNKVRQLKDELRLLQEPGS  66

Query  338  YVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKV  517
            YVGEVVKVMG  KVLVK+HPEGK++V+V K ID+ K+TPS RV L+ DS+ L+ ILP+KV
Sbjct  67   YVGEVVKVMGLKKVLVKIHPEGKFIVNVTKDIDVKKLTPSIRVCLKADSHDLYKILPNKV  126

Query  518  DPLVNLMKVEKVPDSTYDMIGGLDQ  592
            DPLV+LM VEKVPDSTYDM+GGLD+
Sbjct  127  DPLVSLMMVEKVPDSTYDMVGGLDK  151



>emb|CDP93275.1| Protein Bm13756, isoform a [Brugia malayi]
Length=409

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = +2

Query  167  KQGE--GLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSY  340
            K GE   L++YY   I D+Q +V +KT NL RL AQRNELN+KVRMLKEELQ L E GSY
Sbjct  16   KSGEEQSLKRYYKTKIEDMQQRVAEKTQNLRRLHAQRNELNTKVRMLKEELQQLHEQGSY  75

Query  341  VGEVVKVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVD  520
            VGEV K M K KVLVKVHPEGKYVVD+DK IDI  IT   RVALR DSY LH +LP+K+D
Sbjct  76   VGEVSKAMDKKKVLVKVHPEGKYVVDLDKGIDINSITSGCRVALRADSYALHKVLPNKID  135

Query  521  PLVNLMKVEKVPDSTYDMIGGLDQ  592
            PLV+LM VEKVPDSTY+MIGGLD+
Sbjct  136  PLVSLMMVEKVPDSTYEMIGGLDK  159



>gb|ERG85894.1| 26s protease regulatory subunit 8 [Ascaris suum]
Length=404

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  182  LRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVVKV  361
            L++YY   I D Q +V +KT NL RL+AQRNELNSKVRMLKEELQ L E GSYVGEV K 
Sbjct  21   LKRYYKTKIEDAQQRVTEKTQNLRRLQAQRNELNSKVRMLKEELQQLHEQGSYVGEVSKA  80

Query  362  MGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNLMK  541
            M K KVLVKVHPEGKYVVDVDK ID++ +    RVALR DSY LH ILP+KVDPLV+LM 
Sbjct  81   MDKKKVLVKVHPEGKYVVDVDKGIDVSAVNAGCRVALRADSYALHKILPNKVDPLVSLMM  140

Query  542  VEKVPDSTYDMIGGLDQ  592
            VEKVPDSTY+MIGGLD+
Sbjct  141  VEKVPDSTYEMIGGLDK  157



>ref|XP_003138569.1| 26S protease regulatory subunit 8 [Loa loa]
 gb|EFO25501.1| 26S protease regulatory subunit 8 [Loa loa]
Length=409

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            + L++YY   I D+Q +V +KT NL RL AQRNELN+KVRMLKEELQ L E GSYVGEV 
Sbjct  21   QSLKRYYKTKIEDMQQRVAEKTQNLRRLHAQRNELNTKVRMLKEELQQLHEQGSYVGEVS  80

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            K M K KVLVKVHPEGKYVVD+DK IDI  IT   RVALR DSY LH +LP+K+DPLV+L
Sbjct  81   KAMDKKKVLVKVHPEGKYVVDLDKGIDINSITSGCRVALRADSYALHKVLPNKIDPLVSL  140

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M VEKVPDSTY+MIGGLD+
Sbjct  141  MMVEKVPDSTYEMIGGLDK  159



>ref|XP_004997758.1| peptidase 26S subunit [Salpingoeca rosetta]
 gb|EGD78802.1| peptidase 26S subunit [Salpingoeca rosetta]
Length=411

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  EGLRQYYMQHIHDLQLQVRQKTHNLNRLEAQRNELNSKVRMLKEELQLLQEPGSYVGEVV  355
            +G   Y    ++ L + +  K  NL RLEA+RNELN +VR LKEEL LL EPGSYVGEV 
Sbjct  22   KGATAYLESKVNGLTVVLNDKKQNLRRLEAERNELNGRVRQLKEELTLLHEPGSYVGEVA  81

Query  356  KVMGKSKVLVKVHPEGKYVVDVDKSIDITKITPSTRVALRNDSYVLHLILPSKVDPLVNL  535
            KVMGK KVLVK HPEGKYVVD++K+IDITK+TP+TRVALR+DSY LH +LP+KVDPLV+L
Sbjct  82   KVMGKKKVLVKTHPEGKYVVDIEKNIDITKLTPNTRVALRSDSYTLHKVLPNKVDPLVSL  141

Query  536  MKVEKVPDSTYDMIGGLDQ  592
            M +EKVPDSTYDM+GGLD+
Sbjct  142  MMLEKVPDSTYDMVGGLDK  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160