BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J13

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA13440.1|  calcium dependent protein kinase                       213   1e-62   Ipomoea batatas [batate]
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...    159   2e-42   Nicotiana sylvestris
gb|AEY99979.1|  calcium-dependent protein kinase                        145   2e-37   Nicotiana tabacum [American tobacco]
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2      145   2e-37   Nicotiana tomentosiformis
ref|XP_006365956.1|  PREDICTED: calcium-dependent protein kinase 2      144   5e-37   
ref|NP_001275322.1|  calcium-dependent protein kinase                   142   3e-36   Solanum tuberosum [potatoes]
ref|NP_001275371.1|  calcium-dependent protein kinase 2                 142   3e-36   Solanum tuberosum [potatoes]
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...    142   3e-36   Solanum tuberosum [potatoes]
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1             141   5e-36   
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...    141   6e-36   Nicotiana sylvestris
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...    141   6e-36   Nicotiana tomentosiformis
gb|AAD28192.2|  calcium-dependent protein kinase                        140   1e-35   Solanum tuberosum [potatoes]
gb|EYU27336.1|  hypothetical protein MIMGU_mgv1a004414mg                126   9e-31   Erythranthe guttata [common monkey flower]
gb|KHG26977.1|  Calcium-dependent protein kinase 9                      124   4e-30   Gossypium arboreum [tree cotton]
gb|KJB62816.1|  hypothetical protein B456_009G438300                    124   6e-30   Gossypium raimondii
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...    120   2e-28   Sesamum indicum [beniseed]
gb|KCW66999.1|  hypothetical protein EUGRSUZ_F007611                    118   2e-28   Eucalyptus grandis [rose gum]
emb|CDP05759.1|  unnamed protein product                                119   4e-28   Coffea canephora [robusta coffee]
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...    119   4e-28   
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...    119   4e-28   
ref|XP_002532559.1|  calcium-dependent protein kinase, putative         118   7e-28   Ricinus communis
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                     117   1e-27   Eucalyptus grandis [rose gum]
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...    117   2e-27   Eucalyptus grandis [rose gum]
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                     115   7e-27   Vitis amurensis
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2      115   8e-27   Vitis vinifera
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33     114   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    114   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg             113   6e-26   Eutrema salsugineum [saltwater cress]
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    113   7e-26   Fragaria vesca subsp. vesca
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      112   2e-25   
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             111   2e-25   Prunus persica
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...    111   3e-25   Glycine max [soybeans]
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2      111   3e-25   Prunus mume [ume]
gb|KHG28675.1|  Calcium-dependent protein kinase 9                      111   4e-25   Gossypium arboreum [tree cotton]
gb|KJB13681.1|  hypothetical protein B456_002G088800                    110   6e-25   Gossypium raimondii
gb|KDO62721.1|  hypothetical protein CISIN_1g0096582mg                  106   7e-25   Citrus sinensis [apfelsine]
gb|KJB13679.1|  hypothetical protein B456_002G088800                    110   9e-25   Gossypium raimondii
ref|XP_008385882.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    109   1e-24   
gb|KDO62718.1|  hypothetical protein CISIN_1g0096582mg                  106   1e-24   Citrus sinensis [apfelsine]
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    109   2e-24   Nelumbo nucifera [Indian lotus]
gb|ABC59619.1|  calcium-dependent protein kinase                        109   2e-24   Triticum aestivum [Canadian hard winter wheat]
gb|ABD98803.1|  calcium-dependent protein kinase                        109   2e-24   Triticum aestivum [Canadian hard winter wheat]
gb|ABB54456.1|  calcium-dependent protein kinase                        108   2e-24   Hordeum brevisubulatum
ref|XP_002883243.1|  calmodulin-domain protein kinase 9                 108   2e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...    108   2e-24   Oryza brachyantha
ref|XP_006657761.1|  PREDICTED: calcium-dependent protein kinase ...    109   2e-24   
gb|KJB81729.1|  hypothetical protein B456_013G159300                    107   3e-24   Gossypium raimondii
ref|XP_006452345.1|  hypothetical protein CICLE_v10007978mg             108   3e-24   Citrus clementina [clementine]
dbj|BAJ99143.1|  predicted protein                                      108   4e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB81728.1|  hypothetical protein B456_013G159300                    107   4e-24   Gossypium raimondii
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9      108   5e-24   Camelina sativa [gold-of-pleasure]
gb|AAP03014.1|  seed calcium dependent protein kinase c                 108   5e-24   Glycine max [soybeans]
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...    108   5e-24   Camelina sativa [gold-of-pleasure]
ref|NP_188676.1|  calmodulin-domain protein kinase 9                    108   5e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ABC59620.1|  calcium-dependent protein kinase                        107   6e-24   Triticum aestivum [Canadian hard winter wheat]
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                    107   6e-24   Arabis alpina [alpine rockcress]
gb|ACJ61504.1|  calcium-dependent protein kinase                        108   6e-24   Glycine max [soybeans]
gb|KJB81727.1|  hypothetical protein B456_013G159300                    107   6e-24   Gossypium raimondii
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...    107   7e-24   
gb|KHG17079.1|  Calcium-dependent protein kinase 9                      107   8e-24   Gossypium arboreum [tree cotton]
gb|AAD17800.1|  Ca2+-dependent protein kinase                           107   9e-24   Mesembryanthemum crystallinum
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g             107   9e-24   Phaseolus vulgaris [French bean]
ref|XP_006452370.1|  hypothetical protein CICLE_v10007983mg             106   1e-23   
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg             107   1e-23   Capsella rubella
ref|NP_001105542.1|  calcium-dependent protein kinase 2                 106   2e-23   
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...    106   2e-23   
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg             106   2e-23   Citrus clementina [clementine]
emb|CDP04396.1|  unnamed protein product                                106   2e-23   Coffea canephora [robusta coffee]
gb|AAQ17506.1|  calcium dependent protein kinase 3                      106   2e-23   Oryza sativa Japonica Group [Japonica rice]
emb|CAA57157.1|  calcium-dependent protein kinase                       106   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007020822.1|  Calmodulin-domain protein kinase 9 isoform 3       104   3e-23   
ref|NP_001059775.1|  Os07g0515100                                       105   3e-23   
gb|KDP39132.1|  hypothetical protein JCGZ_00889                         105   3e-23   Jatropha curcas
gb|ADM14342.1|  calcium-dependent protein kinase 19                     105   3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ABD98804.1|  calcium-dependent protein kinase                        105   3e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...    106   3e-23   
ref|NP_001235641.1|  calmodulin-like domain protein kinase isoenz...    105   4e-23   
ref|XP_007020821.1|  Calmodulin-domain protein kinase 9 isoform 2       103   4e-23   
gb|KHN02836.1|  Calcium-dependent protein kinase 9                      105   6e-23   Glycine soja [wild soybean]
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                    104   7e-23   Arabis alpina [alpine rockcress]
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...    104   8e-23   
ref|XP_008349938.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    103   8e-23   
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1       104   1e-22   
ref|NP_001105306.1|  calcium-dependent protein kinase                   104   1e-22   Zea mays [maize]
ref|XP_004957848.1|  PREDICTED: calcium-dependent protein kinase ...    104   1e-22   
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...    103   1e-22   Camelina sativa [gold-of-pleasure]
emb|CDX82244.1|  BnaA03g35770D                                          103   2e-22   
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9      103   2e-22   Brassica rapa
gb|ACR34538.1|  unknown                                                 103   2e-22   Zea mays [maize]
emb|CDY36037.1|  BnaC03g41610D                                          103   2e-22   Brassica napus [oilseed rape]
ref|XP_010092160.1|  Calcium-dependent protein kinase 9                 103   2e-22   Morus notabilis
gb|AGG35978.1|  calcium-dependent protein kinase 9                      103   2e-22   Brassica napus [oilseed rape]
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...    103   2e-22   Cucumis sativus [cucumbers]
ref|NP_175485.1|  calcium-dependent protein kinase 33                   103   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ACY78680.1|  calcium-dependent protein kinase 1                      103   3e-22   Panax ginseng [Asiatic ginseng]
gb|AFY10519.1|  calcium dependent protein kinase 1                      103   3e-22   Dendrobium officinale
emb|CDX91224.1|  BnaC02g26350D                                          102   3e-22   
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21     102   3e-22   Camelina sativa [gold-of-pleasure]
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                   102   4e-22   Medicago truncatula
gb|ABE72958.1|  calcium dependent protein kinase 3                      102   4e-22   Medicago truncatula
emb|CAA65500.1|  protein kinase                                         102   5e-22   Medicago sativa [alfalfa]
ref|XP_010675716.1|  PREDICTED: calcium-dependent protein kinase ...    102   5e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009144515.1|  PREDICTED: calcium-dependent protein kinase 21     102   5e-22   Brassica rapa
gb|AGG35970.1|  calcium-dependent protein kinase 21                     101   9e-22   Brassica napus [oilseed rape]
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                    101   1e-21   Arabis alpina [alpine rockcress]
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...    101   1e-21   Cucumis melo [Oriental melon]
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...    101   2e-21   Cicer arietinum [garbanzo]
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...    100   2e-21   Phoenix dactylifera
gb|AET00506.2|  calcium-dependent kinase                                100   2e-21   Medicago truncatula
gb|AIU98507.1|  calcium-dependent protein kinase                        100   2e-21   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009406510.1|  PREDICTED: calcium-dependent protein kinase ...    100   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...    100   2e-21   Elaeis guineensis
ref|NP_192381.1|  calcium-dependent protein kinase 21                   100   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAK92828.1|  putative calcium dependent protein kinase               100   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...    100   2e-21   Eucalyptus grandis [rose gum]
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                     100   3e-21   Eucalyptus grandis [rose gum]
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                     100   3e-21   Eucalyptus grandis [rose gum]
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg             100   3e-21   Capsella rubella
ref|XP_004293286.1|  PREDICTED: calcium-dependent protein kinase ...    100   3e-21   Fragaria vesca subsp. vesca
ref|XP_010467929.1|  PREDICTED: calcium-dependent protein kinase ...    101   3e-21   
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...    100   3e-21   Elaeis guineensis
ref|XP_002891589.1|  calcium-dependent protein kinase 33                100   4e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    100   4e-21   Populus euphratica
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2      100   4e-21   Phoenix dactylifera
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g             100   5e-21   Phaseolus vulgaris [French bean]
ref|XP_010929942.1|  PREDICTED: calcium-dependent protein kinase ...  99.8    6e-21   Elaeis guineensis
gb|AFR11230.1|  calcium dependent protein kinase 1                    99.8    6e-21   Chenopodium album [lamb's-quarters]
ref|XP_002874811.1|  calcium-dependent protein kinase 21              99.4    6e-21   
ref|XP_003617547.1|  Calcium dependent protein kinase                   100   7e-21   
ref|XP_006396672.1|  hypothetical protein EUTSA_v10028567mg           99.4    7e-21   Eutrema salsugineum [saltwater cress]
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33   98.6    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010538709.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    1e-20   Cucumis sativus [cucumbers]
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...  98.2    2e-20   Camelina sativa [gold-of-pleasure]
gb|KDO78219.1|  hypothetical protein CISIN_1g009091mg                 97.4    2e-20   Citrus sinensis [apfelsine]
gb|KDO62707.1|  hypothetical protein CISIN_1g043230mg                 96.3    2e-20   Citrus sinensis [apfelsine]
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2    98.2    2e-20   Cucumis melo [Oriental melon]
ref|XP_010529441.1|  PREDICTED: calcium-dependent protein kinase 21   97.8    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_009597333.1|  PREDICTED: calcium-dependent protein kinase-...  97.8    2e-20   Nicotiana tomentosiformis
gb|AGJ83806.1|  calcium-dependent protein kinase 1d                   97.8    3e-20   Vitis amurensis
ref|XP_006855881.1|  hypothetical protein AMTR_s00037p00138680        96.3    3e-20   
gb|EPS59225.1|  calcium-dependent protein kinase 1                    97.4    3e-20   Genlisea aurea
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...  97.8    3e-20   Populus euphratica
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    3e-20   Cicer arietinum [garbanzo]
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    4e-20   
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    4e-20   Pyrus x bretschneideri [bai li]
ref|XP_002518484.1|  calcium-dependent protein kinase, putative       97.4    4e-20   Ricinus communis
ref|XP_006452348.1|  hypothetical protein CICLE_v10008325mg           96.3    4e-20   
gb|KDO78218.1|  hypothetical protein CISIN_1g009091mg                 97.1    4e-20   Citrus sinensis [apfelsine]
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...  97.1    5e-20   Sesamum indicum [beniseed]
gb|KDO62703.1|  hypothetical protein CISIN_1g009382mg                 97.1    5e-20   Citrus sinensis [apfelsine]
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                 97.1    5e-20   Citrus sinensis [apfelsine]
ref|XP_010686845.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    5e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    5e-20   Citrus sinensis [apfelsine]
emb|CBI23246.3|  unnamed protein product                              96.7    5e-20   Vitis vinifera
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg              97.1    5e-20   Erythranthe guttata [common monkey flower]
gb|KDO37230.1|  hypothetical protein CISIN_1g047606mg                 96.3    5e-20   Citrus sinensis [apfelsine]
gb|KHG10851.1|  Calcium-dependent protein kinase 21                   97.1    5e-20   Gossypium arboreum [tree cotton]
ref|XP_006452356.1|  hypothetical protein CICLE_v10010666mg           96.3    6e-20   
ref|XP_002268814.1|  PREDICTED: calcium-dependent protein kinase 2    96.7    6e-20   Vitis vinifera
ref|XP_006475082.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    6e-20   
ref|XP_006475079.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    6e-20   Citrus sinensis [apfelsine]
emb|CAD70166.1|  putative calcium-dependent protein kinase            92.8    6e-20   Landoltia punctata
ref|XP_007026067.1|  Calcium-dependent protein kinase 21 isoform 2    96.3    6e-20   
ref|XP_007026068.1|  Calcium-dependent protein kinase 21 isoform 3    96.3    7e-20   
ref|XP_006452344.1|  hypothetical protein CICLE_v10007980mg           96.7    7e-20   Citrus clementina [clementine]
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like         96.7    7e-20   Cicer arietinum [garbanzo]
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg           96.3    8e-20   Capsella rubella
ref|XP_009776260.1|  PREDICTED: calcium-dependent protein kinase-...  96.3    8e-20   Nicotiana sylvestris
ref|XP_006475081.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    8e-20   
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g           96.3    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1    96.3    1e-19   
ref|XP_009776253.1|  PREDICTED: calcium-dependent protein kinase-...  96.3    1e-19   Nicotiana sylvestris
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...  95.9    1e-19   Sesamum indicum [beniseed]
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg           95.1    2e-19   Citrus clementina [clementine]
ref|XP_006475078.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    2e-19   
gb|KJB69279.1|  hypothetical protein B456_011G014200                  95.1    3e-19   Gossypium raimondii
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g           94.7    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010093289.1|  Calcium-dependent protein kinase 15              94.4    4e-19   Morus notabilis
ref|XP_006452346.1|  hypothetical protein CICLE_v10010522mg           93.6    4e-19   
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    5e-19   Nicotiana tomentosiformis
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  94.4    5e-19   Prunus mume [ume]
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...  94.0    5e-19   Populus euphratica
gb|KDO62705.1|  hypothetical protein CISIN_1g040917mg                 93.6    5e-19   Citrus sinensis [apfelsine]
gb|KEH28424.1|  calcium-dependent kinase                              92.0    7e-19   Medicago truncatula
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like          93.2    1e-18   Malus domestica [apple tree]
ref|XP_003610427.1|  Calcium-dependent protein kinase                 93.2    1e-18   
gb|AGA83664.1|  calcium-dependent protein kinase 1                    93.2    1e-18   Dendrobium officinale
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_002874812.1|  calcium-dependent protein kinase 23              92.8    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    2e-18   Tarenaya hassleriana [spider flower]
gb|ACB71246.2|  calcium-dependent protein kinase 1                    92.8    2e-18   Hevea brasiliensis [jebe]
ref|XP_006475143.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    2e-18   
gb|KHN12036.1|  Calcium-dependent protein kinase 17                   92.4    2e-18   Glycine soja [wild soybean]
ref|XP_006452347.1|  hypothetical protein CICLE_v10008020mg           92.0    3e-18   Citrus clementina [clementine]
ref|XP_006301218.1|  hypothetical protein CARUB_v10021616mg           92.0    3e-18   Capsella rubella
ref|XP_006452355.1|  hypothetical protein CICLE_v10010314mg           91.7    3e-18   
ref|XP_007141507.1|  hypothetical protein PHAVU_008G201900g           91.7    3e-18   Phaseolus vulgaris [French bean]
gb|ADZ52811.1|  calcium-dependent protein kinase 3                    91.7    3e-18   Solanum tuberosum [potatoes]
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg           91.7    4e-18   Eutrema salsugineum [saltwater cress]
emb|CDY43077.1|  BnaCnng10830D                                        91.7    4e-18   Brassica napus [oilseed rape]
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...  91.7    4e-18   Pyrus x bretschneideri [bai li]
gb|AHN49725.1|  calcium-dependent protein kinase 1                    91.7    4e-18   Hippeastrum hybrid cultivar
gb|KCW68004.1|  hypothetical protein EUGRSUZ_F01694                   90.5    4e-18   Eucalyptus grandis [rose gum]
gb|KCW68005.1|  hypothetical protein EUGRSUZ_F01694                   90.5    5e-18   Eucalyptus grandis [rose gum]
dbj|BAE71239.1|  putative calcium dependent protein kinase            91.3    5e-18   Trifolium pratense [peavine clover]
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...  90.9    7e-18   Glycine max [soybeans]
gb|AIO04122.1|  calcium-dependent protein kinase                      90.9    8e-18   Hevea brasiliensis [jebe]
gb|AAC25423.1|  calcium-dependent protein kinase                      90.5    8e-18   Nicotiana tabacum [American tobacco]
ref|XP_010061106.1|  PREDICTED: calcium-dependent protein kinase ...  90.5    9e-18   Eucalyptus grandis [rose gum]
ref|XP_003617233.1|  Calcium dependent protein kinase                 90.1    1e-17   Medicago truncatula
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...  90.1    1e-17   Glycine max [soybeans]
ref|XP_006350481.1|  PREDICTED: calcium-dependent protein kinase-...  90.1    1e-17   Solanum tuberosum [potatoes]
gb|KHN38392.1|  Calcium-dependent protein kinase 17                   90.1    1e-17   Glycine soja [wild soybean]
ref|NP_001234806.1|  calcium-dependent protein kinase                 90.1    1e-17   Solanum lycopersicum
ref|XP_006575622.1|  PREDICTED: calcium-dependent protein kinase ...  89.7    1e-17   Glycine max [soybeans]
sp|P28582.2|CDPK_DAUCA  RecName: Full=Calcium-dependent protein k...  89.7    1e-17   Daucus carota [carrots]
gb|KDO84959.1|  hypothetical protein CISIN_1g010263mg                 88.2    1e-17   Citrus sinensis [apfelsine]
ref|XP_006391947.1|  hypothetical protein EUTSA_v10023804mg           90.1    1e-17   Eutrema salsugineum [saltwater cress]
ref|XP_009368734.1|  PREDICTED: calcium-dependent protein kinase ...  89.7    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_010434101.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  89.7    2e-17   Camelina sativa [gold-of-pleasure]
emb|CDY07254.1|  BnaC04g19170D                                        89.7    2e-17   
gb|KJB68586.1|  hypothetical protein B456_010G252400                  89.7    2e-17   Gossypium raimondii
ref|XP_006828852.1|  hypothetical protein AMTR_s00001p00158780        89.7    2e-17   Amborella trichopoda
gb|KJB83565.1|  hypothetical protein B456_013G253100                  89.4    2e-17   Gossypium raimondii
ref|XP_010430219.1|  PREDICTED: calcium-dependent protein kinase 19   89.0    2e-17   
ref|XP_006287505.1|  hypothetical protein CARUB_v10000714mg           89.4    2e-17   
ref|XP_006473713.1|  PREDICTED: calcium-dependent protein kinase ...  88.6    3e-17   Citrus sinensis [apfelsine]
ref|XP_009770081.1|  PREDICTED: calcium-dependent protein kinase ...  89.0    3e-17   Nicotiana sylvestris
gb|KFK40633.1|  hypothetical protein AALP_AA2G022000                  89.0    3e-17   Arabis alpina [alpine rockcress]
ref|XP_009120894.1|  PREDICTED: calcium-dependent protein kinase 34   88.6    4e-17   Brassica rapa
emb|CDY13993.1|  BnaC09g38330D                                        88.6    4e-17   Brassica napus [oilseed rape]
ref|XP_010266343.1|  PREDICTED: uncharacterized protein LOC104603873  89.7    4e-17   
ref|XP_006473712.1|  PREDICTED: calcium-dependent protein kinase ...  88.6    4e-17   Citrus sinensis [apfelsine]
ref|XP_009630031.1|  PREDICTED: calcium-dependent protein kinase ...  88.6    4e-17   Nicotiana tomentosiformis
ref|XP_006435253.1|  hypothetical protein CICLE_v10000897mg           88.2    5e-17   Citrus clementina [clementine]
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g           88.2    5e-17   Phaseolus vulgaris [French bean]
ref|XP_010418170.1|  PREDICTED: calcium-dependent protein kinase ...  88.2    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009402456.1|  PREDICTED: calcium-dependent protein kinase ...  87.8    6e-17   
emb|CDY24863.1|  BnaA03g59670D                                        88.2    7e-17   Brassica napus [oilseed rape]
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...  87.8    7e-17   Brassica rapa
emb|CDX78468.1|  BnaA03g03800D                                        87.8    7e-17   
gb|AHG06449.1|  calcium-dependent protein kinase 17                   87.8    7e-17   Brassica napus [oilseed rape]
ref|XP_010448965.1|  PREDICTED: calcium-dependent protein kinase 15   87.8    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_003545165.1|  PREDICTED: calcium-dependent protein kinase ...  87.8    8e-17   Glycine max [soybeans]
ref|XP_004491231.1|  PREDICTED: calcium-dependent protein kinase ...  87.8    8e-17   Cicer arietinum [garbanzo]
gb|KHN28162.1|  Calcium-dependent protein kinase 17                   87.4    8e-17   Glycine soja [wild soybean]
gb|AAL59948.1|  putative calcium-dependent protein kinase             87.8    9e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CAD70165.1|  calcium-dependent protein kinase                     87.8    9e-17   Landoltia punctata
gb|ABV22562.1|  calcium-dependent protein kinase                      87.8    1e-16   Physcomitrella patens
ref|XP_010439398.1|  PREDICTED: calcium-dependent protein kinase ...  87.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...  87.4    1e-16   
ref|NP_196779.1|  calcium-dependent protein kinase 17                 87.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283446.1|  hypothetical protein CARUB_v10004493mg           87.4    1e-16   Capsella rubella
gb|KDP20751.1|  hypothetical protein JCGZ_21222                       87.4    1e-16   Jatropha curcas
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg           87.0    1e-16   Capsella rubella
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                  87.0    1e-16   Arabis alpina [alpine rockcress]
ref|XP_010536137.1|  PREDICTED: calcium-dependent protein kinase 17   87.0    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17   87.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004231610.1|  PREDICTED: calcium-dependent protein kinase ...  87.0    2e-16   Solanum lycopersicum
ref|XP_003564438.1|  PREDICTED: calcium-dependent protein kinase 34   86.7    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_003576346.1|  PREDICTED: calcium-dependent protein kinase ...  87.0    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...  86.7    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34   86.7    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...  86.7    2e-16   Camelina sativa [gold-of-pleasure]
emb|CDY44912.1|  BnaA02g04170D                                        86.7    2e-16   Brassica napus [oilseed rape]
ref|XP_004252886.1|  PREDICTED: calcium-dependent protein kinase ...  86.7    2e-16   Solanum lycopersicum
ref|XP_002888057.1|  predicted protein                                86.7    2e-16   
ref|XP_009126355.1|  PREDICTED: calcium-dependent protein kinase 34   86.7    2e-16   Brassica rapa
ref|XP_008671573.1|  PREDICTED: calcium-dependent protein kinase ...  86.7    2e-16   Zea mays [maize]
emb|CDX97174.1|  BnaC09g44510D                                        86.7    2e-16   
emb|CDX70450.1|  BnaC03g05340D                                        86.7    2e-16   
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg           86.7    2e-16   Eutrema salsugineum [saltwater cress]
gb|KFK26202.1|  hypothetical protein AALP_AA8G215800                  86.7    2e-16   Arabis alpina [alpine rockcress]
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...  86.7    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009121874.1|  PREDICTED: calcium-dependent protein kinase 17   86.7    2e-16   Brassica rapa
emb|CBX25242.1|  hypothetical_protein                                 86.7    2e-16   Oryza brachyantha
ref|XP_002979552.1|  calcium dependent protein kinase 17              86.7    2e-16   
ref|XP_009414250.1|  PREDICTED: calcium-dependent protein kinase ...  85.1    2e-16   
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...  86.3    2e-16   
ref|XP_010261434.1|  PREDICTED: calcium-dependent protein kinase ...  86.3    2e-16   
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...  86.3    3e-16   
ref|XP_002977722.1|  calcium dependent protein kinase 17              86.3    3e-16   
ref|NP_001275456.1|  calcium-dependent protein kinase 3               86.3    3e-16   
ref|XP_010106395.1|  Calcium-dependent protein kinase 17              86.3    3e-16   
gb|KJB21813.1|  hypothetical protein B456_004G015100                  86.3    3e-16   
ref|XP_009113383.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  85.9    3e-16   
ref|XP_010099802.1|  Calcium-dependent protein kinase 17              85.9    3e-16   
gb|EAZ40006.1|  hypothetical protein OsJ_24444                        85.5    3e-16   
gb|ABV22565.1|  calcium-dependent protein kinase                      85.9    3e-16   
ref|XP_002871516.1|  calcium-dependent protein kinase 17              85.9    4e-16   
ref|XP_010251583.1|  PREDICTED: calcium-dependent protein kinase ...  85.9    4e-16   
ref|NP_176386.2|  calcium-dependent protein kinase 19                 85.9    4e-16   
ref|XP_006289743.1|  hypothetical protein CARUB_v10003311mg           85.9    4e-16   
ref|XP_003528592.1|  PREDICTED: calcium-dependent protein kinase ...  85.9    4e-16   
ref|XP_009416404.1|  PREDICTED: calcium-dependent protein kinase ...  85.5    4e-16   
dbj|BAK07881.1|  predicted protein                                    85.5    4e-16   
gb|KHN23929.1|  Calcium-dependent protein kinase 17                   85.5    4e-16   
ref|NP_197437.1|  calcium-dependent protein kinase 34                 85.5    4e-16   
ref|XP_006356386.1|  PREDICTED: calcium-dependent protein kinase ...  85.5    4e-16   
gb|ABV22575.1|  calcium-dependent protein kinase                      85.9    4e-16   
ref|XP_002873943.1|  calcium-dependent protein kinase 34              85.5    5e-16   
gb|KJB09335.1|  hypothetical protein B456_001G135000                  85.1    6e-16   
gb|AIU98504.1|  calcium-dependent protein kinase                      85.1    6e-16   
emb|CDY63783.1|  BnaCnng42690D                                        85.1    6e-16   
gb|AGG35954.1|  calcium-dependent protein kinase 34                   84.7    7e-16   
dbj|BAK06618.1|  predicted protein                                    85.1    7e-16   
ref|NP_001044575.1|  Os01g0808400                                     85.1    7e-16   
gb|EAY76207.1|  hypothetical protein OsI_04143                        84.7    8e-16   
ref|XP_001767768.1|  cpk1 calcium-dependent protein kinase            84.7    9e-16   
ref|XP_008812553.1|  PREDICTED: calcium-dependent protein kinase ...  84.7    1e-15   
ref|XP_002869856.1|  calcium-dependent protein kinase 15              84.7    1e-15   
ref|XP_001782248.1|  predicted protein                                84.3    1e-15   
gb|KDO62709.1|  hypothetical protein CISIN_1g010756mg                 84.3    1e-15   
ref|XP_006452360.1|  hypothetical protein CICLE_v10010555mg           84.3    1e-15   
ref|XP_006662719.1|  PREDICTED: calcium-dependent protein kinase ...  84.3    1e-15   
emb|CBX25340.1|  hypothetical_protein                                 84.3    1e-15   
ref|XP_002442700.1|  hypothetical protein SORBIDRAFT_08g001380        84.3    1e-15   
ref|XP_006349794.1|  PREDICTED: calcium-dependent protein kinase ...  84.0    1e-15   
ref|XP_004499307.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  84.7    1e-15   
ref|XP_006475142.1|  PREDICTED: calcium-dependent protein kinase ...  84.0    1e-15   
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...  84.3    1e-15   
emb|CAG27840.1|  calcium-dependent protein kinase 17                  84.3    1e-15   
ref|XP_006452350.1|  hypothetical protein CICLE_v10007950mg           84.3    1e-15   
gb|ABV22553.1|  calcium-dependent protein kinase                      79.3    1e-15   
ref|XP_006644875.1|  PREDICTED: calcium-dependent protein kinase ...  84.0    1e-15   
ref|XP_003622837.1|  Calcium dependent protein kinase                 84.0    1e-15   
ref|XP_004980140.1|  PREDICTED: calcium-dependent protein kinase ...  84.0    2e-15   
emb|CDP20327.1|  unnamed protein product                              84.0    2e-15   
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...  84.0    2e-15   
ref|XP_002510594.1|  calcium-dependent protein kinase, putative       84.0    2e-15   
ref|XP_009135461.1|  PREDICTED: calcium-dependent protein kinase 15   84.0    2e-15   
ref|XP_006452352.1|  hypothetical protein CICLE_v100107182mg          79.7    2e-15   
ref|XP_003610425.1|  Calcium-dependent protein kinase                 84.0    2e-15   
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...  84.0    2e-15   
ref|NP_193925.1|  calcium-dependent protein kinase 15                 84.0    2e-15   
ref|XP_003556786.1|  PREDICTED: calcium-dependent protein kinase ...  84.0    2e-15   
ref|NP_001190794.1|  calcium-dependent protein kinase 15              84.0    2e-15   
ref|XP_009620047.1|  PREDICTED: calcium-dependent protein kinase 29   84.0    2e-15   
ref|XP_004978350.1|  PREDICTED: calcium-dependent protein kinase ...  83.6    2e-15   
ref|XP_006452359.1|  hypothetical protein CICLE_v10007873mg           84.0    2e-15   
ref|XP_011459094.1|  PREDICTED: calcium-dependent protein kinase ...  83.6    2e-15   
gb|EMS56466.1|  Calcium-dependent protein kinase 34                   83.6    2e-15   
ref|XP_008387908.1|  PREDICTED: calcium-dependent protein kinase 29   83.6    2e-15   
ref|XP_004291330.1|  PREDICTED: calcium-dependent protein kinase ...  83.2    3e-15   
ref|XP_007146136.1|  hypothetical protein PHAVU_006G015300g           83.2    3e-15   
ref|XP_007146477.1|  hypothetical protein PHAVU_006G0437000g          82.8    3e-15   
ref|XP_002441304.1|  hypothetical protein SORBIDRAFT_09g024100        83.2    3e-15   
gb|KJB55472.1|  hypothetical protein B456_009G078000                  83.2    3e-15   
ref|XP_006827112.1|  hypothetical protein AMTR_s00010p00245350        83.2    3e-15   
ref|XP_006452364.1|  hypothetical protein CICLE_v10010377mg           80.1    3e-15   
ref|XP_001781985.1|  predicted protein                                82.8    3e-15   
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...  83.2    3e-15   
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...  83.2    3e-15   
ref|XP_001768980.1|  predicted protein                                82.8    3e-15   
ref|XP_009419685.1|  PREDICTED: calcium-dependent protein kinase ...  83.2    3e-15   
ref|XP_010061107.1|  PREDICTED: calcium-dependent protein kinase ...  82.8    3e-15   
ref|XP_007015253.1|  Calcium-dependent protein kinase 17              83.2    3e-15   
ref|XP_002276630.2|  PREDICTED: calcium-dependent protein kinase ...  83.2    3e-15   
ref|XP_006649323.1|  PREDICTED: calcium-dependent protein kinase ...  83.2    4e-15   
ref|XP_002299975.2|  hypothetical protein POPTR_0001s28150g           82.8    4e-15   
emb|CAN62888.1|  hypothetical protein VITISV_025544                   83.2    4e-15   
ref|XP_008788593.1|  PREDICTED: calcium-dependent protein kinase ...  82.8    4e-15   
ref|XP_011024983.1|  PREDICTED: calcium-dependent protein kinase 17   82.8    4e-15   
ref|XP_004228884.1|  PREDICTED: calcium-dependent protein kinase ...  82.8    4e-15   
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...  82.8    4e-15   
gb|AFW82380.1|  putative calcium-dependent protein kinase family ...  80.1    4e-15   
ref|XP_002526062.1|  calcium-dependent protein kinase, putative       82.8    4e-15   
gb|AGT17455.1|  hypothetical protein SHCRBa_258_F08_F_40              82.8    4e-15   
gb|AGT15898.1|  calcium-dependent protein kinase                      82.8    4e-15   
gb|AES59823.2|  calcium-dependent kinase                              82.8    4e-15   
gb|AGT16545.1|  calcium-dependent protein kinase 34                   82.8    4e-15   
gb|KDP43197.1|  hypothetical protein JCGZ_22749                       82.8    5e-15   
ref|XP_006664312.1|  PREDICTED: calcium-dependent protein kinase ...  82.4    5e-15   
gb|EPS70504.1|  calcium dependent protein kinase 25                   82.4    5e-15   
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg           82.4    5e-15   
gb|AGT17376.1|  calcium-dependent protein kinase                      82.4    5e-15   
ref|XP_009333791.1|  PREDICTED: calcium-dependent protein kinase ...  82.8    5e-15   
ref|XP_001771902.1|  predicted protein                                82.4    5e-15   
gb|KHN16772.1|  Calcium-dependent protein kinase 3                    79.0    6e-15   
ref|XP_008221211.1|  PREDICTED: calcium-dependent protein kinase 29   82.4    6e-15   
gb|KDO36585.1|  hypothetical protein CISIN_1g042977mg                 82.0    7e-15   
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34   82.0    7e-15   
ref|XP_003589572.1|  Calcium-dependent protein kinase                 82.8    7e-15   
ref|XP_007222396.1|  hypothetical protein PRUPE_ppa004027mg           82.0    7e-15   
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...  82.0    7e-15   
gb|AIU98501.1|  calcium-dependent protein kinase                      82.0    7e-15   
ref|XP_006386161.1|  hypothetical protein POPTR_0002s01850g           82.0    7e-15   
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg           82.0    8e-15   
ref|XP_008786936.1|  PREDICTED: calcium-dependent protein kinase ...  82.0    8e-15   
gb|AAC28510.1|  Similar to gb|AF072908 calcium-dependent protein ...  82.0    8e-15   
ref|XP_009334623.1|  PREDICTED: calcium-dependent protein kinase 29   82.0    9e-15   
emb|CDX82886.1|  BnaC01g13360D                                        82.0    9e-15   
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...  82.0    9e-15   
ref|XP_010040549.1|  PREDICTED: calcium-dependent protein kinase ...  81.6    9e-15   
gb|KJB58044.1|  hypothetical protein B456_009G191500                  82.4    1e-14   
ref|XP_010489356.1|  PREDICTED: calcium-dependent protein kinase ...  81.6    1e-14   
gb|AHZ58490.1|  calmodulin-like domain protein kinase                 81.6    1e-14   
gb|AAB70706.1|  calmodulin-like domain protein kinase                 81.6    1e-14   
ref|XP_010922091.1|  PREDICTED: calcium-dependent protein kinase ...  81.6    1e-14   
ref|XP_010935343.1|  PREDICTED: calcium-dependent protein kinase 26   81.6    1e-14   
ref|XP_010904692.1|  PREDICTED: calcium-dependent protein kinase ...  81.6    1e-14   
ref|XP_009796949.1|  PREDICTED: calcium-dependent protein kinase ...  81.6    1e-14   
ref|XP_009340796.1|  PREDICTED: calcium-dependent protein kinase 26   81.6    1e-14   
ref|XP_008348947.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  81.6    1e-14   
ref|XP_011034967.1|  PREDICTED: calcium-dependent protein kinase 29   81.6    1e-14   
gb|KDP36877.1|  hypothetical protein JCGZ_08168                       81.3    1e-14   
gb|AGG35967.1|  calcium-dependent protein kinase 15                   81.6    1e-14   
ref|XP_002299904.1|  calcium-dependent protein kinase 1               81.3    1e-14   
gb|KCW68006.1|  hypothetical protein EUGRSUZ_F01695                   81.3    1e-14   
ref|XP_004140192.1|  PREDICTED: calcium-dependent protein kinase ...  81.3    1e-14   
gb|KDO40818.1|  hypothetical protein CISIN_1g0428232mg                80.1    1e-14   
gb|AFW82381.1|  putative calcium-dependent protein kinase family ...  81.6    1e-14   
gb|KDO40816.1|  hypothetical protein CISIN_1g046082mg                 78.6    1e-14   
ref|XP_008365176.1|  PREDICTED: calcium-dependent protein kinase ...  81.3    1e-14   
gb|ABF93782.1|  Calcium-dependent protein kinase, isoform 11, put...  81.3    1e-14   
ref|XP_006647698.1|  PREDICTED: calcium-dependent protein kinase ...  81.3    1e-14   
ref|XP_009627412.1|  PREDICTED: calcium-dependent protein kinase ...  81.3    1e-14   
ref|XP_010247475.1|  PREDICTED: calcium-dependent protein kinase 34   81.3    1e-14   
ref|XP_004249005.1|  PREDICTED: calcium-dependent protein kinase 4    81.3    2e-14   
ref|XP_004238385.1|  PREDICTED: calcium-dependent protein kinase 29   81.3    2e-14   
ref|XP_011080420.1|  PREDICTED: calcium-dependent protein kinase ...  81.3    2e-14   
gb|AAZ76712.1|  calcium-dependent protein kinase 1                    81.3    2e-14   
ref|XP_002973116.1|  calcium dependent protein kinase 1               81.3    2e-14   
gb|ADE76782.1|  unknown                                               78.6    2e-14   
ref|XP_002976739.1|  calcium dependent protein kinase 1               81.3    2e-14   
ref|XP_002468587.1|  hypothetical protein SORBIDRAFT_01g048570        80.9    2e-14   
ref|XP_008235819.1|  PREDICTED: calcium-dependent protein kinase 26   81.3    2e-14   
ref|XP_008365078.1|  PREDICTED: calcium-dependent protein kinase ...  81.3    2e-14   
ref|XP_008377838.1|  PREDICTED: calcium-dependent protein kinase 26   81.3    2e-14   
gb|AFZ84665.1|  CDPK                                                  80.9    2e-14   
ref|XP_009773532.1|  PREDICTED: calcium-dependent protein kinase ...  80.9    2e-14   
ref|XP_004290076.1|  PREDICTED: calcium-dependent protein kinase 26   80.9    2e-14   
gb|AGS15000.1|  calcium-dependent protein kinase 3                    80.9    2e-14   
ref|XP_002272270.1|  PREDICTED: calcium-dependent protein kinase 3    80.9    2e-14   
emb|CAN61364.1|  hypothetical protein VITISV_032639                   80.5    2e-14   
ref|XP_011045425.1|  PREDICTED: calcium-dependent protein kinase ...  80.5    2e-14   
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...  80.5    2e-14   
ref|XP_009798869.1|  PREDICTED: calcium-dependent protein kinase 29   80.5    2e-14   
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...  80.5    2e-14   
gb|AAC05270.1|  calcium dependent protein kinase                      80.5    3e-14   
gb|EEC74439.1|  hypothetical protein OsI_09829                        80.5    3e-14   
ref|XP_007017899.1|  Calcium-dependent protein kinase 29              80.5    3e-14   
gb|EMS63097.1|  Calcium-dependent protein kinase isoform 11           80.5    3e-14   
ref|NP_001048842.1|  Os03g0128700                                     80.5    3e-14   
ref|XP_011025545.1|  PREDICTED: calcium-dependent protein kinase ...  80.5    3e-14   
dbj|BAC19839.1|  calcium dependent protein kinase 13                  80.5    3e-14   
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg              80.5    3e-14   
ref|XP_008665565.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  81.3    3e-14   
gb|EPS59027.1|  hypothetical protein M569_15783                       79.7    3e-14   
emb|CDP07348.1|  unnamed protein product                              80.5    3e-14   
gb|ABY59018.1|  calcium-dependent protein kinase                      80.1    3e-14   
gb|EEE58262.1|  hypothetical protein OsJ_09266                        80.5    3e-14   
ref|XP_002313342.1|  calcium-dependent protein kinase 1               80.5    3e-14   
ref|XP_008786722.1|  PREDICTED: calcium-dependent protein kinase ...  80.5    3e-14   
emb|CDX79112.1|  BnaA01g11790D                                        80.5    3e-14   
gb|AAN17388.1|  Putative calcium dependent protein kinase             80.5    3e-14   
ref|XP_010229262.1|  PREDICTED: calcium-dependent protein kinase ...  80.5    3e-14   
ref|XP_003558912.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    3e-14   
ref|XP_006342079.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    3e-14   
ref|XP_006655639.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    3e-14   
gb|ABY59004.1|  calcium-dependent protein kinase                      80.1    3e-14   
dbj|BAJ93361.1|  predicted protein                                    80.1    3e-14   
gb|KJB52213.1|  hypothetical protein B456_008G251000                  80.1    3e-14   
ref|XP_010266261.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    3e-14   
ref|XP_007160621.1|  hypothetical protein PHAVU_001G002800g           80.9    3e-14   
ref|XP_010555172.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    3e-14   
ref|XP_010555169.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    4e-14   
ref|XP_008798404.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    4e-14   
ref|XP_010467489.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    4e-14   
ref|XP_006845045.1|  hypothetical protein AMTR_s00269p00011940        80.1    4e-14   
ref|XP_008804660.1|  PREDICTED: calcium-dependent protein kinase 26   80.1    4e-14   
ref|XP_002267735.1|  PREDICTED: calcium-dependent protein kinase 20   80.1    4e-14   
ref|XP_008451214.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    4e-14   
emb|CDX85697.1|  BnaA02g01160D                                        79.7    4e-14   
emb|CDX91168.1|  BnaC02g04290D                                        79.7    4e-14   
ref|XP_002313265.1|  calcium-dependent protein kinase                 79.7    4e-14   
ref|XP_004511540.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    4e-14   
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    4e-14   
ref|XP_004513232.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    4e-14   
gb|ABK63287.1|  calcium dependent protein kinase                      79.7    4e-14   
ref|XP_004144896.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    5e-14   
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    5e-14   
ref|XP_008451211.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    5e-14   
ref|XP_006283444.1|  hypothetical protein CARUB_v10004491mg           79.7    5e-14   
ref|XP_010533815.1|  PREDICTED: calcium-dependent protein kinase 19   79.7    5e-14   
ref|XP_006361005.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    5e-14   
gb|KJB35709.1|  hypothetical protein B456_006G124800                  79.7    5e-14   
ref|XP_011040815.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    5e-14   
ref|NP_001105304.1|  calcium dependent protein kinase                 79.3    5e-14   
gb|EYU46187.1|  hypothetical protein MIMGU_mgv1a004352mg              79.7    5e-14   
gb|AAL68971.1|  phloem calmodulin-like-domain protein kinase PCPK1    79.7    5e-14   
gb|ABY59005.1|  calcium-dependent protein kinase                      79.7    5e-14   
gb|AED99726.1|  stress-related calcium-dependent protein kinase       79.7    5e-14   
ref|XP_010555167.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    6e-14   
ref|XP_004976604.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    6e-14   
ref|XP_010908660.1|  PREDICTED: calcium-dependent protein kinase ...  79.3    6e-14   
ref|XP_009397608.1|  PREDICTED: calcium-dependent protein kinase ...  79.3    6e-14   



>dbj|BAA13440.1| calcium dependent protein kinase [Ipomoea batatas]
Length=514

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 106/118 (90%), Gaps = 7/118 (6%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDA  367
            MGNR+SRHKHGEKHRSEAG        HQTHIEYTKSPGQGAGLP RPPSI K VSKSDA
Sbjct  1    MGNRTSRHKHGEKHRSEAG-------SHQTHIEYTKSPGQGAGLPVRPPSIPKSVSKSDA  53

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEI TGKQYACKSISKKKLVTKGDKDDM
Sbjct  54   ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEIRTGKQYACKSISKKKLVTKGDKDDM  111



>ref|XP_009798561.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=521

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDA  367
            MGN  S     E+  +   HG GG  PH+T I+YTKSPG  + LP R P   KPVS    
Sbjct  1    MGNICSSKSKPEQSNANGHHGSGGVGPHRTEIQYTKSPGPESQLPVRAPPSPKPVSAHGT  60

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ILGK YEDVR HY+LGKELGRGQFGVTYLCTEI+TG+QYACKSISKKKLVTK DKDDM
Sbjct  61   ILGKPYEDVRVHYTLGKELGRGQFGVTYLCTEISTGQQYACKSISKKKLVTKADKDDM  118



>gb|AEY99979.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=522

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  266  PHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGV  445
            PHQT I+YTKSPG  + LP RP +  KPV K + ILGK +EDV+A+Y+LGKELGRGQFGV
Sbjct  28   PHQTQIQYTKSPGPESQLPMRPSASPKPVFKQETILGKPFEDVKAYYTLGKELGRGQFGV  87

Query  446  TYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            T+LCTEI TG QYACKSISKKKLVTK DK+DM
Sbjct  88   TFLCTEIATGHQYACKSISKKKLVTKSDKEDM  119



>ref|XP_009592788.1| PREDICTED: calcium-dependent protein kinase 2 [Nicotiana tomentosiformis]
Length=522

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  266  PHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGV  445
            PHQT I+YTKSPG  + LP RP +  KPV K + ILGK +EDV+A+Y+LGKELGRGQFGV
Sbjct  28   PHQTQIQYTKSPGPESQLPMRPSASPKPVFKQETILGKPFEDVKAYYTLGKELGRGQFGV  87

Query  446  TYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            T+LCTEI TG QYACKSISKKKLVTK DK+DM
Sbjct  88   TFLCTEIATGHQYACKSISKKKLVTKSDKEDM  119



>ref|XP_006365956.1| PREDICTED: calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=526

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +2

Query  227  HRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHY  406
            +RS    GG     HQ  I+YTKSPG    LP RP +  KPV K + ILGKA+EDV+AHY
Sbjct  19   YRSGGSDGGHNHGTHQAQIQYTKSPGPETQLPLRPQASPKPVFKQETILGKAFEDVKAHY  78

Query  407  SLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            +LGKELGRGQFGVT+LCTEI TG QYACKSISKKKLVTK DK DM
Sbjct  79   TLGKELGRGQFGVTFLCTEIATGHQYACKSISKKKLVTKSDKADM  123



>ref|NP_001275322.1| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ACZ26302.1| calcium dependant protein kinase [Solanum tuberosum]
Length=532

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +2

Query  269  HQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVT  448
            HQ  I+YTKSPG    LP RP +  KPV K + ILGKA+EDV+AHY+LGKELGRGQFGVT
Sbjct  39   HQAQIQYTKSPGPETQLPLRPQASPKPVFKQETILGKAFEDVKAHYTLGKELGRGQFGVT  98

Query  449  YLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            +LCTEI TG QYACKSISKKKLVTK DK DM
Sbjct  99   FLCTEIATGHQYACKSISKKKLVTKSDKADM  129



>ref|NP_001275371.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|AAL09044.3|AF418563_1 calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|ADK10908.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=515

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +2

Query  269  HQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVT  448
            H+  I+YTKSPG  A L  RPP   KP  + D ILGK YEDV+ HY+LGKELGRGQFGVT
Sbjct  28   HRNEIQYTKSPGPEAQLHVRPPPSPKPAVRYDTILGKPYEDVKLHYTLGKELGRGQFGVT  87

Query  449  YLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            YLCTEI TG+QYACKSISKKKLVTK DKDDM
Sbjct  88   YLCTEIVTGQQYACKSISKKKLVTKADKDDM  118



>ref|XP_006346214.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Solanum 
tuberosum]
Length=521

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +2

Query  269  HQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVT  448
            H+  I+YTKSPG  A L  RPP   KP  + D ILGK YEDV+ HY+LGKELGRGQFGVT
Sbjct  28   HRNEIQYTKSPGPEAQLHVRPPPSPKPAVRYDTILGKPYEDVKLHYTLGKELGRGQFGVT  87

Query  449  YLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            YLCTEI TG+QYACKSISKKKLVTK DKDDM
Sbjct  88   YLCTEIVTGQQYACKSISKKKLVTKADKDDM  118



>ref|NP_001234582.1| calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
 gb|AAK52801.1|AF363784_1 calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
Length=521

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +2

Query  269  HQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVT  448
            H+  I+YTKSPG  A L  RPP   KP  + D ILGK YEDV+ HY+LGKELGRGQFGVT
Sbjct  28   HRNEIQYTKSPGPEAQLHVRPPPSPKPAVRYDTILGKPYEDVKLHYTLGKELGRGQFGVT  87

Query  449  YLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            YLCTEI TG+QYACKSISKKKLVTK DKDDM
Sbjct  88   YLCTEIATGQQYACKSISKKKLVTKADKDDM  118



>ref|XP_009783685.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=522

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  272  QTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTY  451
            QT I+YTKSPG  + LP RP +  KPV K + ILGK +EDV+AHY+LGKELGRGQFGVT+
Sbjct  30   QTQIQYTKSPGPESQLPMRPSASPKPVFKQETILGKPFEDVKAHYTLGKELGRGQFGVTF  89

Query  452  LCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            LCTEI TG QYACKSISKKKLVTK DK+DM
Sbjct  90   LCTEIATGHQYACKSISKKKLVTKSDKEDM  119



>ref|XP_009604147.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
tomentosiformis]
Length=521

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDA  367
            MGN  S     E+  +   HG GG  PH+T I+YTKSPG  + LP RPP   KPVS    
Sbjct  1    MGNICSSKSKPEQSNANGHHGSGGVGPHRTEIQYTKSPGPESQLPVRPPPSPKPVSAHGT  60

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ILGK YEDVR HY+LGKELGRGQFGVTYLCTEI+TG+QYACKSISKKKLVTK DKDDM
Sbjct  61   ILGKPYEDVRVHYTLGKELGRGQFGVTYLCTEISTGQQYACKSISKKKLVTKADKDDM  118



>gb|AAD28192.2| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ABF56558.1| calcium-dependent protein kinase 1 [Solanum tuberosum]
Length=532

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +2

Query  269  HQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVT  448
            HQ  I+YTKSPG    LP RP +  KPV K + ILGKA+EDV+AHY+LGKELGRGQ+GVT
Sbjct  39   HQAQIQYTKSPGPETQLPLRPQASPKPVFKQETILGKAFEDVKAHYTLGKELGRGQYGVT  98

Query  449  YLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            +LCTEI TG QYACKSISKKKLVTK DK DM
Sbjct  99   FLCTEIATGHQYACKSISKKKLVTKSDKADM  129



>gb|EYU27336.1| hypothetical protein MIMGU_mgv1a004414mg [Erythranthe guttata]
Length=528

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 6/108 (6%)
 Frame = +2

Query  224  KHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLP--TRPPSISKPVSKSDAILGKAYEDVR  397
            +H S A  GGG     Q  I+YT SPG  A LP    P S   PV K++ ILGK YED++
Sbjct  20   EHPSSANGGGG----QQNLIQYTMSPGYAAQLPHVIAPGSPLPPVHKANTILGKPYEDIK  75

Query  398  AHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
             HY+LG+ELGRGQFGVT+LCT+I TG++YACKSISKKKLVT+ DK+DM
Sbjct  76   IHYTLGRELGRGQFGVTHLCTDIATGQEYACKSISKKKLVTRSDKEDM  123



>gb|KHG26977.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=524

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +2

Query  203  SRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPG-QGAGLPTRPPSISKPVSKSDAILGK  379
            S  +H   ++S A       QP  THI   + PG Q    P  P   +KP  KSD ILGK
Sbjct  11   SNPQHNNGYKSGATTTTAAEQPQVTHI--PEKPGTQAPWKPVVPTPSAKPAPKSDTILGK  68

Query  380  AYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
             YED+R HY++GKELG+GQFGVTYLC E +TGKQYACK+ISK+KL+TK DK+DM
Sbjct  69   PYEDIRMHYTIGKELGKGQFGVTYLCIENSTGKQYACKTISKRKLITKNDKEDM  122



>gb|KJB62816.1| hypothetical protein B456_009G438300 [Gossypium raimondii]
Length=524

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 3/116 (3%)
 Frame = +2

Query  197  RSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPG-QGAGLPTRPPSISKPVSKSDAIL  373
            + S  +H   ++S A       QP  THI   + PG Q    P  P   +KP  KSD IL
Sbjct  9    KGSNPQHNNGYKSGATTTTAAEQPQPTHI--PEKPGTQAPWKPVVPTPSAKPAPKSDTIL  66

Query  374  GKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GK YED+R HY++GKELG+GQFGVTYLC E +TGKQYACK+ISK+KL+TK DK+DM
Sbjct  67   GKPYEDIRMHYTIGKELGKGQFGVTYLCIENSTGKQYACKTISKRKLITKNDKEDM  122



>ref|XP_011095398.1| PREDICTED: calcium-dependent protein kinase 33-like [Sesamum 
indicum]
Length=523

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = +2

Query  254  GGSQPHQTHIEYTKSPGQGAGLP---TRPPSISKPVSKSDAILGKAYEDVRAHYSLGKEL  424
             G    QT I++T SPG  A LP           P  K++ ILGK YEDV+AHYSLGKEL
Sbjct  22   NGVHHQQTPIQFTMSPGYAAQLPHVIPPASPAPPPAQKANTILGKPYEDVKAHYSLGKEL  81

Query  425  GRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GRGQFGVT+LCT+I TG++YACKSISKKKLVTK DK+DM
Sbjct  82   GRGQFGVTHLCTDIATGQKYACKSISKKKLVTKSDKEDM  120



>gb|KCW66999.1| hypothetical protein EUGRSUZ_F007611, partial [Eucalyptus grandis]
Length=346

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 4/84 (5%)
 Frame = +2

Query  299  PGQGA---GLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEIT  469
            P Q A    +P   PS  +PV K D ILGK YE+V++HY+LGKELGRGQFGVTYLCTEI+
Sbjct  58   PQQAAFKTSVPASSPS-PRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEIS  116

Query  470  TGKQYACKSISKKKLVTKGDKDDM  541
            TG+QYACKSISK+KLVTK DK+DM
Sbjct  117  TGRQYACKSISKRKLVTKNDKEDM  140



>emb|CDP05759.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +2

Query  269  HQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVT  448
             Q  +++TKSP   + +P +PP   +PV + D ILGK YED++ HY+LGKELGRGQFGVT
Sbjct  28   QQKPVQHTKSPAPNSQMPFKPPPSPRPVHRPDTILGKPYEDIKLHYTLGKELGRGQFGVT  87

Query  449  YLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            YLCT+I TG+QYACKSISKKKLVTKGDK+DM
Sbjct  88   YLCTDIETGRQYACKSISKKKLVTKGDKEDM  118



>ref|XP_010060348.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X2 
[Eucalyptus grandis]
Length=550

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 4/84 (5%)
 Frame = +2

Query  299  PGQGA---GLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEIT  469
            P Q A    +P   PS  +PV K D ILGK YE+V++HY+LGKELGRGQFGVTYLCTEI+
Sbjct  58   PQQAAFKTSVPASSPS-PRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEIS  116

Query  470  TGKQYACKSISKKKLVTKGDKDDM  541
            TG+QYACKSISK+KLVTK DK+DM
Sbjct  117  TGRQYACKSISKRKLVTKNDKEDM  140



>ref|XP_010060346.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X1 
[Eucalyptus grandis]
Length=535

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 4/84 (5%)
 Frame = +2

Query  299  PGQGA---GLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEIT  469
            P Q A    +P   PS  +PV K D ILGK YE+V++HY+LGKELGRGQFGVTYLCTEI+
Sbjct  58   PQQAAFKTSVPASSPS-PRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEIS  116

Query  470  TGKQYACKSISKKKLVTKGDKDDM  541
            TG+QYACKSISK+KLVTK DK+DM
Sbjct  117  TGRQYACKSISKRKLVTKNDKEDM  140



>ref|XP_002532559.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF29820.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=533

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 87/134 (65%), Gaps = 20/134 (15%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTH--IEY-TKSPGQ----------GAGLPTR  328
            MG   S+ K  ++H     + G     HQ+   + Y +KSP Q          GA +P +
Sbjct  1    MGFCLSKEKRSQQHH----YNGATGLQHQSREPVAYQSKSPAQPSYQFPSQTPGAQIPRK  56

Query  329  P--PSIS-KPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            P  P+ S KPV K D IL K YEDV+ HY++GKELGRGQFGVTYLCTEI+TGK YACKSI
Sbjct  57   PVVPAPSPKPVHKPDTILEKPYEDVKLHYTIGKELGRGQFGVTYLCTEISTGKLYACKSI  116

Query  500  SKKKLVTKGDKDDM  541
            SK+KLVT+ DK+DM
Sbjct  117  SKRKLVTRNDKEDM  130



>gb|KCW67039.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=492

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 4/84 (5%)
 Frame = +2

Query  299  PGQGA---GLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEIT  469
            P Q A    +P   PS  +PV K D ILGK YE+V++HY+LGKELGRGQFGVTYLCTEI+
Sbjct  58   PQQAAFKTSVPASSPS-PRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEIS  116

Query  470  TGKQYACKSISKKKLVTKGDKDDM  541
            TG+QYACKSISK+KLV+K DK+DM
Sbjct  117  TGRQYACKSISKRKLVSKNDKEDM  140



>ref|XP_010060380.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW67038.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=543

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 4/84 (5%)
 Frame = +2

Query  299  PGQGA---GLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEIT  469
            P Q A    +P   PS  +PV K D ILGK YE+V++HY+LGKELGRGQFGVTYLCTEI+
Sbjct  58   PQQAAFKTSVPASSPS-PRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEIS  116

Query  470  TGKQYACKSISKKKLVTKGDKDDM  541
            TG+QYACKSISK+KLV+K DK+DM
Sbjct  117  TGRQYACKSISKRKLVSKNDKEDM  140



>gb|AGJ83807.1| calcium-dependent protein kinase 1e [Vitis amurensis]
Length=536

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 3/77 (4%)
 Frame = +2

Query  320  PTRPPSIS---KPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYAC  490
            P +PP+++   KPV + D ILGK++EDV+ HY++GKELGRGQFGVTYLCTE +TG QYAC
Sbjct  57   PVKPPTVAASPKPVHRPDTILGKSFEDVKLHYTIGKELGRGQFGVTYLCTENSTGLQYAC  116

Query  491  KSISKKKLVTKGDKDDM  541
            KSISK+KLVTK DK+D+
Sbjct  117  KSISKRKLVTKNDKEDI  133



>ref|XP_002278179.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=536

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 3/77 (4%)
 Frame = +2

Query  320  PTRPPSIS---KPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYAC  490
            P +PP+++   KPV + D ILGK++EDV+ HY++GKELGRGQFGVTYLCTE +TG QYAC
Sbjct  57   PMKPPTVALSPKPVHRPDTILGKSFEDVKLHYTIGKELGRGQFGVTYLCTENSTGLQYAC  116

Query  491  KSISKKKLVTKGDKDDM  541
            KSISK+KLVTK DK+D+
Sbjct  117  KSISKRKLVTKNDKEDI  133



>ref|XP_010545509.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
 ref|XP_010545510.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
Length=534

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 85/132 (64%), Gaps = 15/132 (11%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHIE--------YTKSPGQGAGLPTRPPS-I  340
            MG   S+  HG K + + G+    ++ H++H +         +  P + AG   +PPS  
Sbjct  1    MGICFSKKNHGLKPQ-QNGYRSAEAENHRSHQDPPPYAAQQRSAQPEKPAGANQQPPSRS  59

Query  341  SKPV-----SKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISK  505
            S PV     +K   IL K YEDVR  YSLGKELGRGQFGVTYLCTE +TGKQYACKSISK
Sbjct  60   SMPVPSPKGTKHSTILEKPYEDVRLFYSLGKELGRGQFGVTYLCTENSTGKQYACKSISK  119

Query  506  KKLVTKGDKDDM  541
            KKLVTKGD++DM
Sbjct  120  KKLVTKGDREDM  131



>ref|XP_009360996.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=544

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +2

Query  215  HGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSK---SDAILGKAY  385
            H +K  S         +P +  +   + P Q A  PT P    KP ++    + ILGK +
Sbjct  31   HQQKPHSHEAAAVHQQRPEKRGLPVNQEP-QPAWKPTVPARTPKPAAQRPADNTILGKPF  89

Query  386  EDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            EDVR HY++GKELGRGQFGVTYLCTEI+TGK+YACKSISK+KLVTK DK+D+
Sbjct  90   EDVRVHYTIGKELGRGQFGVTYLCTEISTGKKYACKSISKRKLVTKNDKEDI  141



>ref|XP_006406385.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
 gb|ESQ47838.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
Length=537

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 77/124 (62%), Gaps = 17/124 (14%)
 Frame = +2

Query  209  HKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKP-------------  349
             ++G+    E  H GGG+  HQ    YT  P      P +P S   P             
Sbjct  15   QQNGQTRSVEIDHRGGGT--HQDPPSYTPQPRSQT--PEKPASQPPPWRMAAAAPGPSPK  70

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
             +KS++IL  A+EDV+  Y+LGKELGRGQFGVTYLCTE +TGK+YACKSISKKKLVTK D
Sbjct  71   ATKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTKAD  130

Query  530  KDDM  541
            KDDM
Sbjct  131  KDDM  134



>ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=541

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  305  QGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQY  484
            Q A  P+ P    KPV + D ILGK YEDV+ HY+LGKELGRGQFGVTYLCTE +TG +Y
Sbjct  62   QPAWKPSVPARHPKPVHRPDTILGKPYEDVKLHYTLGKELGRGQFGVTYLCTENSTGMKY  121

Query  485  ACKSISKKKLVTKGDKDDM  541
            ACKSISK+KLVTK DK+D+
Sbjct  122  ACKSISKRKLVTKNDKEDI  140



>ref|XP_008365060.1| PREDICTED: calcium-dependent protein kinase 2 [Malus domestica]
Length=544

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  209  HKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVS---KSDAILGK  379
            H+    H + A H     +P +  +   + P Q A  PT      KPV+     + ILGK
Sbjct  32   HQKPHSHEAAAVHQ---QRPERRGLPVNQEP-QPAWKPTVXAKTPKPVAPRPADNTILGK  87

Query  380  AYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
             +EDVR HY++GKELGRGQFGVTYLCTEI+TGK+YACKSISK+KLVTK DK+D+
Sbjct  88   PFEDVRVHYTIGKELGRGQFGVTYLCTEISTGKKYACKSISKRKLVTKNDKEDI  141



>ref|XP_007213894.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
 gb|EMJ15093.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
Length=545

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  305  QGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQY  484
            Q A  P+ P    KPV + D ILGK +EDV+ HY++GKELGRGQFGVTYLCTE +TG +Y
Sbjct  64   QPAWKPSVPVKSPKPVYRPDTILGKPFEDVKQHYTIGKELGRGQFGVTYLCTENSTGNKY  123

Query  485  ACKSISKKKLVTKGDKDDM  541
            ACKSISK+KLVTK DK+D+
Sbjct  124  ACKSISKRKLVTKNDKEDI  142



>ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 9-like isoform 1 
[Glycine max]
Length=528

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 73/108 (68%), Gaps = 3/108 (3%)
 Frame = +2

Query  227  HRSEAGHGGGGS-QPHQTHI--EYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVR  397
            +R  AG GG G    H++H    +   P      P RPP   K V K D I GK +EDV+
Sbjct  18   YRHVAGAGGAGVYNNHKSHEPPSHQPYPLPEKHAPWRPPPSPKHVHKHDTITGKPFEDVK  77

Query  398  AHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
             HY+LGKELGRGQFGVTYLCTE +TG QYACKSISK+KLV++ DK+DM
Sbjct  78   QHYTLGKELGRGQFGVTYLCTENSTGFQYACKSISKRKLVSRDDKEDM  125



>ref|XP_008226901.1| PREDICTED: calcium-dependent protein kinase 2 [Prunus mume]
Length=545

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  305  QGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQY  484
            Q A  P  P    KPV + D ILGK YEDV+ HY++GKELGRGQFGVTYLCTE +TG +Y
Sbjct  64   QPAWKPYVPVKSPKPVYRPDTILGKPYEDVKQHYTIGKELGRGQFGVTYLCTENSTGNKY  123

Query  485  ACKSISKKKLVTKGDKDDM  541
            ACKSISK+KLVTK DK+D+
Sbjct  124  ACKSISKRKLVTKNDKEDI  142



>gb|KHG28675.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=537

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 69/95 (73%), Gaps = 4/95 (4%)
 Frame = +2

Query  263  QPHQTHIEYTKSPG-QGAGLPTRPPSISKPVS-KSDAILGKAYEDVRAHYSLGKELGRGQ  436
            QP   HI   + PG Q    P  P    KPV+ + D ILGK +ED+R HY++GKELG+GQ
Sbjct  43   QPQFHHI--PEKPGTQTPWKPVAPSPSPKPVAPRVDTILGKPFEDIRMHYTIGKELGKGQ  100

Query  437  FGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            FGVTYLC E +TGKQYACK+ISKKKLVT+ DK+DM
Sbjct  101  FGVTYLCIENSTGKQYACKTISKKKLVTRNDKEDM  135



>gb|KJB13681.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
Length=481

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 2/83 (2%)
 Frame = +2

Query  299  PG-QGAGLPTRPPSISKPVS-KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITT  472
            PG Q +  P  P    KPV+ + D ILGK +ED+R HY++GKELG+GQFGVTYLC E +T
Sbjct  53   PGTQTSWKPVAPSPSPKPVAPRVDTILGKPFEDIRMHYTIGKELGKGQFGVTYLCIENST  112

Query  473  GKQYACKSISKKKLVTKGDKDDM  541
            GKQYACK+ISKKKLVT+ DK+DM
Sbjct  113  GKQYACKTISKKKLVTRNDKEDM  135



>gb|KDO62721.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
Length=207

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  347  PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKG  526
            P   ++ ILGK YEDV+ HYS GKELGRGQFGVTYLCTE +TG+Q+ACKSISK+KLVTK 
Sbjct  62   PRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTENSTGRQFACKSISKRKLVTKN  121

Query  527  DKDDM  541
            DKDD+
Sbjct  122  DKDDI  126



>gb|KJB13679.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13680.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13682.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
Length=537

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 2/83 (2%)
 Frame = +2

Query  299  PG-QGAGLPTRPPSISKPVS-KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITT  472
            PG Q +  P  P    KPV+ + D ILGK +ED+R HY++GKELG+GQFGVTYLC E +T
Sbjct  53   PGTQTSWKPVAPSPSPKPVAPRVDTILGKPFEDIRMHYTIGKELGKGQFGVTYLCIENST  112

Query  473  GKQYACKSISKKKLVTKGDKDDM  541
            GKQYACK+ISKKKLVT+ DK+DM
Sbjct  113  GKQYACKTISKKKLVTRNDKEDM  135



>ref|XP_008385882.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
isoform 2 [Malus domestica]
Length=470

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 3/82 (4%)
 Frame = +2

Query  305  QGAGLPTRPPSISKPVSK---SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTG  475
            Q A  PT P    KP ++    + ILGK +EDVR  Y++GKELGRGQFGVTYLCTEI+TG
Sbjct  39   QPAWKPTFPAXNPKPAAQGPSDNTILGKPFEDVRLRYTIGKELGRGQFGVTYLCTEISTG  98

Query  476  KQYACKSISKKKLVTKGDKDDM  541
            K+YACKSISK+KLVTK DK+D+
Sbjct  99   KKYACKSISKRKLVTKNDKEDI  120



>gb|KDO62718.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62719.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62720.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
Length=235

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  347  PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKG  526
            P   ++ ILGK YEDV+ HYS GKELGRGQFGVTYLCTE +TG+Q+ACKSISK+KLVTK 
Sbjct  62   PRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTENSTGRQFACKSISKRKLVTKN  121

Query  527  DKDDM  541
            DKDD+
Sbjct  122  DKDDI  126



>ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=538

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 67/92 (73%), Gaps = 2/92 (2%)
 Frame = +2

Query  269  HQTHI-EYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGV  445
             QTH+    + P   A  P +P S    V K D ILGK +ED++AHY+LGKELGRGQFGV
Sbjct  45   QQTHLLPERRQPQPPAAAPVKP-SPHSLVHKQDTILGKPFEDIKAHYTLGKELGRGQFGV  103

Query  446  TYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            TYLCTE +TG  YACKSISK+KLV+K DKDD+
Sbjct  104  TYLCTENSTGHTYACKSISKRKLVSKNDKDDI  135



>gb|ABC59619.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMT05971.1| Calcium-dependent protein kinase isoform 2 [Aegilops tauschii]
Length=532

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 2/67 (3%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            SKP+   D ILGK YEDVR+ YSLGKELGRGQFGVTYLCTEI+TG+QYACKSISK+KLV+
Sbjct  66   SKPMP--DTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEISTGRQYACKSISKRKLVS  123

Query  521  KGDKDDM  541
            K DK+D+
Sbjct  124  KADKEDI  130



>gb|ABD98803.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|ABY59008.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMS66675.1| Calcium-dependent protein kinase isoform 2 [Triticum urartu]
Length=532

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 2/67 (3%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            SKP+   D ILGK YEDVR+ YSLGKELGRGQFGVTYLCTEI+TG+QYACKSISK+KLV+
Sbjct  66   SKPMP--DTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEISTGRQYACKSISKRKLVS  123

Query  521  KGDKDDM  541
            K DK+D+
Sbjct  124  KADKEDI  130



>gb|ABB54456.1| calcium-dependent protein kinase [Hordeum brevisubulatum]
Length=532

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 2/67 (3%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            SKP+   D ILGK YEDVR+ YSLGKELGRGQFGVTYLCTEI+TG+QYACKSISK+KLV+
Sbjct  66   SKPMP--DTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEISTGRQYACKSISKRKLVS  123

Query  521  KGDKDDM  541
            K DK+D+
Sbjct  124  KADKEDI  130



>ref|XP_002883243.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59502.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTK  523
            K  SKS++IL  A+EDV+  Y+LGKELGRGQFGVTYLCTE +TGK+YACKSISKKKLVTK
Sbjct  71   KTTSKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTK  130

Query  524  GDKDDM  541
             DKDDM
Sbjct  131  ADKDDM  136



>ref|XP_006657762.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Oryza brachyantha]
Length=531

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK YEDVR+ YSLGKELGRGQFGVTYLCTEI TGKQYACKSISK+KLV+K DK+D+
Sbjct  71   DTILGKPYEDVRSAYSLGKELGRGQFGVTYLCTEIATGKQYACKSISKRKLVSKADKEDI  130



>ref|XP_006657761.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Oryza brachyantha]
Length=559

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK YEDVR+ YSLGKELGRGQFGVTYLCTEI TGKQYACKSISK+KLV+K DK+D+
Sbjct  71   DTILGKPYEDVRSAYSLGKELGRGQFGVTYLCTEIATGKQYACKSISKRKLVSKADKEDI  130



>gb|KJB81729.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=444

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +2

Query  263  QPHQTHIEYTKSPG-QGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQF  439
            QP   HI   + PG Q    P  P    KP    D ILGK +ED+R HY++GKELG+GQF
Sbjct  43   QPQVYHI--PQKPGTQTPWKPAVPAPSPKPTPNIDTILGKPFEDIRIHYTIGKELGKGQF  100

Query  440  GVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GVTY CTE +TGKQYACK+ISK+KLV K DK+DM
Sbjct  101  GVTYHCTENSTGKQYACKTISKRKLVRKNDKEDM  134



>ref|XP_006452345.1| hypothetical protein CICLE_v10007978mg [Citrus clementina]
 ref|XP_006475077.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
 gb|ESR65585.1| hypothetical protein CICLE_v10007978mg [Citrus clementina]
 gb|KDO62704.1| hypothetical protein CISIN_1g009561mg [Citrus sinensis]
Length=532

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = +2

Query  344  KPVSK-SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            KP+SK SD +LGKAY+DVR +Y+LGK+LGRGQFGVTYLCTE +TG+Q+ACKSI+K+KLVT
Sbjct  45   KPLSKTSDPVLGKAYDDVRLYYNLGKKLGRGQFGVTYLCTEKSTGRQFACKSIAKRKLVT  104

Query  521  KGDKDDM  541
            K DKDD+
Sbjct  105  KNDKDDI  111



>dbj|BAJ99143.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 2/67 (3%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            SKP    D ILGK YEDVR+ YSLGKELGRGQFGVTYLCTEI+TG+QYACKSISK+KLV+
Sbjct  66   SKPTP--DTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEISTGRQYACKSISKRKLVS  123

Query  521  KGDKDDM  541
            K DK+D+
Sbjct  124  KADKEDI  130



>gb|KJB81728.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=480

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +2

Query  263  QPHQTHIEYTKSPG-QGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQF  439
            QP   HI   + PG Q    P  P    KP    D ILGK +ED+R HY++GKELG+GQF
Sbjct  43   QPQVYHI--PQKPGTQTPWKPAVPAPSPKPTPNIDTILGKPFEDIRIHYTIGKELGKGQF  100

Query  440  GVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GVTY CTE +TGKQYACK+ISK+KLV K DK+DM
Sbjct  101  GVTYHCTENSTGKQYACKTISKRKLVRKNDKEDM  134



>ref|XP_010508871.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
 ref|XP_010508878.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
Length=541

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 67/98 (68%), Gaps = 12/98 (12%)
 Frame = +2

Query  248  GGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELG  427
            G G SQP          P + A      P  S   +KS++IL  A+EDV+  Y+LGKELG
Sbjct  51   GSGNSQP---------PPWRTAA---AAPGPSPKTTKSNSILENAFEDVKLFYTLGKELG  98

Query  428  RGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            RGQFGVTYLCTE +TGK+YACKSISKKKLVTK DKDDM
Sbjct  99   RGQFGVTYLCTENSTGKKYACKSISKKKLVTKADKDDM  136



>gb|AAP03014.1| seed calcium dependent protein kinase c [Glycine max]
Length=537

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 73/102 (72%), Gaps = 7/102 (7%)
 Frame = +2

Query  257  GSQPHQTHIEYTKSPGQGA--GLPTRPP--SIS-KPVS--KSDAILGKAYEDVRAHYSLG  415
             +QP+  H ++  S  Q     +P +PP  ++S KPV   + D ILGK +EDV+  Y+LG
Sbjct  28   ANQPYHLHEKHAASTAQTVPQNMPWKPPGPALSPKPVVGVRQDTILGKQFEDVKQFYTLG  87

Query  416  KELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            KELGRGQFGVTYLCTE +TG QYACKSISK+KL +K DK+D+
Sbjct  88   KELGRGQFGVTYLCTENSTGLQYACKSISKRKLASKSDKEDI  129



>ref|XP_010466227.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466228.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466229.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
Length=542

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 67/98 (68%), Gaps = 12/98 (12%)
 Frame = +2

Query  248  GGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELG  427
            G G SQP          P + A      P  S   +KS++IL  A+EDV+  Y+LGKELG
Sbjct  52   GSGNSQP---------PPWRTAA---AAPGPSPKTTKSNSILENAFEDVKLFYTLGKELG  99

Query  428  RGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            RGQFGVTYLCTE +TGK+YACKSISKKKLVTK DKDDM
Sbjct  100  RGQFGVTYLCTENSTGKKYACKSISKKKLVTKADKDDM  137



>ref|NP_188676.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
 sp|Q38868.1|CDPK9_ARATH RecName: Full=Calcium-dependent protein kinase 9; AltName: Full=Calmodulin-domain 
protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAB03242.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 dbj|BAB02824.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAM53285.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAP68337.1| At3g20410 [Arabidopsis thaliana]
 gb|AEE76375.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
Length=541

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTK  523
            K  +KS++IL  A+EDV+  Y+LGKELGRGQFGVTYLCTE +TGK+YACKSISKKKLVTK
Sbjct  71   KTTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTK  130

Query  524  GDKDDM  541
             DKDDM
Sbjct  131  ADKDDM  136



>gb|ABC59620.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 2/67 (3%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            SKP+   D ILGK Y+DVR+ YSLGKELGRGQFGVTYLCTEI+TG+QYACKSISK+KLV+
Sbjct  66   SKPMP--DTILGKQYQDVRSVYSLGKELGRGQFGVTYLCTEISTGRQYACKSISKRKLVS  123

Query  521  KGDKDDM  541
            K DK+D+
Sbjct  124  KADKEDI  130



>gb|KFK39368.1| hypothetical protein AALP_AA3G235800 [Arabis alpina]
Length=535

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 63/83 (76%), Gaps = 9/83 (11%)
 Frame = +2

Query  320  PTRPPSI---------SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITT  472
            P++PP           S   +KS++IL  A+EDV+  Y+LGKELGRGQFGVTYLCTE +T
Sbjct  50   PSQPPPWRMAAAAPGPSPKTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENST  109

Query  473  GKQYACKSISKKKLVTKGDKDDM  541
            GK+YACKSISKKKLVTK DKDDM
Sbjct  110  GKKYACKSISKKKLVTKADKDDM  132



>gb|ACJ61504.1| calcium-dependent protein kinase [Glycine max]
 gb|KHM99562.1| Calcium-dependent protein kinase isoform 2 [Glycine soja]
Length=551

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 73/102 (72%), Gaps = 7/102 (7%)
 Frame = +2

Query  257  GSQPHQTHIEYTKSPGQGA--GLPTRPP--SIS-KPVS--KSDAILGKAYEDVRAHYSLG  415
             +QP+  H ++  S  Q     +P +PP  ++S KPV   + D ILGK +EDV+  Y+LG
Sbjct  41   ANQPYHLHEKHAASTAQTVPQNMPWKPPGPALSPKPVVGVRQDTILGKQFEDVKQFYTLG  100

Query  416  KELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            KELGRGQFGVTYLCTE +TG QYACKSISK+KL +K DK+D+
Sbjct  101  KELGRGQFGVTYLCTENSTGLQYACKSISKRKLASKSDKEDI  142



>gb|KJB81727.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=536

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +2

Query  263  QPHQTHIEYTKSPG-QGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQF  439
            QP   HI   + PG Q    P  P    KP    D ILGK +ED+R HY++GKELG+GQF
Sbjct  43   QPQVYHI--PQKPGTQTPWKPAVPAPSPKPTPNIDTILGKPFEDIRIHYTIGKELGKGQF  100

Query  440  GVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GVTY CTE +TGKQYACK+ISK+KLV K DK+DM
Sbjct  101  GVTYHCTENSTGKQYACKTISKRKLVRKNDKEDM  134



>ref|XP_003563028.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Brachypodium 
distachyon]
Length=532

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 2/67 (3%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            SKP    D ILGK YEDVR+ YSLGKELGRGQFGVTYLCTEI TG+QYACKSISK+KLV+
Sbjct  65   SKPTP--DTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEIATGRQYACKSISKRKLVS  122

Query  521  KGDKDDM  541
            K DK+D+
Sbjct  123  KADKEDI  129



>gb|KHG17079.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=536

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +2

Query  263  QPHQTHIEYTKSPG-QGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQF  439
            QP   HI   + PG Q    P  P    KP    D ILGK +ED+R HY++GKELG+GQF
Sbjct  43   QPRVYHI--PQKPGTQTPWKPAVPAPSPKPAPNIDTILGKPFEDIRMHYTIGKELGKGQF  100

Query  440  GVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GVTY CTE +TGKQYACK+ISK+KLV K DK+DM
Sbjct  101  GVTYHCTENSTGKQYACKTISKRKLVRKNDKEDM  134



>gb|AAD17800.1| Ca2+-dependent protein kinase [Mesembryanthemum crystallinum]
Length=534

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 3/76 (4%)
 Frame = +2

Query  320  PTRPPSISKPVSKS--DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            P R PS  KP  K   + ILGK +EDV+ +Y+LG+ELGRGQFGVTYLCT+  TG+QYACK
Sbjct  57   PVRMPS-PKPAPKVEPNTILGKPFEDVKVYYTLGRELGRGQFGVTYLCTDKKTGQQYACK  115

Query  494  SISKKKLVTKGDKDDM  541
            SISKKKLVTK DKDDM
Sbjct  116  SISKKKLVTKADKDDM  131



>ref|XP_007142270.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
 gb|ESW14264.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
Length=525

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 69/104 (66%), Gaps = 5/104 (5%)
 Frame = +2

Query  245  HGGGGSQPHQTHIEYT-----KSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYS  409
            H  GG+  H++H  +      K   Q A  PT      K V ++D I GK  EDV+ HY+
Sbjct  20   HVVGGAHNHKSHEPFVNQLPEKHAPQAAWRPTVHSPSPKHVHRADTITGKPLEDVKQHYT  79

Query  410  LGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            LGKELGRGQFGVTYLCTE +TG QYACKSISK+KLV + DK+DM
Sbjct  80   LGKELGRGQFGVTYLCTENSTGLQYACKSISKRKLVRRDDKEDM  123



>ref|XP_006452370.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65610.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=472

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  347  PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKG  526
            P   ++ ILGK YEDV+ HYS GKELGRGQFGVTYLCTE +TG+Q+ACKSISK+KLVTK 
Sbjct  62   PRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTENSTGRQFACKSISKRKLVTKN  121

Query  527  DKDDM  541
            DKDD+
Sbjct  122  DKDDI  126



>ref|XP_006297378.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
 gb|EOA30276.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
Length=540

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  353  SKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDK  532
            +KS++IL  A+EDV+  Y+LGKELGRGQFGVTYLCTE +TGK+YACKSISKKKLVTK DK
Sbjct  73   TKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTKADK  132

Query  533  DDM  541
            DDM
Sbjct  133  DDM  135



>ref|NP_001105542.1| calcium-dependent protein kinase 2 [Zea mays]
 sp|P49101.1|CDPK2_MAIZE RecName: Full=Calcium-dependent protein kinase 2; Short=CDPK 
2 [Zea mays]
 gb|AAA69507.1| calcium-dependent protein kinase [Zea mays]
Length=513

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 66/102 (65%), Gaps = 9/102 (9%)
 Frame = +2

Query  263  QPHQTHIEYTKSPGQGAGLPTRPPSISKPVSK---------SDAILGKAYEDVRAHYSLG  415
            Q  + H+     P Q A +   P + +              +D ILGK YEDVR+ YS G
Sbjct  9    QSRRKHLRVYNPPQQAAEVRYTPSATNSSAVPPVAVPPKPTADTILGKQYEDVRSVYSFG  68

Query  416  KELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            KELGRGQFGVTYLCTEI +G+QYACKSISK+KLV+K D++D+
Sbjct  69   KELGRGQFGVTYLCTEIASGRQYACKSISKRKLVSKADREDI  110



>ref|XP_008651864.1| PREDICTED: calcium-dependent protein kinase 2 isoform X1 [Zea 
mays]
Length=531

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  359  SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDD  538
            +D ILGK YEDVR+ YSLGKELGRGQFGVTYLCTEI +G+QYACKSISK+KLV+K D++D
Sbjct  68   ADTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEIASGRQYACKSISKRKLVSKADRED  127

Query  539  M  541
            +
Sbjct  128  I  128



>ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=529

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  347  PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKG  526
            P   ++ ILGK YEDV+ HYS GKELGRGQFGVTYLCTE +TG+Q+ACKSISK+KLVTK 
Sbjct  62   PRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTENSTGRQFACKSISKRKLVTKN  121

Query  527  DKDDM  541
            DKDD+
Sbjct  122  DKDDI  126



>emb|CDP04396.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 67/97 (69%), Gaps = 4/97 (4%)
 Frame = +2

Query  263  QPHQTHIEYTKSPGQG--AGLPTRPPSISKPVSKS--DAILGKAYEDVRAHYSLGKELGR  430
            QPHQ    Y   P     A    +PP   +P  +   + ILGK ++DVRAHY+LG+ELG+
Sbjct  50   QPHQAERFYQPQPPSSVPAKPSAQPPQRPRPAQRQEPNTILGKPFDDVRAHYTLGRELGK  109

Query  431  GQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GQFGVTYLCTE  TG++YACKSI K+KLV+K DK+DM
Sbjct  110  GQFGVTYLCTENATGQKYACKSILKRKLVSKNDKEDM  146



>gb|AAQ17506.1| calcium dependent protein kinase 3 [Oryza sativa Japonica Group]
Length=527

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK Y+DVR+ YSLGKELGRGQFGVTYLCTEI +GKQYACKSISK+KLV+K DK+D+
Sbjct  71   DTILGKLYDDVRSVYSLGKELGRGQFGVTYLCTEIASGKQYACKSISKRKLVSKADKEDI  130



>emb|CAA57157.1| calcium-dependent protein kinase [Oryza sativa Japonica Group]
 gb|EAZ04052.1| hypothetical protein OsI_26188 [Oryza sativa Indica Group]
Length=533

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK Y+DVR+ YSLGKELGRGQFGVTYLCTEI +GKQYACKSISK+KLV+K DK+D+
Sbjct  71   DTILGKLYDDVRSVYSLGKELGRGQFGVTYLCTEIASGKQYACKSISKRKLVSKADKEDI  130



>ref|XP_007020822.1| Calmodulin-domain protein kinase 9 isoform 3 [Theobroma cacao]
 gb|EOY12347.1| Calmodulin-domain protein kinase 9 isoform 3 [Theobroma cacao]
Length=382

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  356  KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKD  535
            + D ILGK YED+R  Y++GKELG+GQFGVTYLCTE +TGKQYACK+ISK+KLVTK DK+
Sbjct  73   RVDTILGKPYEDIRMRYTIGKELGKGQFGVTYLCTENSTGKQYACKTISKRKLVTKNDKE  132

Query  536  DM  541
            DM
Sbjct  133  DM  134



>ref|NP_001059775.1| Os07g0515100 [Oryza sativa Japonica Group]
 sp|P53683.2|CDPK2_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform 2; Short=CDPK 
2 [Oryza sativa Japonica Group]
 dbj|BAC20693.1| CDP2_ORYSA Calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF21689.1| Os07g0515100 [Oryza sativa Japonica Group]
Length=533

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK Y+DVR+ YSLGKELGRGQFGVTYLCTEI +GKQYACKSISK+KLV+K DK+D+
Sbjct  71   DTILGKPYDDVRSVYSLGKELGRGQFGVTYLCTEIASGKQYACKSISKRKLVSKADKEDI  130



>gb|KDP39132.1| hypothetical protein JCGZ_00889 [Jatropha curcas]
Length=535

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 13/97 (13%)
 Frame = +2

Query  290  TKSPGQGA-GLPTRPPSI------------SKPVSKSDAILGKAYEDVRAHYSLGKELGR  430
            +KSP Q    LP++ P I             KPV K D IL K +ED+R HY++GKELGR
Sbjct  36   SKSPVQPTYQLPSQQPPIHVPRKPAAPAPSPKPVQKPDTILEKPFEDLRLHYTIGKELGR  95

Query  431  GQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GQFGVTYLCTE +TG++YACKSISK+KLVTK DK+DM
Sbjct  96   GQFGVTYLCTENSTGRRYACKSISKRKLVTKNDKEDM  132



>gb|ADM14342.1| calcium-dependent protein kinase 19 [Oryza sativa Japonica Group]
Length=533

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK Y+DVR+ YSLGKELGRGQFGVTYLCTEI +GKQYACKSISK+KLV+K DK+D+
Sbjct  71   DTILGKPYDDVRSVYSLGKELGRGQFGVTYLCTEIASGKQYACKSISKRKLVSKADKEDI  130



>gb|ABD98804.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 2/67 (3%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            SKP+   D ILGK Y+DVR+ Y LGKELGRGQFGVTYLCTEI+TG+QYACKSISK+KLV+
Sbjct  66   SKPMP--DTILGKQYDDVRSVYPLGKELGRGQFGVTYLCTEISTGRQYACKSISKRKLVS  123

Query  521  KGDKDDM  541
            K DK+D+
Sbjct  124  KADKEDI  130



>ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=680

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  347  PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKG  526
            P   ++ ILGK YEDV+ HYS GKELGRGQFGVTYLCTE +TG+Q+ACKSISK+KLVTK 
Sbjct  62   PRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTENSTGRQFACKSISKRKLVTKN  121

Query  527  DKDDM  541
            DKDD+
Sbjct  122  DKDDI  126



>ref|NP_001235641.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
 gb|AAB80693.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
Length=538

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 73/102 (72%), Gaps = 7/102 (7%)
 Frame = +2

Query  257  GSQPHQTHIEYTKSPGQGA--GLPTRPP--SIS-KPVS--KSDAILGKAYEDVRAHYSLG  415
             +QP+  H ++  S  Q     +P +PP  ++S KPV   + D ILGK +EDV+  ++LG
Sbjct  28   ANQPYHLHEKHAASTAQTVPQNMPWKPPGPALSPKPVVGVRQDTILGKQFEDVKQFHTLG  87

Query  416  KELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            KELGRGQFGVTYLCTE +TG QYACKSISK+KL +K DK+D+
Sbjct  88   KELGRGQFGVTYLCTENSTGLQYACKSISKRKLASKSDKEDI  129



>ref|XP_007020821.1| Calmodulin-domain protein kinase 9 isoform 2 [Theobroma cacao]
 gb|EOY12346.1| Calmodulin-domain protein kinase 9 isoform 2 [Theobroma cacao]
Length=390

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  356  KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKD  535
            + D ILGK YED+R  Y++GKELG+GQFGVTYLCTE +TGKQYACK+ISK+KLVTK DK+
Sbjct  73   RVDTILGKPYEDIRMRYTIGKELGKGQFGVTYLCTENSTGKQYACKTISKRKLVTKNDKE  132

Query  536  DM  541
            DM
Sbjct  133  DM  134



>gb|KHN02836.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=551

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 7/102 (7%)
 Frame = +2

Query  257  GSQPHQTHIEYTKSPGQGA--GLPTRP--PSIS-KPVS--KSDAILGKAYEDVRAHYSLG  415
             +QP+    ++  S  Q     +P +P  P++S KPV   + D ILGK +EDV+  Y+LG
Sbjct  41   ANQPYHLPEKHAASTAQTVPQNMPWKPSGPALSPKPVVSVRQDTILGKQFEDVKQFYTLG  100

Query  416  KELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            KELGRGQFGVTYLCTE +TG QYACKSISK+KLV K DK+D+
Sbjct  101  KELGRGQFGVTYLCTENSTGLQYACKSISKRKLVKKSDKEDI  142



>gb|KFK35914.1| hypothetical protein AALP_AA4G052700 [Arabis alpina]
Length=512

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 65/96 (68%), Gaps = 4/96 (4%)
 Frame = +2

Query  254  GGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRG  433
             G +     IE       GA  P R P+  + +S    IL K YEDV+  Y+L KELGRG
Sbjct  18   NGGEERSVEIENRGRSTTGAS-PWRKPTPPRSLS---TILEKPYEDVKQFYTLSKELGRG  73

Query  434  QFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            QFGVTYLCTEITTGK++ACKSISKKKLVTK DK+DM
Sbjct  74   QFGVTYLCTEITTGKRFACKSISKKKLVTKSDKEDM  109



>ref|XP_004957849.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Setaria italica]
 gb|AGG54988.1| CDPK1, partial [Setaria italica]
Length=531

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK YEDVR  YSLGKELGRGQFGVTYLCTEI TG+QYACKSISK+KL +K D++D+
Sbjct  69   DTILGKQYEDVRTVYSLGKELGRGQFGVTYLCTEIATGRQYACKSISKRKLTSKADREDI  128



>ref|XP_008349938.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
isoform 2-like [Malus domestica]
Length=453

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            + ILGK +EDVR  Y++GKELGRGQFGVTYLCTEI+TGK+YACKSISK+KLVTK DK+D+
Sbjct  44   NTILGKPFEDVRLRYTIGKELGRGQFGVTYLCTEISTGKKYACKSISKRKLVTKNDKEDI  103



>ref|XP_007020820.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
 gb|EOY12345.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
Length=536

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  356  KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKD  535
            + D ILGK YED+R  Y++GKELG+GQFGVTYLCTE +TGKQYACK+ISK+KLVTK DK+
Sbjct  73   RVDTILGKPYEDIRMRYTIGKELGKGQFGVTYLCTENSTGKQYACKTISKRKLVTKNDKE  132

Query  536  DM  541
            DM
Sbjct  133  DM  134



>ref|NP_001105306.1| calcium-dependent protein kinase [Zea mays]
 dbj|BAA12715.1| calcium-dependent protein kinase [Zea mays]
 gb|ACN30810.1| unknown [Zea mays]
 gb|ACN34633.1| unknown [Zea mays]
 tpg|DAA40972.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
 tpg|DAA40973.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 2 [Zea mays]
 tpg|DAA40974.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 3 [Zea mays]
 tpg|DAA40975.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 4 [Zea mays]
Length=531

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  359  SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDD  538
            +D ILGK YEDVR+ YSLGKELGRGQFGVTYLCTE+ +GKQYACKSISK+KL +K D++D
Sbjct  68   ADTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEVASGKQYACKSISKRKLTSKADRED  127

Query  539  M  541
            +
Sbjct  128  I  128



>ref|XP_004957848.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Setaria italica]
Length=559

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK YEDVR  YSLGKELGRGQFGVTYLCTEI TG+QYACKSISK+KL +K D++D+
Sbjct  69   DTILGKQYEDVRTVYSLGKELGRGQFGVTYLCTEIATGRQYACKSISKRKLTSKADREDI  128



>ref|XP_010455773.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=536

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 71/124 (57%), Gaps = 18/124 (15%)
 Frame = +2

Query  224  KHRSEAGHGGGGS---QPHQTHIEYTKSPGQGAGLPTRPP---------SISKP------  349
            KHR    HGG  S    P QTH+       +   +PT  P          +S P      
Sbjct  7    KHRKTQNHGGERSIPINPIQTHVPNQVPEHRKPQIPTPKPKPTNQPIHQQVSTPSSNPIS  66

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
            V   D ILGK +ED+R  YSLGKELGRGQFG+TY+C EI TG  YACKSI K+KL++K D
Sbjct  67   VRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIETGNTYACKSILKRKLISKQD  126

Query  530  KDDM  541
            K+D+
Sbjct  127  KEDV  130



>emb|CDX82244.1| BnaA03g35770D [Brassica napus]
Length=534

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  365  AILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            +IL  AYEDV+  Y+LGKELGRGQFGVTYLCTE +TGK+YACKSISKKKLVTK DKDDM
Sbjct  67   SILENAYEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTKADKDDM  125



>ref|XP_009135689.1| PREDICTED: calcium-dependent protein kinase 9 [Brassica rapa]
Length=542

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  365  AILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            +IL  AYEDV+  Y+LGKELGRGQFGVTYLCTE +TGK+YACKSISKKKLVTK DKDDM
Sbjct  75   SILENAYEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTKADKDDM  133



>gb|ACR34538.1| unknown [Zea mays]
Length=531

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  359  SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDD  538
            +D ILGK YEDVR+ YSLGKELGRGQF VTYLCTEI +G+QYACKSISK+KLV+K D++D
Sbjct  68   ADTILGKQYEDVRSVYSLGKELGRGQFRVTYLCTEIASGRQYACKSISKRKLVSKADRED  127

Query  539  M  541
            +
Sbjct  128  I  128



>emb|CDY36037.1| BnaC03g41610D [Brassica napus]
Length=531

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            IL  AYEDV+  Y+LGKELGRGQFGVTYLCTE +TGK+YACKSISKKKLVTK DKDDM
Sbjct  66   ILENAYEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTKADKDDM  123



>ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis]
 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis]
Length=548

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTK  523
            K + ++D ILGK +ED++ HY+ GKELGRGQFGVTYLCTE +TG+ YACKSISK+KLV+K
Sbjct  81   KHIQRTDTILGKPFEDIKNHYTFGKELGRGQFGVTYLCTENSTGRLYACKSISKRKLVSK  140

Query  524  GDKDDM  541
             DK+DM
Sbjct  141  NDKEDM  146



>gb|AGG35978.1| calcium-dependent protein kinase 9, partial [Brassica napus]
Length=539

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            IL  AYEDV+  Y+LGKELGRGQFGVTYLCTE +TGK+YACKSISKKKLVTK DKDDM
Sbjct  74   ILENAYEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTKADKDDM  131



>ref|XP_004152931.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 ref|XP_004172987.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 gb|KGN56125.1| hypothetical protein Csa_3G077600 [Cucumis sativus]
Length=519

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query  308  GAGLPTRPPSISKPV-SKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQY  484
            G   P+ PP   K    +SD ILGK  EDV+ HY++GKELGRGQFGVTYLCTE ++GKQY
Sbjct  39   GGAKPSGPPKSPKHTPFRSDTILGKPLEDVKLHYTIGKELGRGQFGVTYLCTENSSGKQY  98

Query  485  ACKSISKKKLVTKGDKDDM  541
            ACKSI K+KLVTK DK+D+
Sbjct  99   ACKSILKRKLVTKNDKEDI  117



>ref|NP_175485.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
 sp|Q9C6P3.1|CDPKX_ARATH RecName: Full=Calcium-dependent protein kinase 33 [Arabidopsis 
thaliana]
 gb|AAG51192.1|AC079279_13 calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAT06478.1| At1g50700 [Arabidopsis thaliana]
 dbj|BAD43386.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32581.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
Length=521

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = +2

Query  323  TRPPSISKPV--SKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
             +PP    P   S + AIL K YEDV+  Y+L KELGRGQFGVTYLCTE +TGK++ACKS
Sbjct  44   NQPPPWRNPAKHSGAAAILEKPYEDVKLFYTLSKELGRGQFGVTYLCTEKSTGKRFACKS  103

Query  497  ISKKKLVTKGDKDDM  541
            ISKKKLVTKGDK+DM
Sbjct  104  ISKKKLVTKGDKEDM  118



>gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng]
Length=549

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = +2

Query  329  PPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKK  508
            P  + KP  + + ILGK +ED+RAHY+LGKELGRGQFGVTYLCTEI++G  YACKSI K+
Sbjct  77   PRPVHKP--EPNTILGKKFEDIRAHYTLGKELGRGQFGVTYLCTEISSGHFYACKSILKR  134

Query  509  KLVTKGDKDDM  541
            KLV+K DK+DM
Sbjct  135  KLVSKNDKEDM  145



>gb|AFY10519.1| calcium dependent protein kinase 1 [Dendrobium catenatum]
Length=525

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 3/71 (4%)
 Frame = +2

Query  329  PPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKK  508
            PP   KP   ++ ILGK +EDVR+HYSLGKELGRGQFGVTY C EI TG  YACKSISK+
Sbjct  55   PP---KPAPTNNTILGKPFEDVRSHYSLGKELGRGQFGVTYFCKEIATGHSYACKSISKR  111

Query  509  KLVTKGDKDDM  541
            KLV K DK+D+
Sbjct  112  KLVHKNDKEDI  122



>emb|CDX91224.1| BnaC02g26350D [Brassica napus]
Length=434

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 76/124 (61%), Gaps = 11/124 (9%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHI--EYTK--SPGQGAGLPTRPPSISKP--  349
            MG  SS+H+  E     A        P QTH+  E+ K  +P     +   PPS S P  
Sbjct  1    MGCLSSKHRQEET----AAKPSTPITPAQTHVVPEHRKPQTPPTHHQISAPPPS-SNPTT  55

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
            V   D ILGK +ED+R  YSLGKELGRGQFG+TY C EI+TG  YACKSI K+KL++K D
Sbjct  56   VRDHDTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSILKRKLISKQD  115

Query  530  KDDM  541
            K+D+
Sbjct  116  KEDV  119



>ref|XP_010422295.1| PREDICTED: calcium-dependent protein kinase 21 [Camelina sativa]
Length=534

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 70/122 (57%), Gaps = 16/122 (13%)
 Frame = +2

Query  224  KHRSEAGHGGGGS---QPHQTHIEYTKSPGQGAGLPTRPPS-------ISKP------VS  355
            KHR    HGG  S    P Q H+       +   +P   P+       IS P      V 
Sbjct  7    KHRKTQNHGGERSIPINPVQAHVANQAPEHRKPQIPIPKPTNQPIHQQISTPSSNPISVR  66

Query  356  KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKD  535
              D ILGK +ED+R  YSLGKELGRGQFG+TY+C EI TG  YACKSI K+KL++K DK+
Sbjct  67   DPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIETGNTYACKSILKRKLISKQDKE  126

Query  536  DM  541
            D+
Sbjct  127  DV  128



>gb|KEH33831.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=538

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 64/81 (79%), Gaps = 6/81 (7%)
 Frame = +2

Query  317  LPTRPPSIS----KPVSKSDA--ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGK  478
            +PT+P SIS    KP+ K D+  ILGK  EDV+  Y+LGKELGRGQFGVT+LCTE +TG 
Sbjct  49   IPTKPSSISAPSPKPLIKQDSNTILGKGLEDVKQFYTLGKELGRGQFGVTFLCTENSTGL  108

Query  479  QYACKSISKKKLVTKGDKDDM  541
             YACKSISK+KLV+K D++D+
Sbjct  109  LYACKSISKRKLVSKSDREDI  129



>gb|ABE72958.1| calcium dependent protein kinase 3 [Medicago truncatula]
Length=538

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 64/81 (79%), Gaps = 6/81 (7%)
 Frame = +2

Query  317  LPTRPPSIS----KPVSKSDA--ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGK  478
            +PT+P SIS    KP+ K D+  ILGK  EDV+  Y+LGKELGRGQFGVT+LCTE +TG 
Sbjct  49   IPTKPSSISAPSPKPLIKQDSNTILGKGLEDVKQFYTLGKELGRGQFGVTFLCTENSTGL  108

Query  479  QYACKSISKKKLVTKGDKDDM  541
             YACKSISK+KLV+K D++D+
Sbjct  109  LYACKSISKRKLVSKSDREDI  129



>emb|CAA65500.1| protein kinase [Medicago sativa]
Length=542

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 6/81 (7%)
 Frame = +2

Query  317  LPTRPPSIS----KPVSKSDA--ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGK  478
            +PT+P SIS    KP+ K D   ILGK  EDV+  Y+LGKELGRGQFGVT+LCTE +TG 
Sbjct  53   IPTKPSSISAPSPKPLIKQDTNTILGKGLEDVKQFYTLGKELGRGQFGVTFLCTENSTGL  112

Query  479  QYACKSISKKKLVTKGDKDDM  541
             YACKSISK+KLV+K D++D+
Sbjct  113  LYACKSISKRKLVSKSDREDI  133



>ref|XP_010675716.1| PREDICTED: calcium-dependent protein kinase 33-like [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            + ILGK +EDV+ HY+LGKELGRGQFGVTYLC + T+G+QYACKSISKKKLVT+ DK+DM
Sbjct  74   NTILGKPFEDVKMHYTLGKELGRGQFGVTYLCVDKTSGQQYACKSISKKKLVTRADKEDM  133



>ref|XP_009144515.1| PREDICTED: calcium-dependent protein kinase 21 [Brassica rapa]
 emb|CDX97315.1| BnaA02g21060D [Brassica napus]
Length=520

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 75/126 (60%), Gaps = 20/126 (16%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHI--EYTKSPGQGAGLPTRPPS---ISKP-  349
            MG  SS+H+  E     A        P QTH+  E+ K        P  PP+   IS P 
Sbjct  1    MGCLSSKHRQEET----AAKPSTPITPAQTHVVPEHRK--------PQTPPTHHQISAPP  48

Query  350  --VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTK  523
              V   D ILGK +ED+R  YSLGKELGRGQFG+TY C EI+TG  YACKSI K+KL++K
Sbjct  49   ATVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSILKRKLISK  108

Query  524  GDKDDM  541
             DK+D+
Sbjct  109  QDKEDV  114



>gb|AGG35970.1| calcium-dependent protein kinase 21 [Brassica napus]
Length=525

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 76/124 (61%), Gaps = 11/124 (9%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHI--EYTK--SPGQGAGLPTRPPSISKP--  349
            MG  SS+H+  E     A        P QTH+  E+ K  +P     +   PPS S P  
Sbjct  1    MGCLSSKHRQEET----AAKPSTPITPAQTHVVPEHRKPQTPPTHHQISAPPPS-SNPTT  55

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
            V   D ILGK +ED+R  YSLGKELGRGQFG+TY C EI+TG  YACKSI K+KL++K D
Sbjct  56   VRDHDTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSILKRKLISKQD  115

Query  530  KDDM  541
            K+D+
Sbjct  116  KEDV  119



>gb|KFK30983.1| hypothetical protein AALP_AA6G053500 [Arabis alpina]
Length=538

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 80/132 (61%), Gaps = 14/132 (11%)
 Frame = +2

Query  188  MGNRSSRHKHGEKH-RSEAGHGGGGSQPHQTHIEYTKSPGQGAGLP-TRPP------SIS  343
            MG  +S+H+  + +  ++AG     + P QTH+    S      +P T  P       IS
Sbjct  1    MGCFTSKHRRTQTNINNDAGKTTIPTNPTQTHVVNPISHHHKPQIPQTHQPRTVHHQQIS  60

Query  344  KP------VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISK  505
             P      V   D ILGK +E+++  YSLGKELGRGQFG+TYLCTEI+TG  YACKSI K
Sbjct  61   TPSPNPISVQDPDTILGKPFEEIKKLYSLGKELGRGQFGITYLCTEISTGNTYACKSILK  120

Query  506  KKLVTKGDKDDM  541
            +KL++K DK+D+
Sbjct  121  RKLISKQDKEDV  132



>ref|XP_008463413.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis melo]
Length=519

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  356  KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKD  535
            +SD ILGK  EDV+ HY++GKELGRGQFGVTYLCTE ++GKQYACKSI K+KLVT+ DK+
Sbjct  56   RSDTILGKPLEDVKLHYTIGKELGRGQFGVTYLCTENSSGKQYACKSILKRKLVTRNDKE  115

Query  536  DM  541
            D+
Sbjct  116  DI  117



>ref|XP_004491400.1| PREDICTED: calcium-dependent protein kinase 9-like [Cicer arietinum]
Length=559

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 12/94 (13%)
 Frame = +2

Query  260  SQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQF  439
            +QPHQ   +  K P     +  RP       S S+ ILGK +EDV+  Y+LGKELGRGQF
Sbjct  75   NQPHQLPEKQVKKP-----IVQRP-------SDSNTILGKNFEDVKQIYTLGKELGRGQF  122

Query  440  GVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GVTYLCTE +TG +YACKSISK+KLV+K DK+D+
Sbjct  123  GVTYLCTENSTGLKYACKSISKRKLVSKADKEDI  156



>ref|XP_008804309.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Phoenix 
dactylifera]
Length=538

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 6/76 (8%)
 Frame = +2

Query  332  PSISKPVSKS------DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            PSI  P S        D +LGK +EDVR+ Y+LGKELGRGQFGVTYLCTEI TG +YACK
Sbjct  61   PSIPTPASAMAAGRAADTVLGKPFEDVRSLYTLGKELGRGQFGVTYLCTEIATGNRYACK  120

Query  494  SISKKKLVTKGDKDDM  541
            SISK+KL +K D+DD+
Sbjct  121  SISKRKLSSKNDRDDI  136



>gb|AET00506.2| calcium-dependent kinase [Medicago truncatula]
Length=540

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 12/94 (13%)
 Frame = +2

Query  263  QPHQTHIEYTKSPGQGAGLPTRP-PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQF  439
            QP+Q       SP + A  P  P P + +P   ++AILGK +EDV+  Y+LGKELGRGQF
Sbjct  55   QPYQ-------SPNKHA--PRSPKPIVQRP--NTNAILGKQFEDVKQIYTLGKELGRGQF  103

Query  440  GVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GVTYLCTE +TG +YACKSISK+KLV+K DK+D+
Sbjct  104  GVTYLCTENSTGLKYACKSISKRKLVSKSDKEDI  137



>gb|AIU98507.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=519

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            SK V   +AILGK + DVR+ YSLGKELGRGQFGVTYLCTE  TG QYACKS+SK+KL T
Sbjct  50   SKGVVAPNAILGKPFADVRSLYSLGKELGRGQFGVTYLCTETATGAQYACKSVSKRKLAT  109

Query  521  KGDKDDM  541
            K D++D+
Sbjct  110  KSDREDI  116



>ref|XP_009406510.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            SK V   +AILGK + DVR+ YSLGKELGRGQFGVTYLCTE  TG QYACKS+SK+KL T
Sbjct  50   SKGVVAPNAILGKPFADVRSLYSLGKELGRGQFGVTYLCTETATGAQYACKSVSKRKLAT  109

Query  521  KGDKDDM  541
            K D++D+
Sbjct  110  KSDREDI  116



>ref|XP_010923910.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Elaeis guineensis]
Length=503

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGKA+EDVR+ Y+LGKELGRGQFGVTYLCTE+ TGK+YACKSISK+KL +  D++D+
Sbjct  89   DTILGKAFEDVRSFYTLGKELGRGQFGVTYLCTEMATGKRYACKSISKRKLSSANDREDI  148



>ref|NP_192381.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
 sp|Q9ZSA2.1|CDPKL_ARATH RecName: Full=Calcium-dependent protein kinase 21 [Arabidopsis 
thaliana]
 gb|AAD03453.1| contains similarity to eukaryotic protein kinase domains (Pfam: 
PF00069, score=312.6, E=4.7e-90, N=1) and EF hand domains 
(Pfam: PF00036, score=131, E=2.1e-35, N=4) [Arabidopsis thaliana]
 emb|CAB80837.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
 gb|AAN13018.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE82416.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
Length=531

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 15/129 (12%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHI--EYTKSPGQGAGLPTRP-------PSI  340
            MG  SS+H+   K +++ G       P QTH+  E+ K         T+P       PS 
Sbjct  1    MGCFSSKHR---KTQNDGGEKSIPINPVQTHVVPEHRKPQTPTPKPMTQPIHQQISTPS-  56

Query  341  SKPVS--KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKL  514
            S PVS    D ILGK +ED+R  YSLGKELGRGQFG+TY+C EI TG  YACKSI K+KL
Sbjct  57   SNPVSVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCKEIGTGNTYACKSILKRKL  116

Query  515  VTKGDKDDM  541
            ++K DK+D+
Sbjct  117  ISKQDKEDV  125



>gb|AAK92828.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
Length=531

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 15/129 (12%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHI--EYTKSPGQGAGLPTRP-------PSI  340
            MG  SS+H+   K +++ G       P QTH+  E+ K         T+P       PS 
Sbjct  1    MGCFSSKHR---KTQNDGGEKSIPINPVQTHVVPEHRKPQTPTPKPMTQPIHQQISTPS-  56

Query  341  SKPVS--KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKL  514
            S PVS    D ILGK +ED+R  YSLGKELGRGQFG+TY+C EI TG  YACKSI K+KL
Sbjct  57   SNPVSVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCKEIGTGNTYACKSILKRKL  116

Query  515  VTKGDKDDM  541
            ++K DK+D+
Sbjct  117  ISKQDKEDV  125



>ref|XP_010057925.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW75311.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=546

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 2/74 (3%)
 Frame = +2

Query  326  RPPSISKPVSK--SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            RP  +S  V++   + ILGK +E+++ HY+LGKELGRGQFG+TYLCTE +TG+ YACKSI
Sbjct  70   RPAPVSSGVAQKMDNTILGKPFEEIKQHYTLGKELGRGQFGITYLCTEKSTGQTYACKSI  129

Query  500  SKKKLVTKGDKDDM  541
             K+KL++KGD+DDM
Sbjct  130  LKRKLLSKGDRDDM  143



>gb|KCW75309.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=536

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 2/74 (3%)
 Frame = +2

Query  326  RPPSISKPVSK--SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            RP  +S  V++   + ILGK +E+++ HY+LGKELGRGQFG+TYLCTE +TG+ YACKSI
Sbjct  70   RPAPVSSGVAQKMDNTILGKPFEEIKQHYTLGKELGRGQFGITYLCTEKSTGQTYACKSI  129

Query  500  SKKKLVTKGDKDDM  541
             K+KL++KGD+DDM
Sbjct  130  LKRKLLSKGDRDDM  143



>gb|KCW75310.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=543

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 2/74 (3%)
 Frame = +2

Query  326  RPPSISKPVSK--SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            RP  +S  V++   + ILGK +E+++ HY+LGKELGRGQFG+TYLCTE +TG+ YACKSI
Sbjct  70   RPAPVSSGVAQKMDNTILGKPFEEIKQHYTLGKELGRGQFGITYLCTEKSTGQTYACKSI  129

Query  500  SKKKLVTKGDKDDM  541
             K+KL++KGD+DDM
Sbjct  130  LKRKLLSKGDRDDM  143



>ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
 gb|EOA22559.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
Length=534

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 70/123 (57%), Gaps = 18/123 (15%)
 Frame = +2

Query  224  KHRSEAGHGGGGSQP---------------HQTHIEYTKSPGQGAGLPTRPPSISKPVS-  355
            KHR     GG  S P                + HI   KS  Q        PS S P+S 
Sbjct  7    KHRKTQNDGGDRSIPINPVQPRVVNQVPEHRKPHIPTPKSTNQPIHQQISTPS-SNPISA  65

Query  356  -KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDK  532
               D ILGK +ED+R  YSLGKELGRGQFG+TY+C EI+TG  YACKSI K+KL++K DK
Sbjct  66   RDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREISTGNTYACKSILKRKLISKQDK  125

Query  533  DDM  541
            +D+
Sbjct  126  EDV  128



>ref|XP_004293286.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 11/95 (12%)
 Frame = +2

Query  290  TKSPGQGAGLPTRP-----------PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQ  436
            T+ P + +  PTRP           P   KP    D+IL K +ED++ +Y+LGKELGRGQ
Sbjct  47   TQQPQKVSAPPTRPKPEPEPQFQPKPQRPKPAVPPDSILEKPFEDIKRYYTLGKELGRGQ  106

Query  437  FGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            FG+TYLCTE +TG  YACKSI K+KLV K D+DD+
Sbjct  107  FGITYLCTENSTGDSYACKSILKRKLVRKSDRDDV  141



>ref|XP_010467929.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=873

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 77/148 (52%), Gaps = 27/148 (18%)
 Frame = +2

Query  179  VREMGNRSSRHKH---------GEKHRSEAGHGGGGS---QPHQTHIEYTKSPGQGAGLP  322
            VR+M  +  R +            K R    HGG  S    P QTH+       +   +P
Sbjct  320  VRKMLTKDPRRRFTAAQQMGCFSSKPRKTQNHGGERSIPINPVQTHVANQVPEHRKPQIP  379

Query  323  TRPP---------SISKP------VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLC  457
            T  P          IS P      V   D ILGK +ED+R  YSLGKELGRGQFG+TY+C
Sbjct  380  TPKPKPTYQPIHQQISTPSSNPISVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMC  439

Query  458  TEITTGKQYACKSISKKKLVTKGDKDDM  541
             EI TG  YACKSI K+KL++K DK+D+
Sbjct  440  REIETGNTYACKSILKRKLISKQDKEDV  467


 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 70/124 (56%), Gaps = 18/124 (15%)
 Frame = +2

Query  224  KHRSEAGHGGGGS---QPHQTHIEYTKSPGQGAGLPTRPP---------SISKP------  349
            K R    HGG  S    P QTH+       +   +PT  P          IS P      
Sbjct  7    KPRKTQNHGGERSIPINPVQTHVANQVPEHRKPQIPTPKPKPTYQPIHQQISTPSSNPIS  66

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
            V   D ILGK +ED+R  YSLGKELGRGQFG+TY+C EI TG  YACKSI K+KL++K D
Sbjct  67   VRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIETGNTYACKSILKRKLISKQD  126

Query  530  KDDM  541
            K+D+
Sbjct  127  KEDV  130



>ref|XP_010923909.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Elaeis guineensis]
Length=551

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGKA+EDVR+ Y+LGKELGRGQFGVTYLCTE+ TGK+YACKSISK+KL +  D++D+
Sbjct  89   DTILGKAFEDVRSFYTLGKELGRGQFGVTYLCTEMATGKRYACKSISKRKLSSANDREDI  148



>ref|XP_002891589.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67848.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = +2

Query  323  TRPPSISKPV--SKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
             +PP    P   S + AIL K YEDV+  Y+L KELGRGQFGVTYLCTE +T K++ACKS
Sbjct  44   NQPPPWRNPAKHSAAAAILEKPYEDVKLFYTLSKELGRGQFGVTYLCTEKSTRKRFACKS  103

Query  497  ISKKKLVTKGDKDDM  541
            ISKKKLVTK DK+DM
Sbjct  104  ISKKKLVTKADKEDM  118



>ref|XP_011047988.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Populus 
euphratica]
Length=533

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 8/80 (10%)
 Frame = +2

Query  320  PTRPPSI------SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQ  481
            PTRP         ++PV   D ILGK +ED++ HY+LGKELGRGQFGVTYLCTE +TG  
Sbjct  55   PTRPQQTQHQTPPTRPVP--DTILGKPFEDIKQHYTLGKELGRGQFGVTYLCTENSTGHT  112

Query  482  YACKSISKKKLVTKGDKDDM  541
            YACKSI K+KLV K D++DM
Sbjct  113  YACKSILKRKLVNKNDREDM  132



>ref|XP_008806408.1| PREDICTED: calcium-dependent protein kinase 2 [Phoenix dactylifera]
Length=548

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK +EDVR+ Y+LGKELGRGQFGVTYLCTEI TGK+YACKSI+K+KL++  D++D+
Sbjct  86   DTILGKPFEDVRSFYTLGKELGRGQFGVTYLCTEIATGKRYACKSIAKRKLLSANDREDI  145



>ref|XP_007153943.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
 gb|ESW25937.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
Length=546

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +2

Query  272  QTHIEYTKSPGQGAGLPTRPPSISKPVSKSDA-ILGKAYEDVRAHYSLGKELGRGQFGVT  448
            Q H E   SP +    PT+    ++ V K DA ILGK +ED++ +YSLGKELGRGQFG+T
Sbjct  49   QPHSEAVASPPKPKLSPTQN---ARAVQKPDATILGKPFEDIKKYYSLGKELGRGQFGIT  105

Query  449  YLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            YLCTE  TG  YACKSI K+KLV++ D++DM
Sbjct  106  YLCTENATGMTYACKSILKRKLVSRADREDM  136



>ref|XP_010929942.1| PREDICTED: calcium-dependent protein kinase 2-like [Elaeis guineensis]
Length=544

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D +LGK++EDVR+ Y+LGKELGRGQFGVTYLCTEI TG +YACKSISK+KL +K D++D+
Sbjct  83   DTVLGKSFEDVRSLYTLGKELGRGQFGVTYLCTEIATGNRYACKSISKRKLSSKNDREDI  142



>gb|AFR11230.1| calcium dependent protein kinase 1 [Chenopodium album]
Length=543

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  332  PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKK  511
            P I+     S  ILGK +ED+R+HY LGKELGRGQFG+TYLCTE +TG+ YACKSI K+K
Sbjct  71   PRIAIAGPPSGTILGKPFEDIRSHYKLGKELGRGQFGITYLCTENSTGQTYACKSILKRK  130

Query  512  LVTKGDKDDM  541
            LVTK DK+D+
Sbjct  131  LVTKADKEDI  140



>ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51070.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 76/131 (58%), Gaps = 16/131 (12%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYT----KSPGQGAGLPTRPPSI-----  340
            MG  SS+H+   K +++ G       P QTH+       + P      P   P +     
Sbjct  1    MGCFSSKHR---KTQNDGGERTIPINPVQTHVVNQVPEHRKPQTPTPKPMNQPILQQIST  57

Query  341  --SKPVSKSD--AILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKK  508
              S P+S  D   ILGK +ED+R  YSLGKELGRGQFG+TY+C EI TG  YACKSI K+
Sbjct  58   PSSNPISVRDPETILGKPFEDIRKFYSLGKELGRGQFGITYMCKEIGTGNTYACKSILKR  117

Query  509  KLVTKGDKDDM  541
            KL++K DK+D+
Sbjct  118  KLISKQDKEDV  128



>ref|XP_003617547.1| Calcium dependent protein kinase [Medicago truncatula]
Length=1052

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 12/94 (13%)
 Frame = +2

Query  263  QPHQTHIEYTKSPGQGAGLPTRP-PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQF  439
            QP+Q       SP + A  P  P P + +P   ++AILGK +EDV+  Y+LGKELGRGQF
Sbjct  55   QPYQ-------SPNKHA--PRSPKPIVQRP--NTNAILGKQFEDVKQIYTLGKELGRGQF  103

Query  440  GVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            GVTYLCTE +TG +YACKSISK+KLV+K DK+D+
Sbjct  104  GVTYLCTENSTGLKYACKSISKRKLVSKSDKEDI  137


 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 75/120 (63%), Gaps = 13/120 (11%)
 Frame = +2

Query  194  NRSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGA-GLPTR-PPSISKPVSKSDA  367
            N++  H H   H          ++ H+  ++ +K P Q    LP +  PS    V +SD 
Sbjct  583  NKNPNHNHCYDH---------NNKNHEPFVKQSKPPFQQPYQLPDKHAPSPKPTVKRSDT  633

Query  368  --ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
              I GK +EDV+  Y+LGKELGRGQFGVTYLCTE +TG +YACKSISK+ LV++ DK+++
Sbjct  634  NTIPGKQFEDVKQIYTLGKELGRGQFGVTYLCTENSTGLKYACKSISKRNLVSEPDKEEI  693



>ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
 gb|ESQ38125.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
Length=535

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 73/131 (56%), Gaps = 15/131 (11%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHI-----EYTKSPGQGAGLP--------TR  328
            MG  SS+H+  E  R  AG       P QTH+     E+ K                 + 
Sbjct  1    MGCFSSKHR--ETQRDIAGKSSIPINPAQTHVVHQVPEHRKPQIPPTQQQQQPIHQQVST  58

Query  329  PPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKK  508
            P S    V   D ILGK +ED+R  YSLGKELGRGQFG+TY C EI+TG  YACKSI K+
Sbjct  59   PSSNPISVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSILKR  118

Query  509  KLVTKGDKDDM  541
            KL++K DK+D+
Sbjct  119  KLISKQDKEDV  129



>ref|XP_010278695.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=539

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 62/90 (69%), Gaps = 11/90 (12%)
 Frame = +2

Query  305  QGAGLPTRP--------PSISKPVS---KSDAILGKAYEDVRAHYSLGKELGRGQFGVTY  451
            Q   LP RP        P  S P S   + + ILGK +EDV++HY++ KELGRGQFGVTY
Sbjct  47   QTRPLPERPKTQPLAPAPVRSSPYSLTHRQETILGKPFEDVKSHYTIRKELGRGQFGVTY  106

Query  452  LCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            LC E +TG  YACKSISK+KLV+K DKDD+
Sbjct  107  LCIENSTGHTYACKSISKRKLVSKNDKDDI  136



>ref|XP_010461925.1| PREDICTED: calcium-dependent protein kinase 33 [Camelina sativa]
Length=521

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = +2

Query  323  TRPPSISKPVSKSDA-----ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYA  487
             +PP    P  K  A     IL K YEDV+  Y+L KELGRGQFGVTYLCTE +TGK++A
Sbjct  41   NQPPPWRNPPKKHSAGGAASILEKPYEDVKLLYTLSKELGRGQFGVTYLCTEKSTGKRFA  100

Query  488  CKSISKKKLVTKGDKDDM  541
            CKSISKKKLVTK DK+DM
Sbjct  101  CKSISKKKLVTKADKEDM  118



>ref|XP_010538709.1| PREDICTED: calcium-dependent protein kinase 21-like [Tarenaya 
hassleriana]
Length=545

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 84/144 (58%), Gaps = 31/144 (22%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGG----SQPHQTHI------------------EYTKSP  301
            MG  SS+H+     R++AG+ GG     + P Q+H+                  + TKS 
Sbjct  1    MGCFSSKHR-----RAQAGNNGGQGSVPANPTQSHVVHHVPEPRKPSIHQNHQAQQTKSQ  55

Query  302  GQGAGLPT--RPPSISKPVS--KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEIT  469
                  PT  + P+ SKPV+  + + ILGK +ED+R  Y+LGKELGRGQFG+TY C E +
Sbjct  56   PNPTNHPTPHQAPTPSKPVAVREPETILGKPFEDIRKFYTLGKELGRGQFGITYRCKENS  115

Query  470  TGKQYACKSISKKKLVTKGDKDDM  541
            TG  YACKSI K+KL ++ D+DD+
Sbjct  116  TGNTYACKSILKRKLTSRQDRDDV  139



>ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 ref|XP_004155602.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus]
Length=552

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 60/82 (73%), Gaps = 8/82 (10%)
 Frame = +2

Query  320  PTRPPSISKPVSKS--------DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTG  475
            PT   + SKP   +        + ILG+ Y+D++ +Y+LGKELGRGQFG+TYLCTE +TG
Sbjct  68   PTSASAFSKPAVSTPRTAQNYPETILGRPYDDIKKYYTLGKELGRGQFGITYLCTENSTG  127

Query  476  KQYACKSISKKKLVTKGDKDDM  541
            + YACKSI K+KL++K DKDDM
Sbjct  128  QTYACKSILKRKLISKNDKDDM  149



>ref|XP_009388872.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388873.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388874.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
Length=557

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  329  PPSISK-PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISK  505
            PP+++K P+   + ILGK +EDVR+ Y+ GKELGRGQFGVTYLCTE  TG +YACKSISK
Sbjct  83   PPAVTKAPLIVHETILGKPFEDVRSLYTFGKELGRGQFGVTYLCTENATGLRYACKSISK  142

Query  506  KKLVTKGDKDDM  541
            +KL  K D++D+
Sbjct  143  RKLSNKSDREDI  154



>ref|XP_010479536.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=521

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 58/78 (74%), Gaps = 5/78 (6%)
 Frame = +2

Query  323  TRPPSISKPVSK-----SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYA  487
             +PP    P  K     + +IL K YEDV+  Y+L KELGRGQFGVTYLCTE +TGK++A
Sbjct  41   NQPPPWRNPPKKHSGGAAASILEKPYEDVKLLYTLSKELGRGQFGVTYLCTEKSTGKRFA  100

Query  488  CKSISKKKLVTKGDKDDM  541
            CKSISKKKLVTK DK+DM
Sbjct  101  CKSISKKKLVTKADKEDM  118



>gb|KDO78219.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
 gb|KDO78220.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=447

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            ++PV K + +LGK  ED+R  Y+LGKELGRGQFG+TYLCTE +TG  YACKSI K+KLV 
Sbjct  75   TRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCTENSTGNSYACKSILKRKLVN  134

Query  521  KGDKDDM  541
            K D++D+
Sbjct  135  KQDREDI  141



>gb|KDO62707.1| hypothetical protein CISIN_1g043230mg, partial [Citrus sinensis]
Length=318

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            DAILG+ YEDV  HY++GKELGRG+FG+TYLCTE +TG Q+ACKSISK+KLV   +KDD+
Sbjct  21   DAILGRTYEDVELHYTIGKELGRGEFGITYLCTENSTGLQFACKSISKRKLVKDYEKDDV  80



>ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo]
Length=552

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 66/101 (65%), Gaps = 11/101 (11%)
 Frame = +2

Query  272  QTHIEYTKSPGQGAGLPTRPPS---ISKPVSKS--------DAILGKAYEDVRAHYSLGK  418
            QT I   ++  Q       PPS    SKP   +        + ILG+ Y+D++ +Y+LGK
Sbjct  49   QTQIPSNRNQPQPPPTAEHPPSASAFSKPAVSTPRTAQNYPETILGRPYDDIKKYYTLGK  108

Query  419  ELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ELGRGQFG+TYLCTE +TG+ YACKSI K+KL++K DKDDM
Sbjct  109  ELGRGQFGITYLCTENSTGQTYACKSILKRKLISKNDKDDM  149



>ref|XP_010529441.1| PREDICTED: calcium-dependent protein kinase 21 [Tarenaya hassleriana]
Length=544

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 78/133 (59%), Gaps = 28/133 (21%)
 Frame = +2

Query  224  KHR-SEAGHGGGGS----QPHQTHIEY-----------------TKSPGQGAGLPTRPPS  337
            KHR ++AG  GG S     P QTH+ +                 T S  + A  P  P  
Sbjct  7    KHRGAQAGVSGGRSSVPTNPTQTHVVHHVPEPRKQSDPQNHQPQTNSQPKPANQPI-PQQ  65

Query  338  ISKP-----VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSIS  502
            +S P     V + D ILGK++ED++  Y+LGKELGRGQFG+TY CTEI+TG  YACKSI 
Sbjct  66   VSTPLKPVAVREPDTILGKSFEDIKKFYTLGKELGRGQFGITYRCTEISTGNTYACKSIL  125

Query  503  KKKLVTKGDKDDM  541
            K+KL ++ DK+D+
Sbjct  126  KRKLTSRQDKEDV  138



>ref|XP_009597333.1| PREDICTED: calcium-dependent protein kinase-like [Nicotiana tomentosiformis]
Length=539

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 81/138 (59%), Gaps = 21/138 (15%)
 Frame = +2

Query  188  MGNRSSRHKHGE----KHRSEAGHGGGGSQPHQ-------THIEYTKSPGQGAGLP----  322
            MG   S++K+G+    ++R   G      QP+Q        H  Y + P +    P    
Sbjct  1    MGGCFSKNKYGQPDGKRYRPRRG-ANAAYQPYQHYQHPVYYHRNYQRPPQERQYKPPHSQ  59

Query  323  ----TRPPSISKP-VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYA  487
                  P   S+P   + D ILGK +ED++AHY+LG+ELGRGQ+GV Y CTEI+TG+ YA
Sbjct  60   QQVQQVPVKNSQPHFQEQDTILGKPFEDIKAHYTLGQELGRGQYGVIYHCTEISTGQAYA  119

Query  488  CKSISKKKLVTKGDKDDM  541
            CKSI K+KLV+K DK+D+
Sbjct  120  CKSILKRKLVSKKDKEDI  137



>gb|AGJ83806.1| calcium-dependent protein kinase 1d [Vitis amurensis]
Length=545

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +2

Query  320  PTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            P+ P +  + + K D ILGK ++D++ +Y+LGKELGRGQFGVTYLCT+ +TG  YACKSI
Sbjct  71   PSHPNT--RAIQKPDTILGKPFDDIKHYYTLGKELGRGQFGVTYLCTQNSTGNTYACKSI  128

Query  500  SKKKLVTKGDKDDM  541
             K+KLVTK DK+D+
Sbjct  129  LKRKLVTKNDKEDI  142



>ref|XP_006855881.1| hypothetical protein AMTR_s00037p00138680 [Amborella trichopoda]
 gb|ERN17348.1| hypothetical protein AMTR_s00037p00138680 [Amborella trichopoda]
Length=390

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 74/125 (59%), Gaps = 22/125 (18%)
 Frame = +2

Query  233  SEAGHGGGGSQP-----------HQTHIEYTKSPGQGAGLPTRP-------PSIS----K  346
            SEA   GGG QP            Q H   ++ PGQ     ++P       P+ S    K
Sbjct  12   SEADGAGGGYQPASRQQNQQKEQQQPHNTRSERPGQQLPPSSQPKASPLPHPASSYEQPK  71

Query  347  PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKG  526
            P    D ILGK + +V++ Y+LGKELGRGQFGVTYLCTE +TG  YACKSISK+KLV K 
Sbjct  72   PEPGVDTILGKPFLNVKSFYTLGKELGRGQFGVTYLCTENSTGLSYACKSISKRKLVRKS  131

Query  527  DKDDM  541
            D+DD+
Sbjct  132  DRDDV  136



>gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea]
Length=503

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            I GK +E++++ Y++G+ELGRGQFGVTYLCTEI +G+QYACKSI K+KLVTK DKDDM
Sbjct  42   IFGKPFENIKSKYAVGRELGRGQFGVTYLCTEIASGQQYACKSILKRKLVTKNDKDDM  99



>ref|XP_011047987.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Populus 
euphratica]
Length=544

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK +ED++ HY+LGKELGRGQFGVTYLCTE +TG  YACKSI K+KLV K D++DM
Sbjct  84   DTILGKPFEDIKQHYTLGKELGRGQFGVTYLCTENSTGHTYACKSILKRKLVNKNDREDM  143



>ref|XP_004500067.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Cicer 
arietinum]
Length=548

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 73/114 (64%), Gaps = 4/114 (4%)
 Frame = +2

Query  203  SRHKHGEK-HRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGK  379
            + H++ EK +++        S   Q H+  T        +P+  P + +   +++ ILGK
Sbjct  29   NNHRNNEKVNQTRTSTQPSTSNQPQKHVSSTHMKPSSVSVPSPKPFMKQ---ETNTILGK  85

Query  380  AYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
             +EDV+  Y+LGKELGRGQFGVTYLCTE +T   YACKSISKKKLV+K D++D+
Sbjct  86   GFEDVKDFYTLGKELGRGQFGVTYLCTENSTKLLYACKSISKKKLVSKSDREDI  139



>ref|XP_010501945.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=582

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 58/78 (74%), Gaps = 5/78 (6%)
 Frame = +2

Query  323  TRPPSISKPVSK-----SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYA  487
             +PP    P  K     + +IL K YEDV+  Y+L KELGRGQFGVTYLCTE +TGK++A
Sbjct  41   NQPPPWRNPPKKHTGGAAASILEKPYEDVKLLYTLSKELGRGQFGVTYLCTEKSTGKRFA  100

Query  488  CKSISKKKLVTKGDKDDM  541
            CKSISKKKLVTK DK+DM
Sbjct  101  CKSISKKKLVTKADKEDM  118



>ref|XP_009357448.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=546

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +2

Query  332  PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKK  511
            PS  KP +  ++ILGK ++D++ +Y+LGKELGRGQFG+TYLCTE +TG  YACKSI K+K
Sbjct  74   PSPVKPAAPPNSILGKPFDDIKQYYTLGKELGRGQFGITYLCTENSTGHSYACKSILKRK  133

Query  512  LVTKGDKDDM  541
            LV+K D++D+
Sbjct  134  LVSKNDREDI  143



>ref|XP_002518484.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=551

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +2

Query  338  ISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLV  517
            I KPV K + ILGK  +D+R  Y+LGKELGRGQFG+TYLCTE +TG  YACKSI K+KL+
Sbjct  81   IIKPVQKPETILGKPLDDIRQFYTLGKELGRGQFGITYLCTENSTGHTYACKSILKRKLI  140

Query  518  TKGDKDDM  541
            +K D++D+
Sbjct  141  SKSDREDI  148



>ref|XP_006452348.1| hypothetical protein CICLE_v10008325mg [Citrus clementina]
 gb|ESR65588.1| hypothetical protein CICLE_v10008325mg [Citrus clementina]
Length=439

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 9/87 (10%)
 Frame = +2

Query  290  TKSPGQ---GAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCT  460
            +K PG     A    +PP +       DAILGK YEDVR HY++GKELG+G F VTYLCT
Sbjct  6    SKIPGSSKPAAARQQQPPKLD------DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCT  59

Query  461  EITTGKQYACKSISKKKLVTKGDKDDM  541
            E +TG Q+ACKSISKKK+V   +KDD+
Sbjct  60   ENSTGLQFACKSISKKKIVAAYEKDDV  86



>gb|KDO78218.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=523

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            ++PV K + +LGK  ED+R  Y+LGKELGRGQFG+TYLCTE +TG  YACKSI K+KLV 
Sbjct  75   TRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCTENSTGNSYACKSILKRKLVN  134

Query  521  KGDKDDM  541
            K D++D+
Sbjct  135  KQDREDI  141



>ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=541

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            + ILGK +EDV++ Y++GKELGRGQFGVTY CTEI TG+QYACKSI K+KLV+K DK+DM
Sbjct  81   NNILGKPFEDVKSKYTIGKELGRGQFGVTYSCTEIATGQQYACKSILKRKLVSKNDKEDM  140



>gb|KDO62703.1| hypothetical protein CISIN_1g009382mg [Citrus sinensis]
Length=536

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK YEDV++HY++GKELGRGQ+G+ YLC E +TG+Q+ACKS++K+KLV+K D+DD+
Sbjct  55   DTILGKPYEDVKSHYTMGKELGRGQYGIIYLCIENSTGRQFACKSVAKRKLVSKTDRDDI  114



>gb|KDO78217.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=544

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            ++PV K + +LGK  ED+R  Y+LGKELGRGQFG+TYLCTE +TG  YACKSI K+KLV 
Sbjct  75   TRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCTENSTGNSYACKSILKRKLVN  134

Query  521  KGDKDDM  541
            K D++D+
Sbjct  135  KQDREDI  141



>ref|XP_010686845.1| PREDICTED: calcium-dependent protein kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  PTRP-PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
            P  P P +       D ILGK YED+R++Y LGKELGRGQFG+TYLCTE +TG+ YACKS
Sbjct  112  PLEPKPRLLIAAPPPDTILGKPYEDIRSNYRLGKELGRGQFGITYLCTENSTGQTYACKS  171

Query  497  ISKKKLVTKGDKDDM  541
            I K+KLVT  DK+D+
Sbjct  172  ILKRKLVTSADKEDI  186



>ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase 21-like [Citrus sinensis]
Length=544

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            ++PV K + +LGK  ED+R  Y+LGKELGRGQFG+TYLCTE +TG  YACKSI K+KLV 
Sbjct  75   TRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCTENSTGNSYACKSILKRKLVN  134

Query  521  KGDKDDM  541
            K D++D+
Sbjct  135  KQDREDI  141



>emb|CBI23246.3| unnamed protein product [Vitis vinifera]
Length=514

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +2

Query  320  PTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            P+ P +  + + K D ILG+ ++D++ +Y+LGKELGRGQFGVTYLCT+ +TG  YACKSI
Sbjct  40   PSHPNT--RAIQKPDTILGRPFDDIKHYYTLGKELGRGQFGVTYLCTQNSTGNTYACKSI  97

Query  500  SKKKLVTKGDKDDM  541
             K+KLVTK DK+D+
Sbjct  98   LKRKLVTKNDKEDI  111



>gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Erythranthe guttata]
Length=539

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ILGK +EDV++HY++GKELGRGQFGVTY C EI+TG  YACKSI K+KLV+K DKDDM
Sbjct  80   ILGKPFEDVKSHYTVGKELGRGQFGVTYSCIEISTGHHYACKSILKRKLVSKNDKDDM  137



>gb|KDO37230.1| hypothetical protein CISIN_1g047606mg [Citrus sinensis]
Length=476

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 9/87 (10%)
 Frame = +2

Query  290  TKSPGQ---GAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCT  460
            +K PG     A    +PP +       DAILGK YEDVR HY++GKELG+G F VTYLCT
Sbjct  6    SKIPGSSKPAAARQQQPPKLD------DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCT  59

Query  461  EITTGKQYACKSISKKKLVTKGDKDDM  541
            E +TG Q+ACKSISKKK+V   +KDD+
Sbjct  60   ENSTGLQFACKSISKKKIVAAYEKDDV  86



>gb|KHG10851.1| Calcium-dependent protein kinase 21 [Gossypium arboreum]
Length=552

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 66/92 (72%), Gaps = 3/92 (3%)
 Frame = +2

Query  272  QTHIEYTKSPGQGAGLPTRP-PSISKPV-SKSDAILGKAYEDVRAHYSLGKELGRGQFGV  445
            +  +  T+ P Q   +P +P P+ ++P+ +  D +LGK  ED++ +Y LGKELGRGQFG+
Sbjct  50   EAQVPQTRQP-QAVSVPLKPSPASTRPIQTMEDTVLGKPLEDIKQYYKLGKELGRGQFGI  108

Query  446  TYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            TYLCTE +TG  YACKSI K+KL +K D++D+
Sbjct  109  TYLCTENSTGNTYACKSILKRKLRSKQDREDI  140



>ref|XP_006452356.1| hypothetical protein CICLE_v10010666mg [Citrus clementina]
 gb|ESR65596.1| hypothetical protein CICLE_v10010666mg [Citrus clementina]
Length=491

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 9/87 (10%)
 Frame = +2

Query  290  TKSPGQ---GAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCT  460
            +K PG     A    +PP +       DAILGK YEDVR HY++GKELG+G F VTYLCT
Sbjct  6    SKIPGSSKPAAARQQQPPKLD------DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCT  59

Query  461  EITTGKQYACKSISKKKLVTKGDKDDM  541
            E +TG Q+ACKSISKKK+V   +KDD+
Sbjct  60   ENSTGLQFACKSISKKKIVAAYEKDDV  86



>ref|XP_002268814.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=545

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +2

Query  320  PTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            P+ P +  + + K D ILG+ ++D++ +Y+LGKELGRGQFGVTYLCT+ +TG  YACKSI
Sbjct  71   PSHPNT--RAIQKPDTILGRPFDDIKHYYTLGKELGRGQFGVTYLCTQNSTGNTYACKSI  128

Query  500  SKKKLVTKGDKDDM  541
             K+KLVTK DK+D+
Sbjct  129  LKRKLVTKNDKEDI  142



>ref|XP_006475082.1| PREDICTED: calcium-dependent protein kinase 33-like isoform X2 
[Citrus sinensis]
Length=504

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 9/87 (10%)
 Frame = +2

Query  290  TKSPGQ---GAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCT  460
            +K PG     A    +PP +       DAILGK YEDVR HY++GKELG+G F VTYLCT
Sbjct  6    SKIPGSSKPAAARQQQPPKLD------DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCT  59

Query  461  EITTGKQYACKSISKKKLVTKGDKDDM  541
            E +TG Q+ACKSISKKK+V   +KDD+
Sbjct  60   ENSTGLQFACKSISKKKIVAAYEKDDV  86



>ref|XP_006475079.1| PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis]
Length=504

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 9/87 (10%)
 Frame = +2

Query  290  TKSPGQ---GAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCT  460
            +K PG     A    +PP +       DAILGK YEDVR HY++GKELG+G F VTYLCT
Sbjct  6    SKIPGSSKPAAARQQQPPKLD------DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCT  59

Query  461  EITTGKQYACKSISKKKLVTKGDKDDM  541
            E +TG Q+ACKSISKKK+V   +KDD+
Sbjct  60   ENSTGLQFACKSISKKKIVAAYEKDDV  86



>emb|CAD70166.1| putative calcium-dependent protein kinase [Landoltia punctata]
Length=182

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 68/102 (67%), Gaps = 8/102 (8%)
 Frame = +2

Query  236  EAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLG  415
            +A +GG  + P Q      K PG   G+  +PP+  K  +    +LG+  EDVR  Y++G
Sbjct  30   QAQNGGSANAPPQ------KPPGAVTGVLRQPPA--KGSAAVGPVLGRRMEDVRQTYAIG  81

Query  416  KELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            KELGRGQFGVT+LCT+  TGKQ+ACK+I+K+KLV K D +D+
Sbjct  82   KELGRGQFGVTHLCTDRVTGKQFACKTIAKRKLVNKEDIEDV  123



>ref|XP_007026067.1| Calcium-dependent protein kinase 21 isoform 2 [Theobroma cacao]
 gb|EOY28689.1| Calcium-dependent protein kinase 21 isoform 2 [Theobroma cacao]
Length=486

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  PTRP-PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
            P +P P+ S+PV   + ILGK  ED++ +Y+LGKELGRGQFG+TYLCTE +TG  YACKS
Sbjct  61   PLKPSPASSRPVQGQETILGKPLEDIKQYYTLGKELGRGQFGITYLCTENSTGNTYACKS  120

Query  497  ISKKKLVTKGDKDDM  541
            I K+KL  K D++D+
Sbjct  121  ILKRKLKNKQDREDI  135



>ref|XP_007026068.1| Calcium-dependent protein kinase 21 isoform 3 [Theobroma cacao]
 gb|EOY28690.1| Calcium-dependent protein kinase 21 isoform 3 [Theobroma cacao]
Length=481

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  PTRP-PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
            P +P P+ S+PV   + ILGK  ED++ +Y+LGKELGRGQFG+TYLCTE +TG  YACKS
Sbjct  61   PLKPSPASSRPVQGQETILGKPLEDIKQYYTLGKELGRGQFGITYLCTENSTGNTYACKS  120

Query  497  ISKKKLVTKGDKDDM  541
            I K+KL  K D++D+
Sbjct  121  ILKRKLKNKQDREDI  135



>ref|XP_006452344.1| hypothetical protein CICLE_v10007980mg [Citrus clementina]
 ref|XP_006475076.1| PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis]
 gb|ESR65584.1| hypothetical protein CICLE_v10007980mg [Citrus clementina]
Length=531

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 9/118 (8%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDA  367
            MG+  S+ +H + H    G         Q +      P       + P  +  P+     
Sbjct  1    MGSGLSKIRHSKPHDKSYGSTS------QANTGVVLEPAAPVAQISSPEPVRHPLY---T  51

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ILGK YEDV+ HY++GKELGRGQ+G+ YLCTE +TG+Q+ACKS++K+KLV+K D+DD+
Sbjct  52   ILGKPYEDVKCHYTMGKELGRGQYGIIYLCTENSTGRQFACKSVAKRKLVSKTDRDDI  109



>ref|NP_001266075.1| calcium-dependent protein kinase 21-like [Cicer arietinum]
 gb|AAP72281.2| calcium-dependent calmodulin-independent protein kinase isoform 
1 [Cicer arietinum]
Length=556

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +2

Query  263  QPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDA-ILGKAYEDVRAHYSLGKELGRGQF  439
            QP  TH++           PT      K V K+D  ILGK ++D++ HY+LG+ELGRGQF
Sbjct  44   QPSSTHVQTPPPKPDSNPKPTVTTQNVKTVHKTDTTILGKPFDDIKKHYTLGQELGRGQF  103

Query  440  GVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            G+TY CTE +TG  YACKSI K+KLV+K D++D+
Sbjct  104  GITYFCTENSTGNTYACKSILKRKLVSKSDREDI  137



>ref|XP_006303970.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
 gb|EOA36868.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
Length=520

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = +2

Query  323  TRPPSISKPVSKSD-----AILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYA  487
             +PP    P  K       +IL K YEDV+  Y+L +ELGRGQFGVTYLCTE +TGK++A
Sbjct  40   NQPPPWRNPPKKHSGGSGASILEKPYEDVKLLYTLSRELGRGQFGVTYLCTEKSTGKRFA  99

Query  488  CKSISKKKLVTKGDKDDM  541
            CKSISKKKLVTK DK+DM
Sbjct  100  CKSISKKKLVTKADKEDM  117



>ref|XP_009776260.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Nicotiana 
sylvestris]
Length=503

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  332  PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKK  511
            P I +   + D ILGK +ED++AHY+LG+ELGRGQ+GV Y CTEI+TG+ YACKSI K+K
Sbjct  80   PHIQEQRIEQDTILGKPFEDIKAHYTLGQELGRGQYGVIYHCTEISTGQPYACKSILKRK  139

Query  512  LVTKGDKDDM  541
            LV K DK+D+
Sbjct  140  LVNKKDKEDI  149



>ref|XP_006475081.1| PREDICTED: calcium-dependent protein kinase 33-like isoform X1 
[Citrus sinensis]
Length=533

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 9/87 (10%)
 Frame = +2

Query  290  TKSPGQ---GAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCT  460
            +K PG     A    +PP +       DAILGK YEDVR HY++GKELG+G F VTYLCT
Sbjct  6    SKIPGSSKPAAARQQQPPKLD------DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCT  59

Query  461  EITTGKQYACKSISKKKLVTKGDKDDM  541
            E +TG Q+ACKSISKKK+V   +KDD+
Sbjct  60   ENSTGLQFACKSISKKKIVAAYEKDDV  86



>ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 emb|CEH19767.1| Calcium-dependent protein kinase [Populus tremula x Populus tremuloides]
Length=532

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            D ILGK +ED++ HY+LGKELGRGQFGVTYLCTE +T   YACKSI K+KLV K DK+DM
Sbjct  72   DTILGKPFEDIKQHYTLGKELGRGQFGVTYLCTENSTSHTYACKSILKRKLVNKNDKEDM  131



>ref|XP_007026066.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
 gb|EOY28688.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
Length=538

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  PTRP-PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
            P +P P+ S+PV   + ILGK  ED++ +Y+LGKELGRGQFG+TYLCTE +TG  YACKS
Sbjct  61   PLKPSPASSRPVQGQETILGKPLEDIKQYYTLGKELGRGQFGITYLCTENSTGNTYACKS  120

Query  497  ISKKKLVTKGDKDDM  541
            I K+KL  K D++D+
Sbjct  121  ILKRKLKNKQDREDI  135



>ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana 
sylvestris]
Length=551

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  332  PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKK  511
            P I +   + D ILGK +ED++AHY+LG+ELGRGQ+GV Y CTEI+TG+ YACKSI K+K
Sbjct  80   PHIQEQRIEQDTILGKPFEDIKAHYTLGQELGRGQYGVIYHCTEISTGQPYACKSILKRK  139

Query  512  LVTKGDKDDM  541
            LV K DK+D+
Sbjct  140  LVNKKDKEDI  149



>ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=543

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ILGK +EDV++ Y++ KELGRGQFGVTYLCT++ TG QYACKSI K+KLV+K DK+DM
Sbjct  85   ILGKPFEDVKSKYTISKELGRGQFGVTYLCTDVATGNQYACKSILKRKLVSKNDKEDM  142



>ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
 gb|ESR62963.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
Length=544

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            ++PV   + +LGK  ED+R  Y+LGKELGRGQFG+TYLCTE +TG  YACKSI K+KLV 
Sbjct  75   TRPVQMPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCTENSTGNTYACKSILKRKLVN  134

Query  521  KGDKDDM  541
            K D++D+
Sbjct  135  KQDREDI  141



>ref|XP_006475078.1| PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis]
Length=551

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            DAILGKAYEDV+ HY++G+E+GRG+FG+TYLCTE +TG ++ACKSI K+KLV   +KDD+
Sbjct  21   DAILGKAYEDVQLHYTIGREVGRGEFGITYLCTENSTGLEFACKSIPKRKLVKDVEKDDV  80



>gb|KJB69279.1| hypothetical protein B456_011G014200 [Gossypium raimondii]
Length=551

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +2

Query  272  QTHIEYTKSPGQGAGLPTRPPSIS-KPV-SKSDAILGKAYEDVRAHYSLGKELGRGQFGV  445
            +  +  T+ P Q   +P +P + S +P+ +  D +LGK  ED++ +Y LGKELGRGQFG+
Sbjct  49   EAQVPQTRQP-QAVSVPLKPSAASTRPIQTMEDTVLGKPLEDIKQYYKLGKELGRGQFGI  107

Query  446  TYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            TYLCTE +TG  YACKSI K+KL +K D++D+
Sbjct  108  TYLCTENSTGNTYACKSILKRKLRSKQDREDI  139



>ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
 gb|EEE86087.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
Length=532

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            ++PV K D ILGK +ED++  Y+L KELGRGQFG+TYLCTE  TG  YACKSI ++KLV 
Sbjct  65   TRPVPKVDTILGKPFEDIKQLYTLSKELGRGQFGITYLCTENATGHSYACKSILRRKLVN  124

Query  521  KGDKDDM  541
            K D DD+
Sbjct  125  KKDGDDI  131



>ref|XP_010093289.1| Calcium-dependent protein kinase 15 [Morus notabilis]
 gb|EXB53814.1| Calcium-dependent protein kinase 15 [Morus notabilis]
Length=539

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            DAILG+ +ED++ HY+LGKELGRGQFG+TYLCTE +TG+ +ACKSI K+KL  + D+DD+
Sbjct  78   DAILGRPFEDIKQHYTLGKELGRGQFGITYLCTENSTGETFACKSILKRKLARQSDRDDV  137



>ref|XP_006452346.1| hypothetical protein CICLE_v10010522mg, partial [Citrus clementina]
 gb|ESR65586.1| hypothetical protein CICLE_v10010522mg, partial [Citrus clementina]
Length=456

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            DAILGKAYEDV+ HY++G+E+GRG+FG+TYLCTE +TG ++ACKSI K+KLV   +KDD+
Sbjct  21   DAILGKAYEDVQLHYTIGREVGRGEFGITYLCTENSTGLEFACKSIPKRKLVKDVEKDDV  80



>ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
tomentosiformis]
Length=534

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ILGK +ED+R HY+LGKELGRGQFGVTY CTE +TG  YACKSI K+KLV+K D++DM
Sbjct  75   ILGKPFEDIRKHYTLGKELGRGQFGVTYHCTENSTGNPYACKSILKRKLVSKNDREDM  132



>ref|XP_008224828.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
2-like [Prunus mume]
Length=560

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 59/75 (79%), Gaps = 5/75 (7%)
 Frame = +2

Query  317  LPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
            +P +P ++       ++ILGK ++D++ +Y+LGKELGRGQFG+TYLCTE +TG  YACKS
Sbjct  88   VPIKPAAVP-----PNSILGKPFDDIKQYYTLGKELGRGQFGITYLCTENSTGHSYACKS  142

Query  497  ISKKKLVTKGDKDDM  541
            I K+KLV+K D+DD+
Sbjct  143  ILKRKLVSKNDRDDI  157



>ref|XP_011037643.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037644.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037646.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
Length=532

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
            V K D +LGK +ED++  Y+LGKELGRGQFG+TYLCTE  TG  YACKSI ++KLV K D
Sbjct  68   VPKVDTMLGKPFEDIKQLYTLGKELGRGQFGITYLCTENATGHSYACKSILRRKLVNKND  127

Query  530  KDDM  541
            +DD+
Sbjct  128  RDDI  131



>gb|KDO62705.1| hypothetical protein CISIN_1g040917mg, partial [Citrus sinensis]
Length=494

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            DAILGKAYEDV+ HY++G+E+GRG+FG+TYLCTE +TG ++ACKSI K+KLV   +KDD+
Sbjct  21   DAILGKAYEDVQLHYTIGREVGRGEFGITYLCTENSTGLEFACKSIPKRKLVKDVEKDDV  80



>gb|KEH28424.1| calcium-dependent kinase [Medicago truncatula]
Length=396

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 75/120 (63%), Gaps = 13/120 (11%)
 Frame = +2

Query  194  NRSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGA-GLPTR-PPSISKPVSKSDA  367
            N++  H H   H          ++ H+  ++ +K P Q    LP +  PS    V +SD 
Sbjct  26   NKNPNHNHCYDH---------NNKNHEPFVKQSKPPFQQPYQLPDKHAPSPKPTVKRSDT  76

Query  368  --ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
              I GK +EDV+  Y+LGKELGRGQFGVTYLCTE +TG +YACKSISK+ LV++ DK+++
Sbjct  77   NTIPGKQFEDVKQIYTLGKELGRGQFGVTYLCTENSTGLKYACKSISKRNLVSEPDKEEI  136



>ref|NP_001280761.1| calcium-dependent protein kinase 2-like [Malus domestica]
 gb|AAR28084.1| calcium-dependent protein kinase [Malus domestica]
Length=543

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ++ILGK ++D++ +Y+LGKELGRGQFG+TYLCTE +TG  YACKSI K+KLV+K D+DD+
Sbjct  81   NSILGKPFDDIKQYYTLGKELGRGQFGITYLCTENSTGHSYACKSILKRKLVSKNDRDDI  140



>ref|XP_003610427.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92624.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=539

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +2

Query  326  RPPSIS--KPVSK--SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            +P +I+  KPV +     ILGK YED++  Y+LGKELGRGQFG+TY CTE +TG  YACK
Sbjct  61   KPSAITTQKPVQQKVDTTILGKPYEDIKKFYTLGKELGRGQFGITYFCTENSTGLNYACK  120

Query  494  SISKKKLVTKGDKDDM  541
            SI K+KLV+K D++D+
Sbjct  121  SILKRKLVSKADREDI  136



>gb|AGA83664.1| calcium-dependent protein kinase 1 [Dendrobium catenatum]
Length=534

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDD  538
            D IL K ++DVR +Y+LGKELGRGQFGVTYLCTE +TG  YACKSISK+KLV K DK+D
Sbjct  73   DTILDKPFDDVRRNYTLGKELGRGQFGVTYLCTENSTGHSYACKSISKRKLVHKNDKED  131



>ref|XP_010519814.1| PREDICTED: calcium-dependent protein kinase 34 isoform X2 [Tarenaya 
hassleriana]
Length=526

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 70/119 (59%), Gaps = 4/119 (3%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISK-PVSKSD  364
            MGN  S  +   +   E   G G +       E + +P      P+ PP+  + P+    
Sbjct  1    MGNCCSHGRESPEDTDEPTPGNGATAQSNPAAETSAAPASKHAPPSPPPATKQGPIG---  57

Query  365  AILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
             +LG+  EDV+A YSLGKELGRGQFGVT+LCT   TG Q+ACK+I+K+KLV K D +D+
Sbjct  58   PVLGRPMEDVKASYSLGKELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIEDV  116



>ref|XP_002874812.1| calcium-dependent protein kinase 23 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51071.1| calcium-dependent protein kinase 23 [Arabidopsis lyrata subsp. 
lyrata]
Length=535

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 62/103 (60%), Gaps = 5/103 (5%)
 Frame = +2

Query  224  KHRSEAGHGGGGSQPH---QTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDV  394
            KHR+    GG  S P    QTH+       +   +PT  PS+   V     ILGK  ED+
Sbjct  7    KHRTTQNDGGERSNPINPVQTHVVNQVPEHREPQIPT--PSVPISVRDPATILGKPLEDI  64

Query  395  RAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTK  523
            R  YSLGKELGRGQFG+TY+C EI TG  YACKSI K+ L+++
Sbjct  65   RRFYSLGKELGRGQFGITYMCKEIGTGNNYACKSILKRTLISE  107



>ref|XP_010519813.1| PREDICTED: calcium-dependent protein kinase 34 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 70/119 (59%), Gaps = 4/119 (3%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISK-PVSKSD  364
            MGN  S  +   +   E   G G +       E + +P      P+ PP+  + P+    
Sbjct  1    MGNCCSHGRESPEDTDEPTPGNGATAQSNPAAETSAAPASKHAPPSPPPATKQGPIG---  57

Query  365  AILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
             +LG+  EDV+A YSLGKELGRGQFGVT+LCT   TG Q+ACK+I+K+KLV K D +D+
Sbjct  58   PVLGRPMEDVKASYSLGKELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIEDV  116



>gb|ACB71246.2| calcium-dependent protein kinase 1 [Hevea brasiliensis]
Length=556

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            ++ V     ILGK  ED++ +YSLGKELGRGQFGVTYLCTE +TG  YACKSI K+KL+ 
Sbjct  87   ARSVQTPQTILGKPLEDIKQYYSLGKELGRGQFGVTYLCTENSTGHIYACKSILKRKLIN  146

Query  521  KGDKDDM  541
            KGD++D+
Sbjct  147  KGDREDI  153



>ref|XP_006475143.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=476

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            DAIL KAYEDV+ HY+LG+ELGRG+FG+TYLCTE +TG ++ACKSI K+KLV    KDD+
Sbjct  36   DAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDV  95



>gb|KHN12036.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=580

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 3/76 (4%)
 Frame = +2

Query  323  TRPPSISKPVSKSDAI---LGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            T PPS     SK  AI   LG+A EDV++ YS+GKELGRGQFGVT+LCT  +TGKQYACK
Sbjct  33   TPPPSSKAKQSKPAAIGPVLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACK  92

Query  494  SISKKKLVTKGDKDDM  541
            +I+K+KLV K D +D+
Sbjct  93   TIAKRKLVNKEDIEDV  108



>ref|XP_006452347.1| hypothetical protein CICLE_v10008020mg [Citrus clementina]
 gb|ESR65587.1| hypothetical protein CICLE_v10008020mg [Citrus clementina]
 gb|KDO62706.1| hypothetical protein CISIN_1g010164mg [Citrus sinensis]
Length=516

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            DAIL KAYEDV+ HY+LG+ELGRG+FG+TYLCTE +TG ++ACKSI K+KLV    KDD+
Sbjct  36   DAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDV  95



>ref|XP_006301218.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
 gb|EOA34116.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
Length=547

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = +2

Query  185  EMGNRSSRHKHGEKHRSEAGHGGGG--SQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSK  358
            E  NR +  K   + R  A         QPH+  +   + P +   +    P  S  + +
Sbjct  21   EEQNRETTPKQNPRQRQTAPRANFQIVVQPHKLPLPIPQ-PQEKQKVIMNNPKQSN-LQQ  78

Query  359  SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDD  538
             + ILGK +ED++  YSLG+ELGRGQFG+TY+CTEI++GK +ACKSI K+KL+   D++D
Sbjct  79   PEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTQDRED  138

Query  539  M  541
            +
Sbjct  139  V  139



>ref|XP_006452355.1| hypothetical protein CICLE_v10010314mg, partial [Citrus clementina]
 gb|ESR65595.1| hypothetical protein CICLE_v10010314mg, partial [Citrus clementina]
Length=494

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            DAILGKAYEDV+  Y++GKELGRG+FG+TYLCTE +TG ++ACKSI K+KLV    KDD+
Sbjct  21   DAILGKAYEDVKLDYTIGKELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDV  80



>ref|XP_007141507.1| hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris]
 gb|ESW13501.1| hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris]
Length=521

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +2

Query  320  PTRPPS-ISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
            P  PPS  SKP +    +LGK  EDVR+ YS+GKELGRGQFGVT+LCT  +TGKQYACK+
Sbjct  38   PNHPPSKQSKPAAIG-PVLGKPMEDVRSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKT  96

Query  497  ISKKKLVTKGDKDDM  541
            I+K+KLV K D +D+
Sbjct  97   IAKRKLVNKEDIEDV  111



>gb|ADZ52811.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=554

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            + ILGK +ED+R  Y+LGKELGRGQFGVTY CTE +TG  YACKSI K+KLV+K D++DM
Sbjct  96   NNILGKPFEDIRKLYTLGKELGRGQFGVTYYCTENSTGNPYACKSILKRKLVSKNDREDM  155



>ref|XP_006399734.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
 gb|ESQ41187.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
Length=528

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 13/112 (12%)
 Frame = +2

Query  242  GHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISK---------PVSKSDAI---LGKAY  385
            G    G  P+  ++    + G  AG PT  PS+++         P +K   I   LG+  
Sbjct  8    GRDSAGDGPNHQNVATASNTGHPAG-PTAEPSVAQSKHAPPSPPPATKQGPIGPVLGRPM  66

Query  386  EDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            EDV+A YSLGKELGRGQFGVT+LCT+  TG+Q+ACK+I+K+KLV K D +D+
Sbjct  67   EDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIEDV  118



>emb|CDY43077.1| BnaCnng10830D [Brassica napus]
Length=522

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 4/63 (6%)
 Frame = +2

Query  353  SKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDK  532
            +K ++IL  AYEDV+  Y+LGKELGRGQFGVTYLCTE +TGK    KSISKKKLVTK DK
Sbjct  52   AKRNSILENAYEDVKLFYTLGKELGRGQFGVTYLCTENSTGK----KSISKKKLVTKADK  107

Query  533  DDM  541
            DDM
Sbjct  108  DDM  110



>ref|XP_009360846.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=543

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ++ILGK + D++ +Y+LGKELGRGQFG+TYLCTE +TG  YACKSI K+KLV+K D+DD+
Sbjct  81   NSILGKPFNDIKQYYTLGKELGRGQFGITYLCTENSTGHCYACKSILKRKLVSKNDRDDI  140



>gb|AHN49725.1| calcium-dependent protein kinase 1 [Hippeastrum hybrid cultivar]
Length=531

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 54/77 (70%), Gaps = 6/77 (8%)
 Frame = +2

Query  329  PPSISKPVSK------SDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYAC  490
            PPS  KP  K       DAIL K Y DVR+ Y+ GK LGRGQFGVTYLCTE +TG  YAC
Sbjct  53   PPSPLKPTPKPELVVPFDAILDKPYSDVRSFYTFGKVLGRGQFGVTYLCTENSTGLLYAC  112

Query  491  KSISKKKLVTKGDKDDM  541
            KSISK++L  K D++D+
Sbjct  113  KSISKRRLKNKNDREDI  129



>gb|KCW68004.1| hypothetical protein EUGRSUZ_F01694 [Eucalyptus grandis]
Length=422

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  329  PPSIS-----KPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            PPS S     +P S+   ILGK Y DV+A Y+L +ELGRGQFGVTYLCTE +TG QYACK
Sbjct  50   PPSRSLTKRRQPSSQIGRILGKPYADVKALYNLDRELGRGQFGVTYLCTERSTGIQYACK  109

Query  494  SISKKKLVTKGDKDDM  541
            SIS++KL+T  D  D+
Sbjct  110  SISQRKLITDNDIGDV  125



>gb|KCW68005.1| hypothetical protein EUGRSUZ_F01694 [Eucalyptus grandis]
Length=439

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  329  PPSIS-----KPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            PPS S     +P S+   ILGK Y DV+A Y+L +ELGRGQFGVTYLCTE +TG QYACK
Sbjct  50   PPSRSLTKRRQPSSQIGRILGKPYADVKALYNLDRELGRGQFGVTYLCTERSTGIQYACK  109

Query  494  SISKKKLVTKGDKDDM  541
            SIS++KL+T  D  D+
Sbjct  110  SISQRKLITDNDIGDV  125



>dbj|BAE71239.1| putative calcium dependent protein kinase [Trifolium pratense]
Length=558

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +2

Query  344  KPVSKSDA-ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            + V K D  ILGK +ED++  Y+LGKELGRGQFG+TY CTE +TG  YACKSI K+KLV+
Sbjct  89   RTVQKPDTTILGKPFEDIKKFYTLGKELGRGQFGITYFCTENSTGLNYACKSILKRKLVS  148

Query  521  KGDKDDM  541
            K D++D+
Sbjct  149  KADREDI  155



>ref|XP_006600312.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Glycine 
max]
 gb|KHN03472.1| Calcium-dependent protein kinase 21 [Glycine soja]
Length=538

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = +2

Query  326  RPPSISKPVSKSDA---ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
            +P S + P  +  A   ILGK ++D++ +YSLGKELGRGQFG+TYLCT+  +G  YACKS
Sbjct  61   KPQSKASPTVQQKADTRILGKPFDDIKKYYSLGKELGRGQFGITYLCTDNASGGTYACKS  120

Query  497  ISKKKLVTKGDKDDM  541
            I K+KLV+K D++DM
Sbjct  121  ILKRKLVSKADREDM  135



>gb|AIO04122.1| calcium-dependent protein kinase [Hevea brasiliensis]
Length=556

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVT  520
            ++ V     ILGK  ED++ +YSLGKELGRGQFG+TYLCTE +TG  YACKSI K+KL  
Sbjct  87   ARSVQTPQTILGKPLEDIKQYYSLGKELGRGQFGITYLCTENSTGHIYACKSILKRKLTN  146

Query  521  KGDKDDM  541
            KGD++D+
Sbjct  147  KGDREDI  153



>gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=540

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            + ILGK +ED+R  Y+LGKELGRGQFGVTY CTE +TG  YACKSI K+KLV K D++DM
Sbjct  79   NNILGKPFEDIRKQYTLGKELGRGQFGVTYHCTENSTGNPYACKSILKRKLVRKNDREDM  138



>ref|XP_010061106.1| PREDICTED: calcium-dependent protein kinase 29-like [Eucalyptus 
grandis]
 gb|KCW68003.1| hypothetical protein EUGRSUZ_F01694 [Eucalyptus grandis]
Length=529

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  329  PPSIS-----KPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            PPS S     +P S+   ILGK Y DV+A Y+L +ELGRGQFGVTYLCTE +TG QYACK
Sbjct  50   PPSRSLTKRRQPSSQIGRILGKPYADVKALYNLDRELGRGQFGVTYLCTERSTGIQYACK  109

Query  494  SISKKKLVTKGDKDDM  541
            SIS++KL+T  D  D+
Sbjct  110  SISQRKLITDNDIGDV  125



>ref|XP_003617233.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AET00192.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=523

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 58/82 (71%), Gaps = 9/82 (11%)
 Frame = +2

Query  323  TRPPSISKPV------SKSDAI---LGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTG  475
            T PP  SKP       SK  AI   LG+  EDV+A YS+GKELGRGQFGVT+LCT  TTG
Sbjct  32   TTPPPWSKPSPQPSKPSKPSAIGPVLGRPMEDVKATYSMGKELGRGQFGVTHLCTHKTTG  91

Query  476  KQYACKSISKKKLVTKGDKDDM  541
            KQYACK+I+K+KL  K D +D+
Sbjct  92   KQYACKTIAKRKLANKEDIEDV  113



>ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase isoform [Glycine 
max]
Length=529

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +2

Query  332  PSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKK  511
            P++ K    S  I+GK ++D++ +YS+GKELGRGQFG+TYLCTE ++G  YACKSI K+K
Sbjct  59   PTVQKKADTS--IVGKPFDDIKKYYSIGKELGRGQFGITYLCTENSSGGTYACKSILKRK  116

Query  512  LVTKGDKDDM  541
            LV+K D++DM
Sbjct  117  LVSKADREDM  126



>ref|XP_006350481.1| PREDICTED: calcium-dependent protein kinase-like [Solanum tuberosum]
Length=545

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  356  KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKD  535
            + D ILGK YE+++AHY+LG+ELGRGQ+GV YLCTE +T + YACKSI K+KLV + D++
Sbjct  82   EQDPILGKPYENIKAHYTLGRELGRGQYGVIYLCTENSTRRNYACKSILKRKLVNRKDRE  141

Query  536  DM  541
            D+
Sbjct  142  DI  143



>gb|KHN38392.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=511

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  329  PPSISKPVSKSDAI---LGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            PPS     SK  AI   LG+A EDV++ YS+GKELGRGQFGVT+LCT  +TGKQYACK+I
Sbjct  44   PPSSKAKQSKPAAIGPVLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTI  103

Query  500  SKKKLVTKGDKDDM  541
            +K+KLV K D +D+
Sbjct  104  AKRKLVNKEDIEDV  117



>ref|NP_001234806.1| calcium-dependent protein kinase [Solanum lycopersicum]
 emb|CAC87494.1| calcium-dependent protein kinase [Solanum lycopersicum]
Length=553

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            + ILGK +E++R  Y+LGKELGRGQFGVTY CTE +TG  YACKSI K+KLV+K D++DM
Sbjct  91   NNILGKPFEEIRKLYTLGKELGRGQFGVTYYCTENSTGNPYACKSILKRKLVSKNDREDM  150



>ref|XP_006575622.1| PREDICTED: calcium-dependent protein kinase 34-like [Glycine 
max]
Length=527

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  329  PPSISKPVSKSDAI---LGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            PPS     SK  AI   LG+A EDV++ YS+GKELGRGQFGVT+LCT  +TGKQYACK+I
Sbjct  44   PPSSKAKQSKPAAIGPVLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTI  103

Query  500  SKKKLVTKGDKDDM  541
            +K+KLV K D +D+
Sbjct  104  AKRKLVNKEDIEDV  117



>sp|P28582.2|CDPK_DAUCA RecName: Full=Calcium-dependent protein kinase; Short=CDPK [Daucus 
carota]
 emb|CAA39936.1| calcium- dependent protein kinase [Daucus carota]
Length=532

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  326  RPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISK  505
            +P  + +P  +S+ ILGK +ED+R  Y+LGKELGRGQFG  Y CTE ++G+ YACKSI K
Sbjct  57   KPRQVHRP--ESNTILGKPFEDIRGKYTLGKELGRGQFGCVYQCTENSSGQLYACKSILK  114

Query  506  KKLVTKGDKDDM  541
            +KLV+K DK+D+
Sbjct  115  RKLVSKNDKEDI  126



>gb|KDO84959.1| hypothetical protein CISIN_1g010263mg [Citrus sinensis]
Length=366

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +2

Query  323  TRPPSISKPVSKSD---AILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            +RPP++SK + ++     ILGK Y D+   Y L KELGRGQFGVTYLCT+  TG++YACK
Sbjct  43   SRPPALSKQIPQTSQIGPILGKPYVDITTIYDLDKELGRGQFGVTYLCTKKATGRKYACK  102

Query  494  SISKKKLVTKGDKDDM  541
            SIS++KLV   D +D+
Sbjct  103  SISRRKLVYDKDMEDV  118



>ref|XP_006391947.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
 gb|ESQ29233.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
Length=553

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
            + + + ILGK +ED++  YSLG+ELGRGQFG+TYLCTEI++GK YACKSI K+KL+   D
Sbjct  82   LQQPEPILGKPFEDIKEKYSLGRELGRGQFGITYLCTEISSGKSYACKSILKRKLIRTQD  141

Query  530  KDDM  541
            ++D+
Sbjct  142  REDV  145



>ref|XP_009368734.1| PREDICTED: calcium-dependent protein kinase 17-like [Pyrus x 
bretschneideri]
Length=534

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = +2

Query  239  AGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGK  418
            A +       H TH      P + +  PT P  ++KP      +LG+  EDVR  YS+GK
Sbjct  32   AANSAPNPSSHATH------PNKPSASPTHPGKVAKP-GPIGPVLGRPMEDVRTTYSIGK  84

Query  419  ELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ELGRGQFGVT+LCT   TG+Q+ACK+I+K+KLV K D +D+
Sbjct  85   ELGRGQFGVTHLCTHKATGEQFACKTIAKRKLVNKEDIEDV  125



>ref|XP_010434101.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
15-like [Camelina sativa]
Length=556

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 2/68 (3%)
 Frame = +2

Query  344  KPVS--KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLV  517
            KP+   +++ ILGK +E++R HY+LG ELGRGQFG+TY C EI+TG  YACKSI K+KL+
Sbjct  82   KPIVFRETETILGKPFEEIRKHYTLGHELGRGQFGITYSCKEISTGNVYACKSILKRKLM  141

Query  518  TKGDKDDM  541
             K D+DD+
Sbjct  142  RKQDRDDV  149



>emb|CDY07254.1| BnaC04g19170D [Brassica napus]
Length=543

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  RPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISK  505
            +P    K + + + ILGK +EDV+  YSLG+ELGRGQFG+TY+CTEI++GK +ACKSI K
Sbjct  66   QPQEQQKLMHQPEPILGKPFEDVKETYSLGRELGRGQFGITYICTEISSGKNFACKSILK  125

Query  506  KKLVTKGDKDDM  541
            +KL+   D++D+
Sbjct  126  RKLIRTQDREDV  137



>gb|KJB68586.1| hypothetical protein B456_010G252400 [Gossypium raimondii]
Length=527

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +2

Query  326  RPPSISKP--VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSI  499
            +PPS +K   V   D +LGK  ED+R +Y+LG ELGRGQFGV YLCTE +TG  YACKSI
Sbjct  51   QPPSANKTSQVKVKDTVLGKPLEDIRQYYTLGDELGRGQFGVIYLCTENSTGHTYACKSI  110

Query  500  SKKKLVTKGDKDDM  541
             K+KL +  DK+D+
Sbjct  111  LKRKLTSLQDKEDI  124



>ref|XP_006828852.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
 gb|ERM96268.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
Length=532

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
            VS  + ILGK   DV + Y+L +ELGRGQFGVTYLCTE TTG QYACKS+SK+KL++K D
Sbjct  76   VSAENTILGKPMVDVSSLYALDRELGRGQFGVTYLCTERTTGLQYACKSVSKRKLMSKSD  135

Query  530  KDDM  541
             +D+
Sbjct  136  VEDI  139



>gb|KJB83565.1| hypothetical protein B456_013G253100 [Gossypium raimondii]
Length=527

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 79/124 (64%), Gaps = 12/124 (10%)
 Frame = +2

Query  188  MGNRSSRHKHGEK-HRSEAGHGGGGSQP----HQTHIEYTKSPG-QGAGLPTRPPSISKP  349
            MGN  +R    +K  ++ AG+G G + P    HQT   Y  +P  QGA    +    SKP
Sbjct  1    MGNCCTRGDGSDKLEKAAAGYGNGDADPTVTSHQT--SYRTAPSSQGASTVGKQ---SKP  55

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
                  +LG+  EDV+A Y++GKELGRGQFG+T+LCT  TTG+Q+ACK+I+K+KL +K D
Sbjct  56   APMG-PVLGRPMEDVKATYTIGKELGRGQFGITHLCTHKTTGEQFACKTIAKRKLSSKED  114

Query  530  KDDM  541
             +D+
Sbjct  115  VEDV  118



>ref|XP_010430219.1| PREDICTED: calcium-dependent protein kinase 19 [Camelina sativa]
Length=482

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            ILGK +ED++  YSLG+ELGRGQFG+TY+CTEI++GK +ACKSI K+KL+   D++D+
Sbjct  15   ILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTQDREDV  72



>ref|XP_006287505.1| hypothetical protein CARUB_v10000714mg [Capsella rubella]
 gb|EOA20403.1| hypothetical protein CARUB_v10000714mg [Capsella rubella]
Length=524

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 69/119 (58%), Gaps = 14/119 (12%)
 Frame = +2

Query  224  KHRSEAGHGGGGS---QPHQTHIEYTKSPGQGA-GLPTRPPS-------ISKPVSKS--D  364
            KHR     GG  S    P QTH+   + P Q     PTR P+        + P+S    D
Sbjct  7    KHRETQNDGGERSFPISPAQTHV-VNQVPEQSKPQTPTRKPTNQQIPTPSANPISARGLD  65

Query  365  AILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
             ILGK +ED+R  YSLGKELG+G F  TY+CTEI+TG  YACKSI K  L+++  ++D+
Sbjct  66   TILGKPFEDIRKVYSLGKELGQGYFATTYMCTEISTGNTYACKSILKSNLISQIYEEDV  124



>ref|XP_006473713.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X2 
[Citrus sinensis]
Length=466

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +2

Query  323  TRPPSISKPVSKSDAI---LGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            +RPP++SK + ++  I   LGK Y D+   Y L KELGRGQFGVTYLCT+  TG++YACK
Sbjct  43   SRPPALSKQIPQTSQIGPILGKPYVDITTIYDLDKELGRGQFGVTYLCTKKATGRKYACK  102

Query  494  SISKKKLVTKGDKDDM  541
            SIS++KLV   D +D+
Sbjct  103  SISRRKLVYDKDMEDV  118



>ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
sylvestris]
Length=542

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            + ILGK +ED+R  Y+LGKELGRGQFGVTY CTE +TG  YACKSI K+KLV K D++D+
Sbjct  81   NNILGKPFEDIRKQYTLGKELGRGQFGVTYHCTENSTGNPYACKSILKRKLVRKNDREDI  140



>gb|KFK40633.1| hypothetical protein AALP_AA2G022000 [Arabis alpina]
Length=551

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
            + + + ILGK +EDV+  YSLG+ELGRGQFG+TYLCTEI++GK +ACKSI K+KL+   D
Sbjct  83   LQQPEPILGKPFEDVKEKYSLGRELGRGQFGITYLCTEISSGKNFACKSILKRKLIRTQD  142

Query  530  KDDM  541
            ++D+
Sbjct  143  REDV  146



>ref|XP_009120894.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
 emb|CDX92536.1| BnaA10g15750D [Brassica napus]
Length=517

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  320  PTRPPSISK--PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            P  PP  +K  P+     +LG+  EDV++ YSLGKELGRGQFGVTYLCT+  TG Q+ACK
Sbjct  33   PASPPPATKQGPIG---PVLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACK  89

Query  494  SISKKKLVTKGDKDDM  541
            +I+K+KLV K D +D+
Sbjct  90   TIAKRKLVNKEDIEDV  105



>emb|CDY13993.1| BnaC09g38330D [Brassica napus]
Length=517

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  320  PTRPPSISK--PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            P  PP  +K  P+     +LG+  EDV++ YSLGKELGRGQFGVTYLCT+  TG Q+ACK
Sbjct  33   PASPPPATKQGPIG---PVLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACK  89

Query  494  SISKKKLVTKGDKDDM  541
            +I+K+KLV K D +D+
Sbjct  90   TIAKRKLVNKEDIEDV  105



>ref|XP_010266343.1| PREDICTED: uncharacterized protein LOC104603873 [Nelumbo nucifera]
Length=1074

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +2

Query  290  TKSPGQGAGLPTRPPSISKPVSKSD--AILGKAYEDVRAHYSLGKELGRGQFGVTYLCTE  463
            +K P Q +   + P S+SK  S S    ILGK   D+ + Y L KELGRGQFG+TYLCTE
Sbjct  586  SKKPHQQSDAASLPTSLSKATSSSQIGTILGKPICDLTSIYDLDKELGRGQFGITYLCTE  645

Query  464  ITTGKQYACKSISKKKLVTKGDKDDM  541
              TG++YACKSISK+KLV K D +D+
Sbjct  646  KATGRKYACKSISKRKLVNKRDIEDV  671


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  317  LPTRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
            LPT  P  +   S++  ILGK   D+ + Y L KELGRGQFG+TYLCTE  TG++YACKS
Sbjct  30   LPTSLPKATSS-SQNGTILGKPICDLTSIYDLDKELGRGQFGITYLCTEKATGRKYACKS  88

Query  497  ISKKKLVTKGDKDDM  541
            ISK+KLV K D +D+
Sbjct  89   ISKRKLVNKKDIEDV  103



>ref|XP_006473712.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X1 
[Citrus sinensis]
 gb|KDO84958.1| hypothetical protein CISIN_1g010263mg [Citrus sinensis]
Length=514

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +2

Query  323  TRPPSISKPVSKSDAI---LGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            +RPP++SK + ++  I   LGK Y D+   Y L KELGRGQFGVTYLCT+  TG++YACK
Sbjct  43   SRPPALSKQIPQTSQIGPILGKPYVDITTIYDLDKELGRGQFGVTYLCTKKATGRKYACK  102

Query  494  SISKKKLVTKGDKDDM  541
            SIS++KLV   D +D+
Sbjct  103  SISRRKLVYDKDMEDV  118



>ref|XP_009630031.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 73/132 (55%), Gaps = 22/132 (17%)
 Frame = +2

Query  188  MGNRSSRHKHGEKHRSEAGHG------------GGGSQPHQTH--IEYTKSPGQGAGLPT  325
            MGN  SR +   +H +   H                SQ  Q H  I   KSP      P+
Sbjct  1    MGNCCSRGQPDNEHTNNNDHTRQKSNTKNDQSVSNNSQQQQNHGSITPPKSPD-----PS  55

Query  326  RPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISK  505
              PS + P+     +LG+  EDVR  YS+GKELGRGQFGVT+LCT   +G+Q+ACK+I+K
Sbjct  56   SKPSKNSPIG---PVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAK  112

Query  506  KKLVTKGDKDDM  541
            +KLV K D +D+
Sbjct  113  RKLVNKEDIEDV  124



>ref|XP_006435253.1| hypothetical protein CICLE_v10000897mg [Citrus clementina]
 gb|ESR48493.1| hypothetical protein CICLE_v10000897mg [Citrus clementina]
Length=514

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +2

Query  323  TRPPSISKPVSKSDAI---LGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            +RPP++SK + ++  I   LGK Y D+   Y L KELGRGQFGVTYLCT+  TG++YACK
Sbjct  43   SRPPALSKQIPQTSQIGPILGKPYVDITTIYDLDKELGRGQFGVTYLCTKKATGRKYACK  102

Query  494  SISKKKLVTKGDKDDM  541
            SIS++KLV   D +D+
Sbjct  103  SISRRKLVYDKDMEDV  118



>ref|XP_007160124.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
 gb|ESW32118.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
Length=519

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 65/109 (60%), Gaps = 11/109 (10%)
 Frame = +2

Query  239  AGHGGGGSQPHQTHIEYTKSPGQGAGLPTRPPSI--SKPVSKSDA------ILGKAYEDV  394
            + HGGGG+    T   Y+    Q  G+   PP+   S P+ K  A      +LG+  EDV
Sbjct  6    SSHGGGGTPATST---YSDELPQRNGITVLPPNTNPSPPLPKPQASSSLGRVLGRPMEDV  62

Query  395  RAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            R+ Y  G+ELGRGQFGVTYL T   T +Q+ACKSI+ +KLV + D DD+
Sbjct  63   RSIYIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLVNRDDIDDV  111



>ref|XP_010418170.1| PREDICTED: calcium-dependent protein kinase 19-like [Camelina 
sativa]
Length=555

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  350  VSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGD  529
            + + + ILGK +ED++  YSLG+ELGRGQFG+TY+CTEI++GK +ACKSI K+KL+   D
Sbjct  82   LQQPEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTQD  141

Query  530  KDDM  541
            ++D+
Sbjct  142  REDV  145



>ref|XP_009402456.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = +2

Query  296  SPGQGAGLPT---RPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEI  466
            +P Q A +PT    PP   KP +    +LG+  EDVR  YSLGKELGRGQFGVT+LCT  
Sbjct  34   APVQTAPVPTAAFSPPP--KPAAPIGPVLGRPMEDVRTTYSLGKELGRGQFGVTHLCTHK  91

Query  467  TTGKQYACKSISKKKLVTKGDKDDM  541
             TG +YACK+I+K+KL  K D +D+
Sbjct  92   ATGDKYACKTIAKRKLANKEDIEDV  116



>emb|CDY24863.1| BnaA03g59670D [Brassica napus]
Length=543

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  323  TRPPSISKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSIS  502
            + P    K + + + I GK +EDV+  YSLG+ELGRGQFG+TYLCTEI++GK +ACKSI 
Sbjct  65   SHPQEQQKLMHQPEPISGKPFEDVKETYSLGRELGRGQFGITYLCTEISSGKNFACKSIL  124

Query  503  KKKLVTKGDKDDM  541
            K+KL+   D++D+
Sbjct  125  KRKLIRTQDREDV  137



>ref|XP_009131258.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=523

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 5/76 (7%)
 Frame = +2

Query  320  PTRPPSISK--PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            P  PP  +K  P+     +LG+  EDV+A YSLGKELGRGQFGVT+LCT+  TG+Q+ACK
Sbjct  41   PPSPPPATKQGPIG---PVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACK  97

Query  494  SISKKKLVTKGDKDDM  541
            +I+K+KLV K D +D+
Sbjct  98   TIAKRKLVNKEDIEDV  113



>emb|CDX78468.1| BnaA03g03800D [Brassica napus]
Length=523

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 5/76 (7%)
 Frame = +2

Query  320  PTRPPSISK--PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            P  PP  +K  P+     +LG+  EDV+A YSLGKELGRGQFGVT+LCT+  TG+Q+ACK
Sbjct  41   PPSPPPATKQGPIG---PVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACK  97

Query  494  SISKKKLVTKGDKDDM  541
            +I+K+KLV K D +D+
Sbjct  98   TIAKRKLVNKEDIEDV  113



>gb|AHG06449.1| calcium-dependent protein kinase 17 [Brassica napus]
Length=523

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 5/76 (7%)
 Frame = +2

Query  320  PTRPPSISK--PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            P  PP  +K  P+     +LG+  EDV+A YSLGKELGRGQFGVT+LCT+  TG+Q+ACK
Sbjct  41   PPSPPPATKQGPIG---PVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACK  97

Query  494  SISKKKLVTKGDKDDM  541
            +I+K+KLV K D +D+
Sbjct  98   TIAKRKLVNKEDIEDV  113



>ref|XP_010448965.1| PREDICTED: calcium-dependent protein kinase 15 [Camelina sativa]
Length=558

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 2/68 (3%)
 Frame = +2

Query  344  KPVS--KSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLV  517
            KP+   +++ ILGK +E +R HY+LG ELGRGQFG+TY C EI+TG  YACKSI K+KL+
Sbjct  84   KPIVFRETETILGKPFEGIRKHYTLGHELGRGQFGITYSCKEISTGNVYACKSILKRKLM  143

Query  518  TKGDKDDM  541
             K D+DD+
Sbjct  144  RKQDRDDV  151



>ref|XP_003545165.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=529

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +2

Query  320  PTRPPSI-SKPVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKS  496
            P  PPS  SKP +    +LG+  EDV++ YS+GKELGRGQFGVT+LCT  +TGKQYACK+
Sbjct  46   PNHPPSKHSKPPAIG-PVLGRPMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKT  104

Query  497  ISKKKLVTKGDKDDM  541
            I+K+KLV K D +D+
Sbjct  105  IAKRKLVNKEDIEDV  119



>ref|XP_004491231.1| PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum]
Length=520

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDD  538
            +L +  EDV+A YS+GKELGRGQFGVTYLCT  TTGKQYACK+I+K+KLV K D +D
Sbjct  53   VLERPMEDVKATYSIGKELGRGQFGVTYLCTHKTTGKQYACKTIAKRKLVNKEDIED  109



>gb|KHN28162.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=472

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  368  ILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACKSISKKKLVTKGDKDDM  541
            +LG+  EDVRA Y++GKELGRGQFGVT+LCT  TTG+Q+ACK+I+K+KLV K D +D+
Sbjct  4    VLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKTTGQQFACKTIAKRKLVNKEDIEDV  61



>gb|AAL59948.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
Length=528

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 5/76 (7%)
 Frame = +2

Query  320  PTRPPSISK--PVSKSDAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEITTGKQYACK  493
            P  PP  +K  P+     +LG+  EDV+A YSLGKELGRGQFGVT+LCT+ +TG Q+ACK
Sbjct  46   PPSPPPATKQGPIG---PVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKSTGHQFACK  102

Query  494  SISKKKLVTKGDKDDM  541
            +I+K+KLV K D +D+
Sbjct  103  TIAKRKLVNKEDIEDV  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645