BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J11

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004251587.1|  PREDICTED: acyl-protein thioesterase 2             187   7e-56   Solanum lycopersicum
ref|XP_006366864.1|  PREDICTED: acyl-protein thioesterase 2-like        186   8e-56   Solanum tuberosum [potatoes]
ref|XP_009797714.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    186   2e-55   Nicotiana sylvestris
ref|XP_009630835.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    186   2e-55   Nicotiana tomentosiformis
ref|XP_009630836.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    186   3e-55   Nicotiana tomentosiformis
gb|EYU18265.1|  hypothetical protein MIMGU_mgv1a012268mg                184   7e-55   Erythranthe guttata [common monkey flower]
ref|XP_009630837.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    184   7e-55   Nicotiana tomentosiformis
emb|CDP10367.1|  unnamed protein product                                183   1e-54   Coffea canephora [robusta coffee]
ref|XP_007202360.1|  hypothetical protein PRUPE_ppa009197mg             184   2e-54   Prunus persica
ref|XP_008337331.1|  PREDICTED: acyl-protein thioesterase 1 isofo...    179   7e-53   Malus domestica [apple tree]
ref|XP_008337330.1|  PREDICTED: acyl-protein thioesterase 1 isofo...    179   7e-53   
ref|XP_002524444.1|  Acyl-protein thioesterase, putative                177   6e-52   Ricinus communis
ref|XP_008242725.1|  PREDICTED: acyl-protein thioesterase 2             176   1e-51   Prunus mume [ume]
gb|KCW79781.1|  hypothetical protein EUGRSUZ_C01119                     175   1e-51   Eucalyptus grandis [rose gum]
gb|KJB83077.1|  hypothetical protein B456_013G233000                    173   3e-51   Gossypium raimondii
ref|XP_010047797.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    175   3e-51   Eucalyptus grandis [rose gum]
ref|XP_010047795.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    176   4e-51   
ref|XP_004287363.1|  PREDICTED: acyl-protein thioesterase 2             174   6e-51   Fragaria vesca subsp. vesca
ref|XP_008354381.1|  PREDICTED: acyl-protein thioesterase 1-like        174   9e-51   
gb|KJB83076.1|  hypothetical protein B456_013G233000                    173   1e-50   Gossypium raimondii
ref|XP_009797713.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    173   2e-50   Nicotiana sylvestris
gb|KJB54088.1|  hypothetical protein B456_009G020100                    172   3e-50   Gossypium raimondii
gb|KHG03780.1|  Acyl-protein thioesterase 2                             171   3e-50   Gossypium arboreum [tree cotton]
ref|XP_007013351.1|  Alpha/beta-Hydrolases superfamily protein is...    172   5e-50   Theobroma cacao [chocolate]
gb|KDO80323.1|  hypothetical protein CISIN_1g024379mg                   170   6e-50   Citrus sinensis [apfelsine]
gb|KHG04929.1|  Acyl-protein thioesterase 2                             167   8e-50   Gossypium arboreum [tree cotton]
ref|XP_010656400.1|  PREDICTED: acyl-protein thioesterase 2             171   1e-49   Vitis vinifera
ref|XP_006371944.1|  hypothetical protein POPTR_0018s06570g             169   1e-49   
ref|XP_006475789.1|  PREDICTED: acyl-protein thioesterase 2-like        171   1e-49   Citrus sinensis [apfelsine]
gb|KDO80322.1|  hypothetical protein CISIN_1g024379mg                   171   1e-49   Citrus sinensis [apfelsine]
ref|XP_011008876.1|  PREDICTED: acyl-protein thioesterase 2-like ...    169   2e-49   Populus euphratica
gb|KHN06121.1|  Acyl-protein thioesterase 2                             168   4e-49   Glycine soja [wild soybean]
gb|ABK95495.1|  unknown                                                 169   5e-49   Populus trichocarpa [western balsam poplar]
gb|KJB64798.1|  hypothetical protein B456_010G065500                    164   8e-49   Gossypium raimondii
ref|XP_010047799.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    168   1e-48   Eucalyptus grandis [rose gum]
ref|XP_011008872.1|  PREDICTED: acyl-protein thioesterase 2-like ...    168   1e-48   Populus euphratica
ref|XP_010047796.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    169   1e-48   
ref|NP_001239784.1|  uncharacterized protein LOC100796190               168   1e-48   Glycine max [soybeans]
ref|XP_003527153.1|  PREDICTED: acyl-protein thioesterase 2-like ...    168   1e-48   Glycine max [soybeans]
ref|XP_010688073.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    168   1e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK37927.1|  unknown                                                 168   2e-48   Medicago truncatula
gb|KEH37959.1|  acyl-protein thioesterase                               167   2e-48   Medicago truncatula
ref|XP_010249993.1|  PREDICTED: acyl-protein thioesterase 2-like        167   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009389937.1|  PREDICTED: acyl-protein thioesterase 2-like        167   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010688069.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    168   3e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK34792.1|  unknown                                                 165   3e-48   Lotus japonicus
ref|XP_010535874.1|  PREDICTED: acyl-protein thioesterase 2-like        167   3e-48   Tarenaya hassleriana [spider flower]
gb|KJB64799.1|  hypothetical protein B456_010G065500                    163   5e-48   Gossypium raimondii
emb|CDO98115.1|  unnamed protein product                                166   7e-48   Coffea canephora [robusta coffee]
ref|XP_011072250.1|  PREDICTED: acyl-protein thioesterase 1 homol...    166   7e-48   Sesamum indicum [beniseed]
ref|XP_008792088.1|  PREDICTED: acyl-protein thioesterase 2             166   9e-48   Phoenix dactylifera
ref|XP_010914919.1|  PREDICTED: acyl-protein thioesterase 2             165   1e-47   Elaeis guineensis
ref|XP_010925247.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    165   1e-47   Elaeis guineensis
ref|XP_008785152.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    165   2e-47   Phoenix dactylifera
gb|KHG00787.1|  Acyl-protein thioesterase 2                             165   2e-47   Gossypium arboreum [tree cotton]
ref|XP_009399762.1|  PREDICTED: acyl-protein thioesterase 2-like        165   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW79779.1|  hypothetical protein EUGRSUZ_C01119                     165   2e-47   Eucalyptus grandis [rose gum]
ref|XP_009345298.1|  PREDICTED: acyl-protein thioesterase 2-like        165   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_008378308.1|  PREDICTED: acyl-protein thioesterase 2-like ...    165   3e-47   
ref|XP_009347638.1|  PREDICTED: acyl-protein thioesterase 2-like ...    165   3e-47   Pyrus x bretschneideri [bai li]
gb|EPS72096.1|  hypothetical protein M569_02661                         164   3e-47   Genlisea aurea
ref|XP_008378307.1|  PREDICTED: acyl-protein thioesterase 2-like ...    165   4e-47   
ref|XP_009347639.1|  PREDICTED: acyl-protein thioesterase 2-like ...    164   4e-47   Pyrus x bretschneideri [bai li]
gb|AFK34216.1|  unknown                                                 164   5e-47   Lotus japonicus
ref|XP_009347637.1|  PREDICTED: acyl-protein thioesterase 2-like ...    165   5e-47   Pyrus x bretschneideri [bai li]
ref|XP_002285009.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    164   5e-47   Vitis vinifera
ref|XP_008394055.1|  PREDICTED: acyl-protein thioesterase 2-like        164   6e-47   Malus domestica [apple tree]
ref|XP_008465012.1|  PREDICTED: acyl-protein thioesterase 2             164   6e-47   Cucumis melo [Oriental melon]
gb|KJB70576.1|  hypothetical protein B456_011G080600                    164   7e-47   Gossypium raimondii
ref|XP_008378306.1|  PREDICTED: acyl-protein thioesterase 2-like ...    164   7e-47   
ref|XP_007023936.1|  Alpha/beta-Hydrolases superfamily protein is...    163   8e-47   
ref|XP_007138319.1|  hypothetical protein PHAVU_009G198700g             164   8e-47   Phaseolus vulgaris [French bean]
ref|XP_007013352.1|  Alpha/beta-Hydrolases superfamily protein is...    163   8e-47   
ref|XP_002517576.1|  Acyl-protein thioesterase, putative                163   9e-47   Ricinus communis
gb|KJB54089.1|  hypothetical protein B456_009G020100                    162   2e-46   Gossypium raimondii
ref|XP_011039721.1|  PREDICTED: acyl-protein thioesterase 2-like        162   3e-46   Populus euphratica
ref|XP_011019782.1|  PREDICTED: acyl-protein thioesterase 2-like        162   3e-46   Populus euphratica
ref|XP_010688070.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    162   3e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002324285.1|  hypothetical protein POPTR_0018s01470g             162   3e-46   Populus trichocarpa [western balsam poplar]
gb|KJB68126.1|  hypothetical protein B456_010G227200                    162   3e-46   Gossypium raimondii
gb|KJB68127.1|  hypothetical protein B456_010G227200                    162   3e-46   Gossypium raimondii
ref|XP_011026469.1|  PREDICTED: acyl-protein thioesterase 2-like        162   3e-46   Populus euphratica
ref|XP_004150012.1|  PREDICTED: acyl-protein thioesterase 2-like        162   4e-46   Cucumis sativus [cucumbers]
gb|KHG10709.1|  Acyl-protein thioesterase 2                             161   5e-46   Gossypium arboreum [tree cotton]
gb|KDP32363.1|  hypothetical protein JCGZ_13288                         162   5e-46   Jatropha curcas
ref|XP_010254331.1|  PREDICTED: acyl-protein thioesterase 2-like        161   5e-46   Nelumbo nucifera [Indian lotus]
dbj|BAJ86349.1|  predicted protein                                      162   6e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010688068.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    162   6e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008445176.1|  PREDICTED: acyl-protein thioesterase 2-like        161   6e-46   
ref|XP_004138733.1|  PREDICTED: acyl-protein thioesterase 2-like        160   1e-45   Cucumis sativus [cucumbers]
ref|XP_006841917.1|  hypothetical protein AMTR_s00042p00153000          160   1e-45   
ref|XP_010520588.1|  PREDICTED: acyl-protein thioesterase 2-like        160   2e-45   Tarenaya hassleriana [spider flower]
dbj|BAJ53250.1|  JHL25H03.13                                            160   2e-45   Jatropha curcas
ref|XP_009131769.1|  PREDICTED: acyl-protein thioesterase 2             160   2e-45   Brassica rapa
ref|XP_008230034.1|  PREDICTED: acyl-protein thioesterase 2-like        159   3e-45   
ref|XP_006427187.1|  hypothetical protein CICLE_v10026074mg             161   3e-45   
ref|XP_009774144.1|  PREDICTED: acyl-protein thioesterase 2-like        159   3e-45   Nicotiana sylvestris
ref|XP_008785111.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    159   3e-45   
ref|XP_006427186.1|  hypothetical protein CICLE_v10026074mg             161   3e-45   
ref|XP_010920065.1|  PREDICTED: acyl-protein thioesterase 2-like        159   4e-45   Elaeis guineensis
ref|XP_004968388.1|  PREDICTED: acyl-protein thioesterase 2-like        159   4e-45   Setaria italica
ref|XP_009789313.1|  PREDICTED: acyl-protein thioesterase 1 homol...    159   5e-45   Nicotiana sylvestris
gb|AAM29178.1|  biostress-resistance-related protein                    160   5e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009629002.1|  PREDICTED: acyl-protein thioesterase 1 homol...    159   6e-45   Nicotiana tomentosiformis
ref|NP_001150035.1|  acyl-protein thioesterase 2                        159   6e-45   Zea mays [maize]
ref|XP_006427188.1|  hypothetical protein CICLE_v10026074mg             159   6e-45   
ref|XP_006465384.1|  PREDICTED: acyl-protein thioesterase 2-like        159   6e-45   Citrus sinensis [apfelsine]
gb|AFW80178.1|  hypothetical protein ZEAMMB73_309051                    159   7e-45   
ref|XP_009126414.1|  PREDICTED: acyl-protein thioesterase 2-like ...    158   8e-45   Brassica rapa
ref|XP_010322678.1|  PREDICTED: acyl-protein thioesterase 2-like ...    158   1e-44   
ref|XP_006356194.1|  PREDICTED: acyl-protein thioesterase 2-like        158   1e-44   Solanum tuberosum [potatoes]
ref|XP_010230528.1|  PREDICTED: acyl-protein thioesterase 1 homol...    158   1e-44   
ref|XP_011035658.1|  PREDICTED: acyl-protein thioesterase 2-like        158   1e-44   Populus euphratica
ref|XP_008809651.1|  PREDICTED: acyl-protein thioesterase 2-like        157   2e-44   Phoenix dactylifera
ref|XP_002308652.2|  hypothetical protein POPTR_0006s26730g             157   2e-44   
ref|NP_197506.1|  phospholipase/carboxylesterase family protein         157   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007023935.1|  Alpha/beta-Hydrolases superfamily protein is...    158   2e-44   
ref|XP_006400572.1|  hypothetical protein EUTSA_v10014480mg             157   2e-44   Eutrema salsugineum [saltwater cress]
ref|XP_002871919.1|  phospholipase/carboxylesterase family protein      157   2e-44   Arabidopsis lyrata subsp. lyrata
gb|ACN35659.1|  unknown                                                 159   2e-44   Zea mays [maize]
gb|ACF79577.1|  unknown                                                 155   3e-44   Zea mays [maize]
ref|XP_006288411.1|  hypothetical protein CARUB_v10001666mg             157   3e-44   
ref|XP_002285335.1|  PREDICTED: acyl-protein thioesterase 2             157   4e-44   Vitis vinifera
ref|XP_009589216.1|  PREDICTED: acyl-protein thioesterase 2-like        156   4e-44   Nicotiana tomentosiformis
gb|KHG30420.1|  Acyl-protein thioesterase 2                             156   4e-44   Gossypium arboreum [tree cotton]
gb|KJB56648.1|  hypothetical protein B456_009G129700                    156   5e-44   Gossypium raimondii
emb|CBI36259.3|  unnamed protein product                                157   6e-44   Vitis vinifera
ref|XP_009380412.1|  PREDICTED: acyl-protein thioesterase 2-like        156   6e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925246.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    157   6e-44   Elaeis guineensis
ref|NP_001042168.2|  Os01g0175000                                       157   7e-44   
gb|EMT28452.1|  Acyl-protein thioesterase 2                             157   9e-44   
gb|ABR16303.1|  unknown                                                 155   9e-44   Picea sitchensis
dbj|BAH20103.1|  AT5G20060                                              155   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|EEE53965.1|  hypothetical protein OsJ_00575                          155   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001131247.2|  uncharacterized protein LOC100192559               155   1e-43   
emb|CDP04787.1|  unnamed protein product                                155   1e-43   Coffea canephora [robusta coffee]
emb|CDY45109.1|  BnaA02g04670D                                          162   1e-43   Brassica napus [oilseed rape]
dbj|BAB62566.1|  putative lysophospholipase 2                           155   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009334767.1|  PREDICTED: acyl-protein thioesterase 2-like        155   1e-43   
dbj|BAD68124.1|  putative lysophospholipase 2                           154   1e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70031.1|  hypothetical protein OsI_00606                          157   2e-43   Oryza sativa Indica Group [Indian rice]
gb|EYU21607.1|  hypothetical protein MIMGU_mgv1a012402mg                154   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_002299611.1|  phospholipase/carboxylesterase family protein      154   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_007227247.1|  hypothetical protein PRUPE_ppa017996mg             154   3e-43   
ref|XP_007215843.1|  hypothetical protein PRUPE_ppa010240mg             153   7e-43   Prunus persica
gb|EMS55551.1|  Acyl-protein thioesterase 2                             157   7e-43   Triticum urartu
ref|XP_011459207.1|  PREDICTED: acyl-protein thioesterase 2-like ...    154   8e-43   Fragaria vesca subsp. vesca
ref|XP_008228643.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-protein...    152   9e-43   
emb|CDX70910.1|  BnaC03g09940D                                          160   9e-43   
ref|XP_007137043.1|  hypothetical protein PHAVU_009G095000g             152   2e-42   Phaseolus vulgaris [French bean]
ref|XP_006483705.1|  PREDICTED: acyl-protein thioesterase 2-like        152   3e-42   Citrus sinensis [apfelsine]
ref|XP_006450483.1|  hypothetical protein CICLE_v10009080mg             151   3e-42   Citrus clementina [clementine]
gb|KHN08117.1|  Acyl-protein thioesterase 2                             151   3e-42   Glycine soja [wild soybean]
ref|XP_006450482.1|  hypothetical protein CICLE_v10009080mg             152   3e-42   
gb|KDO61680.1|  hypothetical protein CISIN_1g022847mg                   152   4e-42   Citrus sinensis [apfelsine]
ref|NP_001240872.1|  uncharacterized protein LOC100811642               151   5e-42   Glycine max [soybeans]
ref|XP_010493100.1|  PREDICTED: acyl-protein thioesterase 2             150   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010454302.1|  PREDICTED: acyl-protein thioesterase 2-like        150   8e-42   Camelina sativa [gold-of-pleasure]
ref|XP_003526419.1|  PREDICTED: acyl-protein thioesterase 2-like        150   8e-42   Glycine max [soybeans]
ref|XP_002515548.1|  Acyl-protein thioesterase, putative                150   1e-41   Ricinus communis
gb|ACG39837.1|  acyl-protein thioesterase 2                             150   1e-41   Zea mays [maize]
ref|XP_004291485.1|  PREDICTED: acyl-protein thioesterase 2-like ...    150   2e-41   Fragaria vesca subsp. vesca
ref|XP_009403010.1|  PREDICTED: acyl-protein thioesterase 2-like        149   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010322679.1|  PREDICTED: acyl-protein thioesterase 2-like ...    149   2e-41   Solanum lycopersicum
ref|XP_006645555.1|  PREDICTED: acyl-protein thioesterase 2-like        149   2e-41   
gb|EPS73326.1|  hypothetical protein M569_01428                         149   3e-41   Genlisea aurea
ref|XP_011040013.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    147   3e-41   Populus euphratica
emb|CAN77362.1|  hypothetical protein VITISV_011037                     151   3e-41   Vitis vinifera
gb|KCW53795.1|  hypothetical protein EUGRSUZ_J03039                     147   4e-41   Eucalyptus grandis [rose gum]
ref|XP_010033922.1|  PREDICTED: acyl-protein thioesterase 1 isofo...    149   4e-41   Eucalyptus grandis [rose gum]
ref|XP_003603430.1|  Acyl-protein thioesterase                          148   6e-41   Medicago truncatula
ref|XP_010420838.1|  PREDICTED: acyl-protein thioesterase 2-like        148   6e-41   Camelina sativa [gold-of-pleasure]
emb|CDX88861.1|  BnaA03g07880D                                          157   6e-41   
ref|XP_007135729.1|  hypothetical protein PHAVU_010G153400g             147   1e-40   Phaseolus vulgaris [French bean]
ref|XP_002304161.1|  phospholipase/carboxylesterase family protein      147   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011040012.1|  PREDICTED: acyl-protein thioesterase 2 isofo...    147   1e-40   Populus euphratica
ref|XP_008350420.1|  PREDICTED: acyl-protein thioesterase 2-like        147   1e-40   Malus domestica [apple tree]
ref|XP_010033923.1|  PREDICTED: acyl-protein thioesterase 1 isofo...    147   2e-40   
ref|XP_004302945.1|  PREDICTED: acyl-protein thioesterase 2             147   2e-40   Fragaria vesca subsp. vesca
ref|XP_006305405.1|  hypothetical protein CARUB_v10009797mg             148   3e-40   
ref|XP_003531704.1|  PREDICTED: acyl-protein thioesterase 2-like ...    146   4e-40   Glycine max [soybeans]
gb|AAD55595.1|AC008016_5  F6D8.5                                        144   4e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KEH37960.1|  acyl-protein thioesterase                               145   4e-40   Medicago truncatula
ref|XP_011084000.1|  PREDICTED: acyl-protein thioesterase 2-like        145   7e-40   Sesamum indicum [beniseed]
ref|XP_007013823.1|  Acyl-protein thioesterase 2                        145   8e-40   Theobroma cacao [chocolate]
ref|XP_008377618.1|  PREDICTED: acyl-protein thioesterase 2             145   8e-40   Malus domestica [apple tree]
ref|XP_011081941.1|  PREDICTED: acyl-protein thioesterase 2-like        145   8e-40   Sesamum indicum [beniseed]
ref|XP_006392878.1|  hypothetical protein EUTSA_v10011726mg             145   1e-39   Eutrema salsugineum [saltwater cress]
emb|CDY72010.1|  BnaC03g78050D                                          143   1e-39   Brassica napus [oilseed rape]
ref|XP_009333641.1|  PREDICTED: acyl-protein thioesterase 2             144   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_009107020.1|  PREDICTED: acyl-protein thioesterase 1 homol...    144   2e-39   Brassica rapa
ref|NP_175679.2|  alpha/beta-Hydrolases superfamily protein             144   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006361514.1|  PREDICTED: acyl-protein thioesterase 2-like ...    144   2e-39   Solanum tuberosum [potatoes]
ref|XP_004501308.1|  PREDICTED: acyl-protein thioesterase 1 homol...    144   2e-39   Cicer arietinum [garbanzo]
ref|XP_004245199.1|  PREDICTED: acyl-protein thioesterase 1 homol...    144   2e-39   Solanum lycopersicum
ref|XP_010500884.1|  PREDICTED: acyl-protein thioesterase 2-like ...    144   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009107021.1|  PREDICTED: acyl-protein thioesterase 1-like ...    144   3e-39   
gb|ACU24196.1|  unknown                                                 144   3e-39   Glycine max [soybeans]
ref|XP_010479784.1|  PREDICTED: acyl-protein thioesterase 2-like ...    144   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009144821.1|  PREDICTED: acyl-protein thioesterase 2             144   3e-39   
ref|XP_010462117.1|  PREDICTED: acyl-protein thioesterase 2-like ...    144   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003528353.1|  PREDICTED: acyl-protein thioesterase 2-like        144   4e-39   Glycine max [soybeans]
emb|CDY02538.1|  BnaA08g01450D                                          143   6e-39   
ref|XP_009400510.1|  PREDICTED: acyl-protein thioesterase 2-like        143   6e-39   
ref|XP_008775038.1|  PREDICTED: acyl-protein thioesterase 2-like        144   8e-39   
ref|XP_010061942.1|  PREDICTED: acyl-protein thioesterase 1 homol...    142   8e-39   Eucalyptus grandis [rose gum]
ref|XP_010691200.1|  PREDICTED: acyl-protein thioesterase 2             142   9e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006585644.1|  PREDICTED: acyl-protein thioesterase 2-like ...    142   9e-39   
ref|XP_004152217.1|  PREDICTED: acyl-protein thioesterase 2-like        142   1e-38   
ref|XP_004156814.1|  PREDICTED: acyl-protein thioesterase 2-like        142   1e-38   
emb|CDY60557.1|  BnaA05g35750D                                          142   1e-38   Brassica napus [oilseed rape]
gb|KDP33625.1|  hypothetical protein JCGZ_07196                         142   1e-38   Jatropha curcas
ref|XP_008454274.1|  PREDICTED: acyl-protein thioesterase 2             142   1e-38   Cucumis melo [Oriental melon]
ref|NP_001189903.1|  alpha/beta-Hydrolases superfamily protein          143   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006585643.1|  PREDICTED: acyl-protein thioesterase 2-like ...    142   1e-38   Glycine max [soybeans]
ref|XP_004969150.1|  PREDICTED: acyl-protein thioesterase 1 homol...    142   1e-38   Setaria italica
ref|NP_001052156.2|  Os04g0174900                                       137   3e-38   
ref|XP_003569345.1|  PREDICTED: acyl-protein thioesterase 1 homol...    140   4e-38   Brachypodium distachyon [annual false brome]
gb|EYU29226.1|  hypothetical protein MIMGU_mgv1a012792mg                139   8e-38   Erythranthe guttata [common monkey flower]
ref|NP_001043556.1|  Os01g0612500                                       139   1e-37   
gb|EEE54977.1|  hypothetical protein OsJ_02584                          140   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652102.1|  PREDICTED: acyl-protein thioesterase 1 homol...    139   1e-37   Oryza brachyantha
ref|XP_009763809.1|  PREDICTED: acyl-protein thioesterase 2-like ...    139   2e-37   Nicotiana sylvestris
ref|XP_009603471.1|  PREDICTED: acyl-protein thioesterase 2-like ...    140   3e-37   
gb|EEC76867.1|  hypothetical protein OsI_15057                          138   3e-37   Oryza sativa Indica Group [Indian rice]
dbj|BAH00877.1|  unnamed protein product                                138   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006406938.1|  hypothetical protein EUTSA_v10021374mg             138   3e-37   Eutrema salsugineum [saltwater cress]
ref|XP_009763808.1|  PREDICTED: acyl-protein thioesterase 2-like ...    139   4e-37   Nicotiana sylvestris
ref|XP_009603470.1|  PREDICTED: acyl-protein thioesterase 2-like ...    139   4e-37   
ref|XP_006644361.1|  PREDICTED: acyl-protein thioesterase 1 homol...    138   5e-37   Oryza brachyantha
ref|XP_010500881.1|  PREDICTED: acyl-protein thioesterase 2-like ...    138   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010500882.1|  PREDICTED: acyl-protein thioesterase 2-like ...    138   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010462118.1|  PREDICTED: acyl-protein thioesterase 2-like ...    137   7e-37   Camelina sativa [gold-of-pleasure]
gb|KFK35776.1|  hypothetical protein AALP_AA4G034500                    137   1e-36   Arabis alpina [alpine rockcress]
ref|XP_010479785.1|  PREDICTED: acyl-protein thioesterase 2-like ...    137   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002455943.1|  hypothetical protein SORBIDRAFT_03g027720          136   1e-36   
ref|XP_010670669.1|  PREDICTED: acyl-protein thioesterase 1 homol...    136   1e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009126416.1|  PREDICTED: acyl-protein thioesterase 2-like ...    136   2e-36   
gb|ACG37850.1|  hypothetical protein                                    136   2e-36   Zea mays [maize]
ref|XP_008675489.1|  PREDICTED: acyl-protein thioesterase 1 homol...    136   2e-36   Zea mays [maize]
ref|XP_010487396.1|  PREDICTED: acyl-protein thioesterase 2-like        136   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006654857.1|  PREDICTED: acyl-protein thioesterase 2-like        136   2e-36   Oryza brachyantha
ref|XP_009403127.1|  PREDICTED: acyl-protein thioesterase 2-like        136   2e-36   
ref|XP_010670667.1|  PREDICTED: acyl-protein thioesterase 1 homol...    136   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009146212.1|  PREDICTED: acyl-protein thioesterase 2-like ...    136   2e-36   Brassica rapa
emb|CDY62011.1|  BnaCnng38960D                                          137   2e-36   Brassica napus [oilseed rape]
ref|XP_006298382.1|  hypothetical protein CARUB_v10014451mg             136   3e-36   Capsella rubella
gb|EEC71077.1|  hypothetical protein OsI_02836                          136   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_010670666.1|  PREDICTED: acyl-protein thioesterase 1 homol...    136   3e-36   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX97691.1|  BnaA05g23880D                                          136   3e-36   
ref|XP_009135452.1|  PREDICTED: acyl-protein thioesterase 2-like        135   5e-36   Brassica rapa
gb|AAT44165.1|  hypothetical protein, contains phospholipase/carb...    134   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003597840.1|  Acyl-protein thioesterase                          135   7e-36   
ref|XP_004486695.1|  PREDICTED: acyl-protein thioesterase 2-like ...    135   7e-36   
gb|ABD83287.1|  Fgenesh protein 43                                      135   7e-36   Beta vulgaris [beet]
emb|CDY30093.1|  BnaC05g37690D                                          135   7e-36   Brassica napus [oilseed rape]
ref|XP_009115338.1|  PREDICTED: acyl-protein thioesterase 2-like ...    135   8e-36   Brassica rapa
ref|XP_010465539.1|  PREDICTED: acyl-protein thioesterase 2-like ...    135   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002882956.1|  phospholipase/carboxylesterase family protein      135   9e-36   Arabidopsis lyrata subsp. lyrata
ref|NP_188186.1|  alpha/beta-Hydrolases superfamily protein             135   9e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KHN22471.1|  Acyl-protein thioesterase 2                             135   1e-35   Glycine soja [wild soybean]
ref|XP_010503311.1|  PREDICTED: acyl-protein thioesterase 2-like        136   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_003546153.2|  PREDICTED: acyl-protein thioesterase 2-like ...    135   1e-35   Glycine max [soybeans]
gb|AFW81296.1|  hypothetical protein ZEAMMB73_017576                    134   2e-35   
ref|XP_003543671.1|  PREDICTED: acyl-protein thioesterase 2-like ...    134   2e-35   Glycine max [soybeans]
emb|CDY58459.1|  BnaA03g57470D                                          134   2e-35   Brassica napus [oilseed rape]
emb|CDX75839.1|  BnaC03g39220D                                          134   2e-35   
ref|XP_004252320.1|  PREDICTED: acyl-protein thioesterase 2-like        134   2e-35   Solanum lycopersicum
emb|CDY20140.1|  BnaA01g28620D                                          134   2e-35   Brassica napus [oilseed rape]
emb|CDY21856.1|  BnaC01g35920D                                          134   2e-35   Brassica napus [oilseed rape]
ref|XP_008656096.1|  PREDICTED: acyl-protein thioesterase 1 homol...    133   3e-35   Zea mays [maize]
gb|EMT13208.1|  Acyl-protein thioesterase 2                             133   4e-35   
ref|XP_004961046.1|  PREDICTED: acyl-protein thioesterase 1 homol...    133   4e-35   Setaria italica
ref|XP_002441605.1|  hypothetical protein SORBIDRAFT_09g030200          132   8e-35   Sorghum bicolor [broomcorn]
gb|KFK38914.1|  hypothetical protein AALP_AA3G177100                    132   1e-34   Arabis alpina [alpine rockcress]
gb|EMS45988.1|  Acyl-protein thioesterase 1                             130   1e-34   Triticum urartu
ref|XP_007150709.1|  hypothetical protein PHAVU_005G174700g             132   1e-34   Phaseolus vulgaris [French bean]
ref|XP_003567798.1|  PREDICTED: acyl-protein thioesterase 1 homol...    131   2e-34   
ref|XP_007150708.1|  hypothetical protein PHAVU_005G174700g             132   2e-34   Phaseolus vulgaris [French bean]
gb|EMT20363.1|  Acyl-protein thioesterase 1                             130   3e-34   
dbj|BAK05678.1|  predicted protein                                      130   4e-34   
ref|XP_009115335.1|  PREDICTED: acyl-protein thioesterase 2-like ...    131   5e-34   
ref|XP_010465540.1|  PREDICTED: acyl-protein thioesterase 2-like ...    129   8e-34   
gb|KEH28718.1|  acyl thioesterase-like protein                          130   8e-34   
ref|XP_009146211.1|  PREDICTED: acyl-protein thioesterase 1 homol...    130   9e-34   
ref|XP_010088259.1|  Acyl-protein thioesterase 2                        128   3e-33   
ref|XP_010545781.1|  PREDICTED: acyl-protein thioesterase 2-like        129   5e-33   
emb|CDM83407.1|  unnamed protein product                                130   8e-33   
ref|XP_002894399.1|  phospholipase/carboxylesterase family protein      126   2e-32   
ref|XP_010110350.1|  Acyl-protein thioesterase 2                        117   8e-29   
ref|XP_002966628.1|  hypothetical protein SELMODRAFT_85852              107   3e-25   
ref|XP_002978114.1|  hypothetical protein SELMODRAFT_152462             107   3e-25   
ref|XP_009150819.1|  PREDICTED: acyl-protein thioesterase 2-like        103   8e-25   
ref|XP_006303755.1|  hypothetical protein CARUB_v10011927mg           99.8    1e-22   
ref|XP_010481150.1|  PREDICTED: acyl-protein thioesterase 2-like      95.1    5e-22   
gb|ACN28968.1|  unknown                                               96.3    7e-22   
emb|CDY08787.1|  BnaA06g24370D                                        97.4    1e-21   
ref|XP_004515602.1|  PREDICTED: uncharacterized protein LOC101492417  97.8    1e-20   
ref|XP_002891386.1|  hypothetical protein ARALYDRAFT_473918           93.6    1e-20   
ref|XP_010508771.1|  PREDICTED: acyl-protein thioesterase 2-like      94.0    2e-20   
ref|XP_002894396.1|  hypothetical protein ARALYDRAFT_892283           92.0    8e-20   
ref|NP_175212.1|  estrase/lipase domain-containing protein            90.9    1e-19   
emb|CDY14573.1|  BnaC03g48860D                                        91.7    2e-19   
ref|XP_004172181.1|  PREDICTED: acyl-protein thioesterase 2-like      90.1    4e-19   
ref|XP_009043851.1|  hypothetical protein LOTGIDRAFT_152136           90.1    5e-19   
ref|XP_009148187.1|  PREDICTED: acyl-protein thioesterase 2           88.6    6e-19   
gb|AAD55623.1|AC008016_33  Similar to F6D8.5                          87.4    3e-18   
ref|XP_006303571.1|  hypothetical protein CARUB_v10011069mg           88.2    3e-18   
ref|NP_849799.1|  alpha/beta-Hydrolases superfamily protein           87.8    3e-18   
ref|XP_006392891.1|  hypothetical protein EUTSA_v10012094mg           85.9    6e-18   
gb|AAD55622.1|AC008016_32  Similar to F6D8.5                          86.7    7e-18   
ref|NP_001156119.1|  acyl-protein thioesterase 1,2-like               86.3    1e-17   
ref|XP_006392884.1|  hypothetical protein EUTSA_v10011963mg           84.3    1e-17   
gb|KJB56649.1|  hypothetical protein B456_009G129700                  85.9    2e-17   
ref|XP_006392889.1|  hypothetical protein EUTSA_v10012118mg           85.5    2e-17   
ref|XP_006392887.1|  hypothetical protein EUTSA_v10011946mg           85.5    2e-17   
ref|XP_006392880.1|  hypothetical protein EUTSA_v10012252mg           85.5    2e-17   
ref|XP_010925194.1|  PREDICTED: acyl-protein thioesterase 2-like      85.9    2e-17   
ref|XP_002405266.1|  lysophospholipase, putative                      85.5    2e-17   
ref|XP_002894395.1|  phospholipase/carboxylesterase family protein    85.1    3e-17   
ref|XP_006597132.1|  PREDICTED: acyl-protein thioesterase 2-like ...  84.3    5e-17   
ref|XP_006392885.1|  hypothetical protein EUTSA_v10012079mg           82.8    7e-17   
gb|AAD55624.1|AC008016_34  Similar to F6D8.5                          82.8    8e-17   
gb|AAD30641.1|AC006085_14  Hypothetical protein                       83.2    1e-16   
ref|XP_009823350.1|  hypothetical protein H257_01712                  83.6    1e-16   
ref|XP_010446735.1|  PREDICTED: acyl-protein thioesterase 2-like      82.8    2e-16   
ref|XP_006392882.1|  hypothetical protein EUTSA_v10012083mg           80.9    9e-16   
ref|NP_001155486.1|  acyl-protein thioesterase 1,2-like               80.9    9e-16   
gb|EPB91345.1|  hypothetical protein HMPREF1544_01862                 80.5    1e-15   
ref|XP_005831414.1|  hypothetical protein GUITHDRAFT_87404            80.1    2e-15   
dbj|GAN00840.1|  phospholipase/carboxylesterase                       79.3    3e-15   
gb|EWM21802.1|  lysophospholipase ii                                  78.6    6e-15   
ref|XP_006306077.1|  hypothetical protein CARUB_v10011403mg           79.0    6e-15   
ref|XP_002894398.1|  predicted protein                                78.6    7e-15   
ref|XP_008612212.1|  hypothetical protein SDRG_08122                  78.6    7e-15   
gb|KFD58030.1|  hypothetical protein M513_01263                       78.6    7e-15   
ref|XP_005853662.1|  lysophospholipase II                             78.6    8e-15   
ref|XP_004205755.1|  PREDICTED: acyl-protein thioesterase 1-like      78.2    8e-15   
ref|XP_002894397.1|  hypothetical protein ARALYDRAFT_892284           77.8    8e-15   
ref|XP_011270508.1|  hypothetical protein CAOG_08854                  78.2    1e-14   
gb|KDQ08866.1|  hypothetical protein BOTBODRAFT_37563                 77.4    2e-14   
ref|XP_006353590.1|  PREDICTED: acyl-protein thioesterase 2-like ...  77.4    2e-14   
gb|KDO25473.1|  hypothetical protein SPRG_09416                       77.0    2e-14   
gb|EIE75916.1|  hypothetical protein RO3G_00620                       77.0    3e-14   
gb|KDQ13022.1|  hypothetical protein BOTBODRAFT_33906                 77.0    3e-14   
ref|XP_002423226.1|  Acyl-protein thioesterase, putative              76.6    3e-14   
ref|XP_008866251.1|  hypothetical protein, variant                    76.6    3e-14   
emb|CEG79388.1|  hypothetical protein RMATCC62417_13865               74.3    3e-14   
gb|ERG82281.1|  acyl-protein thioesterase 1                           76.6    4e-14   
ref|XP_004173506.1|  PREDICTED: acyl-protein thioesterase 2-like      72.4    6e-14   
emb|CEP10030.1|  hypothetical protein                                 75.9    6e-14   
gb|KFM75729.1|  hypothetical protein X975_09949                       75.9    6e-14   
ref|XP_969230.1|  PREDICTED: acyl-protein thioesterase 1              75.5    7e-14   
gb|EFA11376.1|  hypothetical protein TcasGA2_TC011535                 75.5    7e-14   
dbj|GAN09052.1|  acyl-protein thioesterase-1                          75.5    7e-14   
gb|KIO29492.1|  hypothetical protein M407DRAFT_21391                  75.5    9e-14   
emb|CDH60464.1|  phospholipase carboxylesterase                       75.5    9e-14   
emb|CEJ05504.1|  hypothetical protein RMCBS344292_19444               75.1    1e-13   
emb|CEG66943.1|  hypothetical protein RMATCC62417_03434               75.1    1e-13   
emb|CEP18719.1|  hypothetical protein                                 75.1    1e-13   
emb|CEJ01654.1|  hypothetical protein RMCBS344292_15677               75.1    1e-13   
gb|ERG80743.1|  acyl-protein thioesterase 1                           75.5    1e-13   
ref|XP_002502600.1|  predicted protein                                74.7    2e-13   
ref|NP_492213.1|  Protein ATH-1                                       74.3    2e-13   
gb|AAU01162.1|  acyl protein thioesterase 1                           74.3    2e-13   
ref|XP_001599074.2|  PREDICTED: acyl-protein thioesterase 2 isofo...  74.3    2e-13   
gb|ABI52780.1|  lysophospholipase                                     73.9    2e-13   
emb|CDS02749.1|  hypothetical protein LRAMOSA00153                    74.3    2e-13   
ref|XP_008203334.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  73.9    2e-13   
ref|XP_003059223.1|  predicted protein                                73.9    2e-13   
gb|KDR11136.1|  Acyl-protein thioesterase 1                           73.9    2e-13   
emb|CDR32758.1|  ATH-1, isoform b                                     74.7    3e-13   
ref|XP_011201215.1|  PREDICTED: acyl-protein thioesterase 1           73.9    3e-13   
ref|WP_006008301.1|  acyl-protein thioesterase 1                      73.9    3e-13   
ref|XP_002732463.1|  PREDICTED: acyl-protein thioesterase 1-like      73.6    3e-13   
ref|XP_011188355.1|  PREDICTED: acyl-protein thioesterase 1           73.9    3e-13   
ref|WP_014107242.1|  carboxylesterase                                 73.6    4e-13   
gb|KDE04249.1|  hypothetical protein MVLG_05277                       76.3    4e-13   
ref|XP_001703374.1|  predicted protein                                73.2    4e-13   
ref|XP_320405.4|  AGAP012126-PA                                       72.8    7e-13   
ref|XP_008555364.1|  PREDICTED: acyl-protein thioesterase 1           72.8    7e-13   
dbj|GAM17762.1|  hypothetical protein SAMD00019534_009370             73.2    7e-13   
gb|EGT54137.1|  hypothetical protein CAEBREN_19431                    72.4    8e-13   
ref|WP_005368889.1|  MULTISPECIES: carboxylesterase                   72.4    9e-13   
ref|XP_011259114.1|  PREDICTED: acyl-protein thioesterase 2           72.4    9e-13   
ref|XP_011062908.1|  PREDICTED: acyl-protein thioesterase 2           72.4    1e-12   
ref|WP_024299269.1|  carboxylesterase                                 72.4    1e-12   
gb|EGT49334.1|  hypothetical protein CAEBREN_17167                    72.4    1e-12   
ref|XP_006680769.1|  hypothetical protein BATDEDRAFT_33521            72.0    1e-12   
ref|XP_010479598.1|  PREDICTED: acyl-protein thioesterase 2           72.4    1e-12   
ref|XP_003139006.1|  phospholipase/Carboxylesterase                   72.8    1e-12   
gb|EJW87681.1|  phospholipase/Carboxylesterase                        72.0    1e-12   
ref|XP_009010164.1|  hypothetical protein HELRODRAFT_154397           72.0    1e-12   
gb|EFO25064.2|  phospholipase/Carboxylesterase                        72.0    1e-12   
ref|XP_003488354.1|  PREDICTED: acyl-protein thioesterase 1-like      71.6    1e-12   
ref|XP_003398487.1|  PREDICTED: acyl-protein thioesterase 1-like      71.6    1e-12   
ref|XP_001418794.1|  predicted protein                                71.6    2e-12   
ref|XP_011163537.1|  PREDICTED: acyl-protein thioesterase 1           71.6    2e-12   
emb|CCD82387.1|  putative acyl-protein thioesterase 1,2 (lysophos...  71.6    2e-12   
gb|AAC62254.1|  lysophospholipase homolog                             71.6    2e-12   
gb|EDL29959.1|  lysophospholipase 2, isoform CRA_b                    70.1    2e-12   
emb|CCD82389.1|  putative acyl-protein thioesterase 1,2 (lysophos...  71.6    2e-12   
ref|XP_003745788.1|  PREDICTED: acyl-protein thioesterase 1-like      71.6    2e-12   
ref|XP_001660206.1|  AAEL009539-PA                                    71.2    2e-12   
ref|XP_011341143.1|  PREDICTED: acyl-protein thioesterase 2           71.2    2e-12   
ref|XP_003699191.1|  PREDICTED: acyl-protein thioesterase 1-like      71.2    2e-12   
gb|EDL80790.1|  lysophospholipase 2, isoform CRA_b                    70.1    2e-12   
ref|XP_003884115.1|  hypothetical protein NCLIV_045170                71.6    2e-12   
gb|EFX86257.1|  hypothetical protein DAPPUDRAFT_230516                71.2    2e-12   
ref|XP_001896040.1|  Phospholipase/Carboxylesterase family protein    71.6    3e-12   
ref|XP_001849526.1|  acyl-protein thioesterase 1,2                    71.2    3e-12   
ref|XP_011498931.1|  PREDICTED: acyl-protein thioesterase 1           71.6    3e-12   
ref|XP_011145876.1|  PREDICTED: acyl-protein thioesterase 1           70.9    3e-12   
tpg|DAA32154.1|  TPA: lysophospholipase II                            70.1    3e-12   
gb|ELT93210.1|  hypothetical protein CAPTEDRAFT_20690                 70.9    3e-12   
ref|XP_006159429.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.5    3e-12   
ref|XP_011303394.1|  PREDICTED: acyl-protein thioesterase 2           70.5    4e-12   
emb|CBJ31154.1|  similar to lysophospholipase II                      70.5    4e-12   
emb|CAX70647.1|  lysophospholipase II                                 70.5    5e-12   
ref|XP_004522198.1|  PREDICTED: acyl-protein thioesterase 2-like ...  70.5    5e-12   
ref|XP_009492434.1|  hypothetical protein H696_00312                  71.6    5e-12   
gb|EPB89706.1|  hypothetical protein HMPREF1544_03506                 70.5    5e-12   
ref|NP_009191.1|  acyl-protein thioesterase 2                         70.5    5e-12   
ref|XP_005535813.1|  similar to lysophospholipase II                  70.9    5e-12   
ref|XP_006078013.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    5e-12   
ref|XP_006159428.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    5e-12   
ref|XP_002027864.1|  GL16272                                          70.1    5e-12   
ref|XP_004394818.1|  PREDICTED: acyl-protein thioesterase 2           70.1    5e-12   
ref|XP_008571243.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    5e-12   
ref|XP_006179213.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    5e-12   
ref|XP_003356251.2|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.9    5e-12   
ref|XP_008060338.1|  PREDICTED: acyl-protein thioesterase 2           70.1    5e-12   
ref|XP_004285703.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    5e-12   
ref|XP_007175171.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.5    5e-12   
ref|XP_005079675.1|  PREDICTED: acyl-protein thioesterase 2           70.1    6e-12   
ref|XP_006980889.1|  PREDICTED: acyl-protein thioesterase 2           70.1    6e-12   
ref|XP_003471377.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    6e-12   
ref|XP_010955665.1|  PREDICTED: acyl-protein thioesterase 2           70.5    6e-12   
ref|XP_004637661.1|  PREDICTED: acyl-protein thioesterase 2           70.1    6e-12   
ref|XP_004592317.1|  PREDICTED: acyl-protein thioesterase 2           70.1    6e-12   
ref|XP_004285702.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    6e-12   
ref|XP_005394838.1|  PREDICTED: acyl-protein thioesterase 2           70.1    6e-12   
ref|XP_005317651.1|  PREDICTED: acyl-protein thioesterase 2           70.1    6e-12   
ref|XP_005845399.1|  hypothetical protein CHLNCDRAFT_136959           70.5    6e-12   
ref|XP_007617217.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    6e-12   
gb|ELR49448.1|  Acyl-protein thioesterase 2                           70.1    6e-12   
ref|XP_008146320.1|  PREDICTED: acyl-protein thioesterase 2           70.1    6e-12   
ref|NP_001073831.1|  acyl-protein thioesterase 2                      70.1    6e-12   
ref|XP_006777623.1|  PREDICTED: acyl-protein thioesterase 2           70.1    6e-12   
ref|XP_005353085.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    6e-12   
ref|XP_005875277.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    6e-12   
ref|NP_036072.1|  acyl-protein thioesterase 2                         70.1    6e-12   
ref|XP_011226736.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    6e-12   
ref|NP_112632.1|  acyl-protein thioesterase 2                         70.1    6e-12   
ref|XP_001984733.1|  GH14861                                          70.1    6e-12   
ref|XP_010988120.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-protein...  70.1    6e-12   
ref|XP_004465475.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.5    6e-12   
ref|XP_005245785.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    6e-12   
emb|CDJ96886.1|  Phospholipase carboxylesterase domain containing...  70.1    7e-12   
gb|EHH14445.1|  hypothetical protein EGK_00372                        70.1    7e-12   
ref|WP_042152814.1|  carboxylesterase                                 69.7    7e-12   
ref|XP_006078014.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    7e-12   
ref|XP_005544515.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    7e-12   
ref|XP_001501400.3|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.5    7e-12   
ref|XP_008961366.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    7e-12   
emb|CDY28985.1|  BnaC07g31910D                                        68.2    7e-12   
gb|EHH49645.1|  hypothetical protein EGM_00343                        69.7    7e-12   
ref|NP_001040255.1|  lysophospholipase                                69.7    8e-12   
ref|XP_001972413.1|  GG15517                                          69.7    8e-12   
ref|XP_004332243.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  69.7    8e-12   
ref|XP_002048597.1|  GJ14054                                          69.7    8e-12   
gb|AAD52700.1|AF091539_1  lysophospholipase                           69.7    8e-12   
gb|EAW95078.1|  lysophospholipase II, isoform CRA_b                   69.7    8e-12   
emb|CDH52434.1|  acyl-protein thioesterase 1                          69.7    9e-12   
ref|XP_005107836.1|  PREDICTED: acyl-protein thioesterase 1-like ...  69.7    1e-11   
ref|XP_003697331.1|  PREDICTED: acyl-protein thioesterase 2-like ...  68.9    1e-11   
ref|XP_011295063.1|  PREDICTED: acyl-protein thioesterase 1-like ...  69.3    1e-11   
ref|XP_005189744.1|  PREDICTED: acyl-protein thioesterase 1-like ...  69.3    1e-11   
emb|CDS08263.1|  hypothetical protein LRAMOSA02211                    69.7    1e-11   
gb|AAP97210.1|AF090423_1  lysophospholipase LPL-I                     69.3    1e-11   
ref|XP_002114305.1|  hypothetical protein TRIADDRAFT_63333            69.3    1e-11   
ref|XP_005192208.1|  PREDICTED: acyl-protein thioesterase 1-like      69.3    1e-11   
ref|NP_175541.1|  alpha/beta-Hydrolases superfamily protein           69.3    1e-11   
ref|XP_011226725.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  69.7    1e-11   
ref|XP_005832975.1|  hypothetical protein GUITHDRAFT_57831            68.9    1e-11   
gb|ETN65714.1|  acyl-protein thioesterase 1,2                         68.9    1e-11   
ref|XP_004465474.1|  PREDICTED: acyl-protein thioesterase 2 isofo...  70.1    1e-11   
ref|XP_007522662.1|  PREDICTED: acyl-protein thioesterase 2           68.9    2e-11   
ref|XP_004705168.1|  PREDICTED: acyl-protein thioesterase 2           68.9    2e-11   
gb|EKD04279.1|  acyl-protein thioesterase-1                           71.2    2e-11   
ref|XP_004657577.1|  PREDICTED: acyl-protein thioesterase 2           68.9    2e-11   
ref|XP_005107838.1|  PREDICTED: acyl-protein thioesterase 1-like ...  68.9    2e-11   
emb|CEJ92538.1|  hypothetical protein VHEMI08186                      69.3    2e-11   
ref|XP_008329244.1|  PREDICTED: acyl-protein thioesterase 2           68.9    2e-11   
ref|XP_004678663.1|  PREDICTED: acyl-protein thioesterase 2           68.6    2e-11   
ref|WP_007637913.1|  carboxylesterase 1                               68.6    2e-11   
ref|XP_392725.1|  PREDICTED: acyl-protein thioesterase 1-like         68.6    2e-11   
ref|XP_003697332.1|  PREDICTED: acyl-protein thioesterase 2-like ...  68.6    2e-11   
ref|XP_005107837.1|  PREDICTED: acyl-protein thioesterase 1-like ...  68.9    2e-11   
ref|XP_006621296.1|  PREDICTED: acyl-protein thioesterase 1-like      68.6    2e-11   



>ref|XP_004251587.1| PREDICTED: acyl-protein thioesterase 2 [Solanum lycopersicum]
Length=256

 Score =   187 bits (474),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG+SV S   TA R+F FG+TYVVKPKGKHQATIVWLHGLGDNGSSWS+LLETLPLP
Sbjct  1    MSFTGASVGSVAGTARRAFEFGQTYVVKPKGKHQATIVWLHGLGDNGSSWSNLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAPQRPITLFGGFPSTAWFDVN+LSENAIDD
Sbjct  61   NIKWICPTAPQRPITLFGGFPSTAWFDVNDLSENAIDD  98



>ref|XP_006366864.1| PREDICTED: acyl-protein thioesterase 2-like [Solanum tuberosum]
Length=256

 Score =   186 bits (473),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG+S+ S   TA R+F FG+TYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP
Sbjct  1    MSFTGASMGSVAGTARRAFEFGQTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAPQRPITLFGGFPS+AWFDVN+LSENAIDD+
Sbjct  61   NIKWICPTAPQRPITLFGGFPSSAWFDVNDLSENAIDDI  99



>ref|XP_009797714.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Nicotiana 
sylvestris]
Length=256

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG S+AS    A R+F FG+TYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP
Sbjct  1    MSFTGPSMASGAGIARRAFEFGQTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAPQRPITLFGGFPSTAWFDVN+LSENAIDD
Sbjct  61   NIKWICPTAPQRPITLFGGFPSTAWFDVNDLSENAIDD  98



>ref|XP_009630835.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Nicotiana 
tomentosiformis]
Length=272

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  102  SNSLLSVLFEG-MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGS  278
            +   L  LFE  MSFTG S+AS    A R+F FG+TYVVKPKGKHQATIVWLHGLGDNGS
Sbjct  5    ATQYLVPLFEASMSFTGPSMASGAGIARRAFEFGQTYVVKPKGKHQATIVWLHGLGDNGS  64

Query  279  SWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            SWS+LLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVN+LSENAIDD
Sbjct  65   SWSNLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNDLSENAIDD  114



>ref|XP_009630836.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=266

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = +3

Query  123  LFEG-MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLE  299
            LFE  MSFTG S+AS    A R+F FG+TYVVKPKGKHQATIVWLHGLGDNGSSWS+LLE
Sbjct  6    LFEASMSFTGPSMASGAGIARRAFEFGQTYVVKPKGKHQATIVWLHGLGDNGSSWSNLLE  65

Query  300  TLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            TLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVN+LSENAIDD
Sbjct  66   TLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNDLSENAIDD  108



>gb|EYU18265.1| hypothetical protein MIMGU_mgv1a012268mg [Erythranthe guttata]
Length=256

 Score =   184 bits (467),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  MSFTGSSVA-SAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPL  311
            MSFTG SVA SAGRTA R+F+FGRTYVV+PKGKHQATIVWLHGLGDNG+SWS+LLETLPL
Sbjct  1    MSFTGPSVAASAGRTARRAFDFGRTYVVRPKGKHQATIVWLHGLGDNGNSWSTLLETLPL  60

Query  312  PNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            PNIKWICPTAPQ+PITLFGGFPSTAWFDV++LSENA DD+
Sbjct  61   PNIKWICPTAPQQPITLFGGFPSTAWFDVSDLSENASDDL  100



>ref|XP_009630837.1| PREDICTED: acyl-protein thioesterase 2 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009630838.1| PREDICTED: acyl-protein thioesterase 2 isoform X3 [Nicotiana 
tomentosiformis]
Length=256

 Score =   184 bits (467),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG S+AS    A R+F FG+TYVVKPKGKHQATIVWLHGLGDNGSSWS+LLETLPLP
Sbjct  1    MSFTGPSMASGAGIARRAFEFGQTYVVKPKGKHQATIVWLHGLGDNGSSWSNLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAPQRPITLFGGFPSTAWFDVN+LSENAIDD
Sbjct  61   NIKWICPTAPQRPITLFGGFPSTAWFDVNDLSENAIDD  98



>emb|CDP10367.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG S  ++GRT  R+FNFGRTYVV+PKGKHQATIVWLHGLGDNGSSWS+LLE+LPLP
Sbjct  1    MSFTGPSAGASGRTVTRAFNFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSTLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICP+APQ+PITLFGGFPSTAWFDVN+LSEN  DDV
Sbjct  61   NIKWICPSAPQQPITLFGGFPSTAWFDVNDLSENTKDDV  99



>ref|XP_007202360.1| hypothetical protein PRUPE_ppa009197mg [Prunus persica]
 gb|EMJ03559.1| hypothetical protein PRUPE_ppa009197mg [Prunus persica]
Length=302

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = +3

Query  30   LRTGES-EALRKLHVIEISGEIYNCSNSLL-SVLFEG--MSFTGSSVASAGRTAGRSFNF  197
            L  GE  E  ++   IE    +  CS SL+ ++LF G  MSFT SSV S GRT  R F F
Sbjct  7    LEEGERVEERQRPQKIEDLCSVDCCSRSLVCAILFGGPNMSFTSSSVGSGGRTVRRVFEF  66

Query  198  GRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGGFP  377
            GRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLPNIKWICPTAP +PI +FGGFP
Sbjct  67   GRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTQPIKVFGGFP  126

Query  378  STAWFDVNELSENAIDDV  431
            STAWFDV ELSE+A DD+
Sbjct  127  STAWFDVGELSEDAPDDI  144



>ref|XP_008337331.1| PREDICTED: acyl-protein thioesterase 1 isoform X2 [Malus domestica]
Length=256

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG SV S GRTA R+F FGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSFTGPSVGSGGRTARRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI++FGGFPSTAWFDV ELSE+A DDV
Sbjct  61   NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDDV  99



>ref|XP_008337330.1| PREDICTED: acyl-protein thioesterase 1 isoform X1 [Malus domestica]
Length=263

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG SV S GRTA R+F FGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSFTGPSVGSGGRTARRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI++FGGFPSTAWFDV ELSE+A DDV
Sbjct  61   NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDDV  99



>ref|XP_002524444.1| Acyl-protein thioesterase, putative [Ricinus communis]
 gb|EEF37884.1| Acyl-protein thioesterase, putative [Ricinus communis]
Length=258

 Score =   177 bits (448),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG SV + G+TA R+F FGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSVGAGGKTARRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PIT+FGGFPSTAWFDV +LSE+A DD+
Sbjct  61   NIKWICPTAPTQPITVFGGFPSTAWFDVGDLSEDAPDDL  99



>ref|XP_008242725.1| PREDICTED: acyl-protein thioesterase 2 [Prunus mume]
Length=257

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFT SSV S GRT  R F FGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTSSSVGSGGRTVRRVFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI +FGGFPSTAWFDV ELSE+A DD+
Sbjct  61   NIKWICPTAPTQPIKVFGGFPSTAWFDVGELSEDAPDDI  99



>gb|KCW79781.1| hypothetical protein EUGRSUZ_C01119 [Eucalyptus grandis]
Length=237

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS TG+S+ S G+TA ++ NFGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSLTGTSMGSGGQTARKAVNFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPT+P RP+++FGGFPSTAWFDV +LSENA DD+
Sbjct  61   NIKWICPTSPTRPVSIFGGFPSTAWFDVGDLSENAADDL  99



>gb|KJB83077.1| hypothetical protein B456_013G233000 [Gossypium raimondii]
Length=199

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG SV   GRTA R+  FGRTYVV+PKG+HQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSVGPGGRTARRALEFGRTYVVRPKGRHQATIVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI++FGGFPSTAWF+V ELSE+A DD+
Sbjct  61   NIKWICPTAPTQPISIFGGFPSTAWFNVGELSEDAPDDI  99



>ref|XP_010047797.1| PREDICTED: acyl-protein thioesterase 2 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010047798.1| PREDICTED: acyl-protein thioesterase 2 isoform X3 [Eucalyptus 
grandis]
 gb|KCW79780.1| hypothetical protein EUGRSUZ_C01119 [Eucalyptus grandis]
Length=257

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS TG+S+ S G+TA ++ NFGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSLTGTSMGSGGQTARKAVNFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPT+P RP+++FGGFPSTAWFDV +LSENA DD+
Sbjct  61   NIKWICPTSPTRPVSIFGGFPSTAWFDVGDLSENAADDL  99



>ref|XP_010047795.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW79778.1| hypothetical protein EUGRSUZ_C01119 [Eucalyptus grandis]
Length=285

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  VLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLE  299
            +L   MS TG+S+ S G+TA ++ NFGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLE
Sbjct  24   ILRSQMSLTGTSMGSGGQTARKAVNFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLE  83

Query  300  TLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            TLPLPNIKWICPT+P RP+++FGGFPSTAWFDV +LSENA DD+
Sbjct  84   TLPLPNIKWICPTSPTRPVSIFGGFPSTAWFDVGDLSENAADDL  127



>ref|XP_004287363.1| PREDICTED: acyl-protein thioesterase 2 [Fragaria vesca subsp. 
vesca]
Length=257

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFT  SV S GRT  R+F FGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSFTSPSVGSGGRTVRRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI++FGGFPSTAWFDV ELSE+A DD+
Sbjct  61   NIKWICPTAPTQPISVFGGFPSTAWFDVGELSEDAPDDI  99



>ref|XP_008354381.1| PREDICTED: acyl-protein thioesterase 1-like [Malus domestica]
 ref|XP_008354382.1| PREDICTED: acyl-protein thioesterase 1-like [Malus domestica]
Length=256

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS TG SV S GRTA R+  FGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSSTGPSVGSGGRTARRAVEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI++FGGFPSTAWFDV ELSE+A DDV
Sbjct  61   NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDDV  99



>gb|KJB83076.1| hypothetical protein B456_013G233000 [Gossypium raimondii]
 gb|KJB83078.1| hypothetical protein B456_013G233000 [Gossypium raimondii]
 gb|KJB83079.1| hypothetical protein B456_013G233000 [Gossypium raimondii]
Length=257

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG SV   GRTA R+  FGRTYVV+PKG+HQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSVGPGGRTARRALEFGRTYVVRPKGRHQATIVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI++FGGFPSTAWF+V ELSE+A DD+
Sbjct  61   NIKWICPTAPTQPISIFGGFPSTAWFNVGELSEDAPDDI  99



>ref|XP_009797713.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Nicotiana 
sylvestris]
Length=260

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  177  AGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPI  356
            A R+F FG+TYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPI
Sbjct  19   ARRAFEFGQTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPI  78

Query  357  TLFGGFPSTAWFDVNELSENAIDD  428
            TLFGGFPSTAWFDVN+LSENAIDD
Sbjct  79   TLFGGFPSTAWFDVNDLSENAIDD  102



>gb|KJB54088.1| hypothetical protein B456_009G020100 [Gossypium raimondii]
Length=256

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTGSSV   G T  R+  FGRTYVV+PKG+HQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGSSVGPGGGTVRRALEFGRTYVVRPKGRHQATIVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PIT+FGGFPSTAWFDV ++SE+A DD+
Sbjct  61   NIKWICPTAPTQPITIFGGFPSTAWFDVGDISEDAADDI  99



>gb|KHG03780.1| Acyl-protein thioesterase 2 [Gossypium arboreum]
Length=213

 Score =   171 bits (433),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTGSSV   G T  R+  FGRTYVV+PKG+HQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGSSVGPGGGTVRRALEFGRTYVVRPKGRHQATIVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PIT+FGGFPSTAWFDV ++SE+A DD+
Sbjct  61   NIKWICPTAPTQPITVFGGFPSTAWFDVGDISEDAADDI  99



>ref|XP_007013351.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY30970.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=257

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG SV   GRT  R+  FGRTYVV+PKG+HQ TIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSVGPGGRTVRRALEFGRTYVVRPKGRHQVTIVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PIT+FGGFPSTAWFDV +LSE+A DD+
Sbjct  61   NIKWICPTAPTQPITVFGGFPSTAWFDVGDLSEDAPDDI  99



>gb|KDO80323.1| hypothetical protein CISIN_1g024379mg [Citrus sinensis]
Length=201

 Score =   170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG S++S G T  R+  FGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSMSSGGNTVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+T+FGGFPSTAWFDV +LSE+  DD+
Sbjct  61   NIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDL  99



>gb|KHG04929.1| Acyl-protein thioesterase 2 [Gossypium arboreum]
Length=127

 Score =   167 bits (423),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG S+ S GR    +  FGRT+VV+PKG+HQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSIGSGGRR--EALEFGRTHVVRPKGRHQATVVWLHGLGDNGSSWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RPITLFGGFP+TAWFDV ELSE+A DDV
Sbjct  59   NIKWICPTAPTRPITLFGGFPTTAWFDVGELSEDAPDDV  97



>ref|XP_010656400.1| PREDICTED: acyl-protein thioesterase 2 [Vitis vinifera]
 emb|CBI28159.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG SV S GRT  R+F FGRTYVV+PKGKHQAT+VWLHGLGDNGSSW  LLETLPLP
Sbjct  1    MSFTGPSV-SGGRTVKRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWFQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI++FGGFPSTAWFDV ELSE+A DD+
Sbjct  60   NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDDL  98



>ref|XP_006371944.1| hypothetical protein POPTR_0018s06570g, partial [Populus trichocarpa]
 gb|ERP49741.1| hypothetical protein POPTR_0018s06570g, partial [Populus trichocarpa]
Length=193

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF G S+AS G+T  R+  FGRTYVVKPKGKH AT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFAGPSLASGGKTVRRAIEFGRTYVVKPKGKHLATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP +P+T+FGGFPSTAWFDV +LSE+A DD
Sbjct  61   NIKWICPTAPTQPVTVFGGFPSTAWFDVGDLSEDAPDD  98



>ref|XP_006475789.1| PREDICTED: acyl-protein thioesterase 2-like [Citrus sinensis]
 gb|KDO80321.1| hypothetical protein CISIN_1g024379mg [Citrus sinensis]
Length=257

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG S++S G T  R+  FGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSMSSGGNTVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+T+FGGFPSTAWFDV +LSE+  DD+
Sbjct  61   NIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDL  99



>gb|KDO80322.1| hypothetical protein CISIN_1g024379mg [Citrus sinensis]
Length=268

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG S++S G T  R+  FGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSMSSGGNTVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+T+FGGFPSTAWFDV +LSE+  DD+
Sbjct  61   NIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDL  99



>ref|XP_011008876.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Populus 
euphratica]
Length=217

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF G S+AS G+T  R+  FGRTYVVKPKGKH AT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFAGPSLASGGKTVRRAIEFGRTYVVKPKGKHLATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +P+T+FGGFPSTAWFDV  LSE+A DD 
Sbjct  61   NIKWICPTAPTQPVTVFGGFPSTAWFDVGNLSEDAPDDT  99



>gb|KHN06121.1| Acyl-protein thioesterase 2 [Glycine soja]
Length=216

 Score =   168 bits (426),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  MSFTGSSVASAG-RTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPL  311
            MSF   S+ SAG R+A R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLETLPL
Sbjct  1    MSFAAPSLGSAGGRSARRAFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPL  60

Query  312  PNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            PNIKWICPTAP +PI++FGGFPSTAWFDV ++SE+A DD+
Sbjct  61   PNIKWICPTAPTQPISIFGGFPSTAWFDVGDISEDAPDDL  100



>gb|ABK95495.1| unknown [Populus trichocarpa]
Length=256

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF G S+AS G+T  R+  FGRTYVVKPKGKH AT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFAGPSLASGGKTVRRAIEFGRTYVVKPKGKHLATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP +P+T+FGGFPSTAWFDV +LSE+A DD
Sbjct  61   NIKWICPTAPTQPVTVFGGFPSTAWFDVGDLSEDAPDD  98



>gb|KJB64798.1| hypothetical protein B456_010G065500 [Gossypium raimondii]
Length=122

 Score =   164 bits (416),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG S+ S GR    +  FGRT+VV+PKG+HQAT+VWLH LGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSIGSGGRR--EAHEFGRTHVVRPKGRHQATVVWLHDLGDNGSSWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RPITLFGGFP+TAWFDV ELSE+A DDV
Sbjct  59   NIKWICPTAPTRPITLFGGFPATAWFDVGELSEDAPDDV  97



>ref|XP_010047799.1| PREDICTED: acyl-protein thioesterase 2 isoform X4 [Eucalyptus 
grandis]
Length=255

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 89/99 (90%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS TG+S+   G+TA ++ NFGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSLTGTSMG--GQTARKAVNFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPT+P RP+++FGGFPSTAWFDV +LSENA DD+
Sbjct  59   NIKWICPTSPTRPVSIFGGFPSTAWFDVGDLSENAADDL  97



>ref|XP_011008872.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011008873.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011008874.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011008875.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Populus 
euphratica]
Length=256

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF G S+AS G+T  R+  FGRTYVVKPKGKH AT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFAGPSLASGGKTVRRAIEFGRTYVVKPKGKHLATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP +P+T+FGGFPSTAWFDV  LSE+A DD
Sbjct  61   NIKWICPTAPTQPVTVFGGFPSTAWFDVGNLSEDAPDD  98



>ref|XP_010047796.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Eucalyptus 
grandis]
Length=283

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 2/104 (2%)
 Frame = +3

Query  120  VLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLE  299
            +L   MS TG+S+   G+TA ++ NFGRTYVV+PKGKHQAT+VWLHGLGDNGSSWS LLE
Sbjct  24   ILRSQMSLTGTSMG--GQTARKAVNFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLE  81

Query  300  TLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            TLPLPNIKWICPT+P RP+++FGGFPSTAWFDV +LSENA DD+
Sbjct  82   TLPLPNIKWICPTSPTRPVSIFGGFPSTAWFDVGDLSENAADDL  125



>ref|NP_001239784.1| uncharacterized protein LOC100796190 [Glycine max]
 ref|XP_006577820.1| PREDICTED: uncharacterized protein LOC100796190 isoform X1 [Glycine 
max]
 gb|ACU21317.1| unknown [Glycine max]
 gb|KHN34555.1| Acyl-protein thioesterase 2 [Glycine soja]
Length=258

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  MSFTGSSVASAG-RTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPL  311
            MSF   S+ SAG R+A R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLETLPL
Sbjct  1    MSFAAPSLGSAGGRSARRAFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPL  60

Query  312  PNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            PNIKWICPTAP +PI++FGGFPSTAWFDV ++SE+A DD+
Sbjct  61   PNIKWICPTAPTQPISIFGGFPSTAWFDVGDISEDAPDDL  100



>ref|XP_003527153.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Glycine 
max]
 ref|XP_006582078.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Glycine 
max]
Length=258

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  MSFTGSSVASAG-RTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPL  311
            MSF   S+ SAG R+A R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLETLPL
Sbjct  1    MSFAAPSLGSAGGRSARRAFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPL  60

Query  312  PNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            PNIKWICPTAP +PI++FGGFPSTAWFDV ++SE+A DD+
Sbjct  61   PNIKWICPTAPTQPISIFGGFPSTAWFDVGDISEDAPDDL  100



>ref|XP_010688073.1| PREDICTED: acyl-protein thioesterase 2 isoform X4 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688074.1| PREDICTED: acyl-protein thioesterase 2 isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=253

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF+G+S  S G  A ++F FGRTYVV+PKGKHQAT+VWLHGLGDNG SWS +LETL LP
Sbjct  1    MSFSGTSAGSGGNAARKAFEFGRTYVVRPKGKHQATVVWLHGLGDNGGSWSQILETLSLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RPI+LFGGFPSTAWFDV +LSE+A DD
Sbjct  61   NIKWICPTAPSRPISLFGGFPSTAWFDVQDLSEDAPDD  98



>gb|AFK37927.1| unknown [Medicago truncatula]
Length=255

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF  SSV   GR+A  ++ FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLET+PLP
Sbjct  1    MSFAASSVG--GRSAAAAYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLETIPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++LFGGFPSTAWFDV ELSE A DD+
Sbjct  59   NIKWICPTAPTRPMSLFGGFPSTAWFDVAELSEEAPDDL  97



>gb|KEH37959.1| acyl-protein thioesterase [Medicago truncatula]
Length=255

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF  SSV   GR+A  ++ FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLET+PLP
Sbjct  1    MSFAASSVG--GRSAATAYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLETIPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++LFGGFPSTAWFDV ELSE A DD+
Sbjct  59   NIKWICPTAPTRPMSLFGGFPSTAWFDVAELSEEAPDDL  97



>ref|XP_010249993.1| PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera]
 ref|XP_010249994.1| PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera]
 ref|XP_010249995.1| PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera]
 ref|XP_010249996.1| PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera]
Length=257

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFT  S  S  R A R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTSHSAGSGSRAARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAWFDV +LSE+  DDV
Sbjct  61   NIKWICPTAPTRPVAIFGGFPCTAWFDVGDLSEDGPDDV  99



>ref|XP_009389937.1| PREDICTED: acyl-protein thioesterase 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389938.1| PREDICTED: acyl-protein thioesterase 2-like [Musa acuminata subsp. 
malaccensis]
Length=257

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  SS+AS  +TA R+F+FGRT+VV+PKG+H AT+VWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGSSSIASGAKTAARAFDFGRTHVVRPKGRHLATVVWLHGLGDNGASWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFPSTAWFDV +LSE+  DDV
Sbjct  61   NIKWICPTAPTRPVAVFGGFPSTAWFDVGDLSEDGPDDV  99



>ref|XP_010688069.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=280

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF+G+S  S G  A ++F FGRTYVV+PKGKHQAT+VWLHGLGDNG SWS +LETL LP
Sbjct  28   MSFSGTSAGSGGNAARKAFEFGRTYVVRPKGKHQATVVWLHGLGDNGGSWSQILETLSLP  87

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RPI+LFGGFPSTAWFDV +LSE+A DD
Sbjct  88   NIKWICPTAPSRPISLFGGFPSTAWFDVQDLSEDAPDD  125



>gb|AFK34792.1| unknown [Lotus japonicus]
Length=189

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 88/99 (89%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFT  S+ASAG  A R+F +GRTYVV+PKGKHQATIVWLHGLGDNG+SWS LLETL LP
Sbjct  1    MSFTAPSLASAG--ARRAFEYGRTYVVRPKGKHQATIVWLHGLGDNGASWSQLLETLALP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFGGFPSTAWFDV +LSE+A DD+
Sbjct  59   NIKWICPTAPTQPISLFGGFPSTAWFDVGDLSEDAPDDL  97



>ref|XP_010535874.1| PREDICTED: acyl-protein thioesterase 2-like [Tarenaya hassleriana]
Length=252

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF GSSV S+ R AGR+  FG+T+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFPGSSVGSS-RVAGRTVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RPI+LFGGFPSTAWFDV +L+E+A DD 
Sbjct  60   NIKWICPTAPSRPISLFGGFPSTAWFDVVDLNEDAPDDT  98



>gb|KJB64799.1| hypothetical protein B456_010G065500 [Gossypium raimondii]
Length=146

 Score =   163 bits (413),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 84/99 (85%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG S+ S GR       FGRT+VV+PKG+HQAT+VWLH LGDNGSSWS LLETLPLP
Sbjct  1    MSFTGPSIGSGGRREAH--EFGRTHVVRPKGRHQATVVWLHDLGDNGSSWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RPITLFGGFP+TAWFDV ELSE+A DDV
Sbjct  59   NIKWICPTAPTRPITLFGGFPATAWFDVGELSEDAPDDV  97



>emb|CDO98115.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+T SS+ S  R A R+F+FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYTNSSMGSGSRGARRTFDFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWFDV ELSE+  DD
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDVGELSEDGPDD  98



>ref|XP_011072250.1| PREDICTED: acyl-protein thioesterase 1 homolog 1 [Sesamum indicum]
Length=252

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++ SS+ S  RT  R+F FGRTYVVKPKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYSNSSMGSGSRTGRRTFEFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWFDV ELSE+  DD
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDVGELSEDCPDD  98



>ref|XP_008792088.1| PREDICTED: acyl-protein thioesterase 2 [Phoenix dactylifera]
 ref|XP_008792089.1| PREDICTED: acyl-protein thioesterase 2 [Phoenix dactylifera]
Length=257

 Score =   166 bits (420),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  SS+AS  +TA R F +GRT+VV+PKG+HQATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGSSSLASGAKTATRHFEYGRTHVVRPKGRHQATIVWLHGLGDNGASWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAWFDV ELSE+  DDV
Sbjct  61   NIKWICPTAPTRPVAVFGGFPCTAWFDVGELSEDGPDDV  99



>ref|XP_010914919.1| PREDICTED: acyl-protein thioesterase 2 [Elaeis guineensis]
Length=257

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  SS+AS  +TA R F +GRT+VV+PKG+HQATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGSSSLASGAKTAARHFEYGRTHVVRPKGRHQATIVWLHGLGDNGASWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPT+P RP+ +FGGFP TAWFDV ELSE+  DDV
Sbjct  61   NIKWICPTSPTRPVAVFGGFPCTAWFDVGELSEDGPDDV  99



>ref|XP_010925247.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Elaeis guineensis]
Length=256

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  SS+AS  +TA R F +GRT+VV+PKG+HQATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGSSSLASGAKTAARPFEYGRTHVVRPKGRHQATIVWLHGLGDNGASWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAWFDV +LSE+  DDV
Sbjct  61   NIKWICPTAPTRPVAVFGGFPCTAWFDVGDLSEDGPDDV  99



>ref|XP_008785152.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Phoenix dactylifera]
 ref|XP_008785161.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Phoenix dactylifera]
 ref|XP_008785169.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Phoenix dactylifera]
 ref|XP_008785178.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Phoenix dactylifera]
 ref|XP_008785187.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Phoenix dactylifera]
Length=257

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  SS+AS  +TA R F +GRT+VV+PKG+HQATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGSSSLASGAKTAARPFEYGRTHVVRPKGRHQATIVWLHGLGDNGASWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAWFDV +LSE+  DDV
Sbjct  61   NIKWICPTAPTRPVAVFGGFPCTAWFDVGDLSEDGPDDV  99



>gb|KHG00787.1| Acyl-protein thioesterase 2 [Gossypium arboreum]
 gb|KHG22005.1| Acyl-protein thioesterase 2 [Gossypium arboreum]
Length=254

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++ +++ S  RTA R+F+FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYSHNTMGSGSRTATRTFDFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ L GGFP TAWFDV+ELSEN  DD
Sbjct  61   NIKWICPTAPTRPVALLGGFPYTAWFDVSELSENGPDD  98



>ref|XP_009399762.1| PREDICTED: acyl-protein thioesterase 2-like [Musa acuminata subsp. 
malaccensis]
Length=257

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  SS+AS  +TA R+F+FGRT+VV+PKG+H AT+VWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGSSSIASGAKTATRTFDFGRTHVVRPKGRHLATVVWLHGLGDNGASWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFPST+WFDV +LSE+  DDV
Sbjct  61   NIKWICPTAPTRPVAIFGGFPSTSWFDVTDLSEDGPDDV  99



>gb|KCW79779.1| hypothetical protein EUGRSUZ_C01119 [Eucalyptus grandis]
Length=269

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 90/111 (81%), Gaps = 12/111 (11%)
 Frame = +3

Query  135  MSFTGSSVAS------------AGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGS  278
            MS TG+S+ S             G+TA ++ NFGRTYVV+PKGKHQAT+VWLHGLGDNGS
Sbjct  1    MSLTGTSMGSGLLDLLFPFFPCCGQTARKAVNFGRTYVVRPKGKHQATVVWLHGLGDNGS  60

Query  279  SWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            SWS LLETLPLPNIKWICPT+P RP+++FGGFPSTAWFDV +LSENA DD+
Sbjct  61   SWSQLLETLPLPNIKWICPTSPTRPVSIFGGFPSTAWFDVGDLSENAADDL  111



>ref|XP_009345298.1| PREDICTED: acyl-protein thioesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009345299.1| PREDICTED: acyl-protein thioesterase 2-like [Pyrus x bretschneideri]
Length=258

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF  S+ AS  RT  R+F FGRT+VV+PKG+HQATIVWLHGLGD GSSWS LLE+LPLP
Sbjct  1    MSFNSSNAASGSRTGSRAFEFGRTHVVRPKGRHQATIVWLHGLGDKGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFD+ E+SE+A DD+
Sbjct  61   NIKWICPTAPSRPVALFGGFPCTAWFDMGEISEDAPDDM  99



>ref|XP_008378308.1| PREDICTED: acyl-protein thioesterase 2-like isoform X3 [Malus 
domestica]
 ref|XP_008378309.1| PREDICTED: acyl-protein thioesterase 2-like isoform X3 [Malus 
domestica]
Length=257

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+  S  RTA R+F FGRT+VV+PKG+HQATIVWLHGLGD GSSWS LLE+LPLP
Sbjct  1    MSYNSSNAGSXSRTASRAFEFGRTHVVRPKGRHQATIVWLHGLGDKGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFD+ E+SE+A DD+
Sbjct  61   NIKWICPTAPSRPVALFGGFPCTAWFDMGEISEDAPDDI  99



>ref|XP_009347638.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=274

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  111  LLSVLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSS  290
             + +L   MS+  S+  S  RTA R+F FGRT+V++PKG+HQATIVWLHGLGD GSSWS 
Sbjct  10   FVCILGARMSYNSSNAGSGSRTASRAFEFGRTHVIRPKGRHQATIVWLHGLGDKGSSWSQ  69

Query  291  LLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            LLE+LPLPNIKWICPTAP RP+ LFGGFP TAWFD+ E+SE+A DD+
Sbjct  70   LLESLPLPNIKWICPTAPSRPVALFGGFPCTAWFDMGEISEDAPDDI  116



>gb|EPS72096.1| hypothetical protein M569_02661, partial [Genlisea aurea]
Length=260

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 4/107 (4%)
 Frame = +3

Query  114  LSVLFEGMSFTGSS-VASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSS  290
            +S +++ MS  G+S V SAGRTA    +FG+TYVV+PKGKHQAT VWLHGLGD G+SWSS
Sbjct  4    ISFIWKNMSAPGASAVGSAGRTA---LSFGQTYVVRPKGKHQATFVWLHGLGDTGNSWSS  60

Query  291  LLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            LLETLPLPNIKWICPTAP RP+TLFGGFPSTAWFDVNELSE+A DD+
Sbjct  61   LLETLPLPNIKWICPTAPLRPMTLFGGFPSTAWFDVNELSEHADDDL  107



>ref|XP_008378307.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Malus 
domestica]
Length=274

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+  S  RTA R+F FGRT+VV+PKG+HQATIVWLHGLGD GSSWS LLE+LPLP
Sbjct  18   MSYNSSNAGSXSRTASRAFEFGRTHVVRPKGRHQATIVWLHGLGDKGSSWSQLLESLPLP  77

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFD+ E+SE+A DD+
Sbjct  78   NIKWICPTAPSRPVALFGGFPCTAWFDMGEISEDAPDDI  116



>ref|XP_009347639.1| PREDICTED: acyl-protein thioesterase 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=257

 Score =   164 bits (415),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+  S  RTA R+F FGRT+V++PKG+HQATIVWLHGLGD GSSWS LLE+LPLP
Sbjct  1    MSYNSSNAGSGSRTASRAFEFGRTHVIRPKGRHQATIVWLHGLGDKGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFD+ E+SE+A DD+
Sbjct  61   NIKWICPTAPSRPVALFGGFPCTAWFDMGEISEDAPDDI  99



>gb|AFK34216.1| unknown [Lotus japonicus]
 gb|AFK46785.1| unknown [Lotus japonicus]
Length=255

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFT  S+ SAG  A R+F +GRTYVV+PKGKHQATIVWLHGLGDNG+SWS LLETL LP
Sbjct  1    MSFTAPSLVSAG--ARRAFEYGRTYVVRPKGKHQATIVWLHGLGDNGASWSQLLETLALP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFGGFPSTAWFDV +LSE+A DD+
Sbjct  59   NIKWICPTAPTQPISLFGGFPSTAWFDVGDLSEDAPDDL  97



>ref|XP_009347637.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=288

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  111  LLSVLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSS  290
             + +L   MS+  S+  S  RTA R+F FGRT+V++PKG+HQATIVWLHGLGD GSSWS 
Sbjct  24   FVCILGARMSYNSSNAGSGSRTASRAFEFGRTHVIRPKGRHQATIVWLHGLGDKGSSWSQ  83

Query  291  LLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            LLE+LPLPNIKWICPTAP RP+ LFGGFP TAWFD+ E+SE+A DD+
Sbjct  84   LLESLPLPNIKWICPTAPSRPVALFGGFPCTAWFDMGEISEDAPDDI  130



>ref|XP_002285009.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Vitis vinifera]
 ref|XP_010648640.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Vitis vinifera]
 ref|XP_010648641.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Vitis vinifera]
 emb|CBI21011.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF  S++ S  RT  R+F FGRT+VV+PKGKHQATIVWLHGLGD GSSWS +LETLPLP
Sbjct  1    MSFNSSTMGSGSRTTRRTFEFGRTHVVRPKGKHQATIVWLHGLGDKGSSWSQILETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ L GGFP TAWFDV E+SE+A DD+
Sbjct  61   NIKWICPTAPTRPVALLGGFPCTAWFDVGEISEDAPDDL  99



>ref|XP_008394055.1| PREDICTED: acyl-protein thioesterase 2-like [Malus domestica]
 ref|XP_008394056.1| PREDICTED: acyl-protein thioesterase 2-like [Malus domestica]
 ref|XP_008361071.1| PREDICTED: acyl-protein thioesterase 2-like [Malus domestica]
 ref|XP_008361072.1| PREDICTED: acyl-protein thioesterase 2-like [Malus domestica]
Length=258

 Score =   164 bits (414),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+ AS  RT  R+F FGRT+VV+PKG+HQATIVWLHGLGD GSSWS LLE+LPLP
Sbjct  1    MSYNSSNAASGSRTGSRAFEFGRTHVVRPKGRHQATIVWLHGLGDKGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFD+ E+SE+A DD+
Sbjct  61   NIKWICPTAPSRPVALFGGFPCTAWFDMGEISEDAPDDM  99



>ref|XP_008465012.1| PREDICTED: acyl-protein thioesterase 2 [Cucumis melo]
 ref|XP_008465013.1| PREDICTED: acyl-protein thioesterase 2 [Cucumis melo]
Length=252

 Score =   164 bits (414),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF GSSVA+ GR A ++  FG+TYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFAGSSVAAGGRAAKKAIEFGKTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RPI LFGGFPSTAWFDV +LSEN  DD+
Sbjct  61   NIKWICPTAPTRPIALFGGFPSTAWFDVEDLSENGPDDL  99



>gb|KJB70576.1| hypothetical protein B456_011G080600 [Gossypium raimondii]
Length=254

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS + +++ S  RTA R+F+FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSHSHNTMGSGSRTARRTFDFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ L GGFP TAWFDV+ELSEN  DD
Sbjct  61   NIKWICPTAPTRPVALLGGFPYTAWFDVSELSENGPDD  98



>ref|XP_008378306.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Malus 
domestica]
Length=288

 Score =   164 bits (416),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+  S  RTA R+F FGRT+VV+PKG+HQATIVWLHGLGD GSSWS LLE+LPLP
Sbjct  32   MSYNSSNAGSXSRTASRAFEFGRTHVVRPKGRHQATIVWLHGLGDKGSSWSQLLESLPLP  91

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFD+ E+SE+A DD+
Sbjct  92   NIKWICPTAPSRPVALFGGFPCTAWFDMGEISEDAPDDI  130



>ref|XP_007023936.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY26558.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=245

 Score =   163 bits (413),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  RT  RSF+FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYSHHSMGSGSRTTRRSFDFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ L GGFP TAWFDV ELSE+  DD
Sbjct  61   NIKWICPTAPTRPVALLGGFPCTAWFDVGELSEDGPDD  98



>ref|XP_007138319.1| hypothetical protein PHAVU_009G198700g [Phaseolus vulgaris]
 gb|ESW10313.1| hypothetical protein PHAVU_009G198700g [Phaseolus vulgaris]
Length=258

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  MSFTGSSVAS-AGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPL  311
            MSF   S+ S  GR++ R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLETLPL
Sbjct  1    MSFAAPSLGSVGGRSSRRAFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPL  60

Query  312  PNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
             NIKWICPTAP +PI++FGGFPSTAWFDV E+SE+A DD+
Sbjct  61   TNIKWICPTAPTQPISIFGGFPSTAWFDVGEISEDAPDDL  100



>ref|XP_007013352.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY30971.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=251

 Score =   163 bits (413),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 84/99 (85%), Gaps = 6/99 (6%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG      GRT  R+  FGRTYVV+PKG+HQ TIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTG------GRTVRRALEFGRTYVVRPKGRHQVTIVWLHGLGDNGSSWSQLLETLPLP  54

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PIT+FGGFPSTAWFDV +LSE+A DD+
Sbjct  55   NIKWICPTAPTQPITVFGGFPSTAWFDVGDLSEDAPDDI  93



>ref|XP_002517576.1| Acyl-protein thioesterase, putative [Ricinus communis]
 gb|EEF44740.1| Acyl-protein thioesterase, putative [Ricinus communis]
Length=258

 Score =   163 bits (413),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +3

Query  153  SVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWIC  332
            SV S  RTA R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLPNIKWIC
Sbjct  8    SVGSGSRTARRTFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLPNIKWIC  67

Query  333  PTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            PTAP RP+ L GGFP TAWFDV E+SEN+ DD
Sbjct  68   PTAPTRPVALLGGFPCTAWFDVGEISENSPDD  99



>gb|KJB54089.1| hypothetical protein B456_009G020100 [Gossypium raimondii]
Length=250

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 84/99 (85%), Gaps = 6/99 (6%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSFTG      G T  R+  FGRTYVV+PKG+HQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFTG------GGTVRRALEFGRTYVVRPKGRHQATIVWLHGLGDNGSSWSQLLETLPLP  54

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PIT+FGGFPSTAWFDV ++SE+A DD+
Sbjct  55   NIKWICPTAPTQPITIFGGFPSTAWFDVGDISEDAADDI  93



>ref|XP_011039721.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
 ref|XP_011039723.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
 ref|XP_011039724.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
Length=257

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+V S  R   R+F FGRT+VV+PKGKHQATIVWLHGLGD GSSWS LLETLPLP
Sbjct  1    MSYNTSAVGSGSRNTTRTFEFGRTHVVRPKGKHQATIVWLHGLGDKGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAWFDV ++SE+A DD+
Sbjct  61   NIKWICPTAPTRPVAIFGGFPCTAWFDVGDISEDAPDDL  99



>ref|XP_011019782.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
 ref|XP_011019784.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
 ref|XP_011019785.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
Length=257

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+V S  R   R+F FGRT+VV+PKGKHQATIVWLHGLGD GSSWS LLETLPLP
Sbjct  1    MSYNTSAVGSGSRNTTRTFEFGRTHVVRPKGKHQATIVWLHGLGDKGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAWFDV ++SE+A DD+
Sbjct  61   NIKWICPTAPTRPVAIFGGFPCTAWFDVGDISEDAPDDL  99



>ref|XP_010688070.1| PREDICTED: acyl-protein thioesterase 2 isoform X3 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688071.1| PREDICTED: acyl-protein thioesterase 2 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=257

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 85/102 (83%), Gaps = 4/102 (4%)
 Frame = +3

Query  135  MSFTGSSVASA----GRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLET  302
            MSF+G+S  S     G  A ++F FGRTYVV+PKGKHQAT+VWLHGLGDNG SWS +LET
Sbjct  1    MSFSGTSAGSVPLIGGNAARKAFEFGRTYVVRPKGKHQATVVWLHGLGDNGGSWSQILET  60

Query  303  LPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            L LPNIKWICPTAP RPI+LFGGFPSTAWFDV +LSE+A DD
Sbjct  61   LSLPNIKWICPTAPSRPISLFGGFPSTAWFDVQDLSEDAPDD  102



>ref|XP_002324285.1| hypothetical protein POPTR_0018s01470g [Populus trichocarpa]
 gb|EEF02850.1| hypothetical protein POPTR_0018s01470g [Populus trichocarpa]
Length=257

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+V S  R   R+F FGRT+VV+PKGKHQATIVWLHGLGD GSSWS LLETLPLP
Sbjct  1    MSYNTSAVGSGSRNTTRTFEFGRTHVVRPKGKHQATIVWLHGLGDKGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAWFDV ++SE+A DD+
Sbjct  61   NIKWICPTAPTRPVAIFGGFPCTAWFDVGDISEDAPDDL  99



>gb|KJB68126.1| hypothetical protein B456_010G227200 [Gossypium raimondii]
Length=256

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  ++AS  RT  R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYSHYTMASGSRTGRRTFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ L GGFP TAWFD  ELSE + DD
Sbjct  61   NIKWICPTAPTRPVALLGGFPCTAWFDAGELSEESPDD  98



>gb|KJB68127.1| hypothetical protein B456_010G227200 [Gossypium raimondii]
Length=253

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  ++AS  RT  R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYSHYTMASGSRTGRRTFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ L GGFP TAWFD  ELSE + DD
Sbjct  61   NIKWICPTAPTRPVALLGGFPCTAWFDAGELSEESPDD  98



>ref|XP_011026469.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
 ref|XP_011026470.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
 ref|XP_011026471.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
 ref|XP_011026472.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
Length=257

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+V S  R   R+F FGRT+VV+PKGKHQATIVWLHGLGD GSSWS LLETLPLP
Sbjct  1    MSYNTSAVGSGSRNTTRTFEFGRTHVVRPKGKHQATIVWLHGLGDKGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAWFDV ++SE+A DD+
Sbjct  61   NIKWICPTAPTRPVAIFGGFPCTAWFDVGDISEDAPDDL  99



>ref|XP_004150012.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis sativus]
 ref|XP_004170269.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis sativus]
 gb|KGN65303.1| hypothetical protein Csa_1G305760 [Cucumis sativus]
Length=252

 Score =   162 bits (409),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF GSSVA+ GR A ++  FG+TYVV+PKGKHQAT+VWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFAGSSVAAGGRAAKKAIEFGKTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RPI LFGGFPSTAWFDV +LSE+  DD+
Sbjct  61   NIKWICPTAPTRPIALFGGFPSTAWFDVEDLSEDGPDDL  99



>gb|KHG10709.1| Acyl-protein thioesterase 2 [Gossypium arboreum]
Length=256

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  ++AS  RT  R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYSHYTMASGSRTGRRTFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            N+KWICPTAP RP+ L GGFP TAWFD  ELSE + DD
Sbjct  61   NVKWICPTAPTRPVALLGGFPCTAWFDAGELSEESPDD  98



>gb|KDP32363.1| hypothetical protein JCGZ_13288 [Jatropha curcas]
Length=277

 Score =   162 bits (410),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 89/119 (75%), Gaps = 20/119 (17%)
 Frame = +3

Query  135  MSFTGSSVAS--------------------AGRTAGRSFNFGRTYVVKPKGKHQATIVWL  254
            MSFTG SV S                     G+TA R+  FGRTYVV+PKGKHQAT++WL
Sbjct  1    MSFTGPSVGSGCIIDGLWKFGCGGLTRQKNCGKTARRALEFGRTYVVRPKGKHQATVIWL  60

Query  255  HGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            HGLGDNGSSWS LLETLPLPNIKWICPTAP +PI++FGGFPSTAWFDV +LSE+A DD+
Sbjct  61   HGLGDNGSSWSQLLETLPLPNIKWICPTAPTQPISIFGGFPSTAWFDVGDLSEDAPDDI  119



>ref|XP_010254331.1| PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera]
 ref|XP_010254332.1| PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera]
Length=259

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAG--RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLP  308
            MSFT  S+ S  R     ++F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLP
Sbjct  1    MSFTSPSICSGSRATATKKTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLP  60

Query  309  LPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            LPNIKWICPTAP RP+ +FGGFP TAWFDV +LSE+  DDV
Sbjct  61   LPNIKWICPTAPTRPVAIFGGFPCTAWFDVGDLSEDGPDDV  101



>dbj|BAJ86349.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00631.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=280

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 86/101 (85%), Gaps = 2/101 (2%)
 Frame = +3

Query  129  EGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLP  308
             GMSF G+S  +AG  A R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLP
Sbjct  23   RGMSFGGASSVAAG--AKRPFEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLP  80

Query  309  LPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            LPNIKWICPTAP RP+ +FGGFPSTAWFDV +LSE++ DDV
Sbjct  81   LPNIKWICPTAPTRPVAIFGGFPSTAWFDVADLSEDSPDDV  121



>ref|XP_010688068.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=284

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 85/102 (83%), Gaps = 4/102 (4%)
 Frame = +3

Query  135  MSFTGSSVASA----GRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLET  302
            MSF+G+S  S     G  A ++F FGRTYVV+PKGKHQAT+VWLHGLGDNG SWS +LET
Sbjct  28   MSFSGTSAGSVPLIGGNAARKAFEFGRTYVVRPKGKHQATVVWLHGLGDNGGSWSQILET  87

Query  303  LPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            L LPNIKWICPTAP RPI+LFGGFPSTAWFDV +LSE+A DD
Sbjct  88   LSLPNIKWICPTAPSRPISLFGGFPSTAWFDVQDLSEDAPDD  129



>ref|XP_008445176.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis melo]
 ref|XP_008445177.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis melo]
 ref|XP_008445178.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis melo]
 ref|XP_008445179.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis melo]
 ref|XP_008445180.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis melo]
Length=260

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+V S  RT   +F FGRT+VV+PKGKHQATIVWLHGLGD GSSWS LLETLPLP
Sbjct  1    MSYNSSTVGSGSRTGRMTFEFGRTHVVRPKGKHQATIVWLHGLGDKGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFDV ++SE++ DD+
Sbjct  61   NIKWICPTAPTRPVALFGGFPCTAWFDVGDISEDSPDDL  99



>ref|XP_004138733.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis sativus]
 gb|KGN62923.1| hypothetical protein Csa_2G380030 [Cucumis sativus]
Length=260

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+V S  RT   +F FGRT+VV+PKGKHQATIVWLHGLGD GSSWS +LETLPLP
Sbjct  1    MSYNSSTVGSGSRTGRMTFEFGRTHVVRPKGKHQATIVWLHGLGDKGSSWSQILETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFDV ++SE++ DD+
Sbjct  61   NIKWICPTAPTRPVALFGGFPCTAWFDVGDISEDSPDDL  99



>ref|XP_006841917.1| hypothetical protein AMTR_s00042p00153000 [Amborella trichopoda]
 gb|ERN03592.1| hypothetical protein AMTR_s00042p00153000 [Amborella trichopoda]
Length=257

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  171  RTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQR  350
            R   R+F+FGRT+VVKPKGKHQATIVWLHGLGDNGSSWS LLETLPLPNIKWICPTAP R
Sbjct  13   RAGRRAFDFGRTHVVKPKGKHQATIVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTR  72

Query  351  PITLFGGFPSTAWFDVNELSENAIDD  428
            P+ LFGGFP TAWFDV ELSE+A DD
Sbjct  73   PVALFGGFPCTAWFDVGELSEDAPDD  98



>ref|XP_010520588.1| PREDICTED: acyl-protein thioesterase 2-like [Tarenaya hassleriana]
 ref|XP_010520589.1| PREDICTED: acyl-protein thioesterase 2-like [Tarenaya hassleriana]
 ref|XP_010520590.1| PREDICTED: acyl-protein thioesterase 2-like [Tarenaya hassleriana]
 ref|XP_010520591.1| PREDICTED: acyl-protein thioesterase 2-like [Tarenaya hassleriana]
 ref|XP_010520593.1| PREDICTED: acyl-protein thioesterase 2-like [Tarenaya hassleriana]
Length=252

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF G+SV S+ R  GR   FG+T+V++PKGKHQATIVWLHGLGDNG SWS LLETLPLP
Sbjct  1    MSFPGASVGSS-RAVGRVVEFGKTHVIRPKGKHQATIVWLHGLGDNGLSWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP++LFGGFPSTAWFDV +L+E+A DD
Sbjct  60   NIKWICPTAPSRPVSLFGGFPSTAWFDVVDLNEDAPDD  97



>dbj|BAJ53250.1| JHL25H03.13 [Jatropha curcas]
 gb|KDP37131.1| hypothetical protein JCGZ_06187 [Jatropha curcas]
Length=258

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  153  SVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWIC  332
            S+ S  RT  R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLPNIKWIC
Sbjct  8    SMGSGSRTVRRTFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLPNIKWIC  67

Query  333  PTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            PTAP RP+ L GGFP TAWFDV E+SEN+ DD
Sbjct  68   PTAPTRPVALLGGFPCTAWFDVGEISENSPDD  99



>ref|XP_009131769.1| PREDICTED: acyl-protein thioesterase 2 [Brassica rapa]
Length=253

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G++   + R   R+  FG+T+VV+PKGKHQATIVWLHGLGDNGSSWS +LETLPLP
Sbjct  1    MSLSGAAAVGSSRNLKRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQILETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFGGFPSTAWFDV +L+EN  DDV
Sbjct  61   NIKWICPTAPSQPISLFGGFPSTAWFDVVDLTENGPDDV  99



>ref|XP_008230034.1| PREDICTED: acyl-protein thioesterase 2-like [Prunus mume]
Length=234

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+  S  RT  R+F FGRT+VV+PKG HQATIVWLHGLGD GSSWS LLETLPLP
Sbjct  1    MSYNTSNTGSGSRTPRRTFEFGRTHVVRPKGNHQATIVWLHGLGDKGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFD+ ++SE+A DD+
Sbjct  61   NIKWICPTAPSRPVALFGGFPCTAWFDMGDISEDAPDDM  99



>ref|XP_006427187.1| hypothetical protein CICLE_v10026074mg [Citrus clementina]
 gb|ESR40427.1| hypothetical protein CICLE_v10026074mg [Citrus clementina]
Length=326

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  129  EGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLP  308
            E MS++  +V S  R A R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE+LP
Sbjct  68   EKMSYSHQTVGSGSRAARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLP  127

Query  309  LPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            LPNIKWICPTAP RP+ + GGFP TAWFDV ELS++  +D
Sbjct  128  LPNIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPED  167



>ref|XP_009774144.1| PREDICTED: acyl-protein thioesterase 2-like [Nicotiana sylvestris]
 ref|XP_009774145.1| PREDICTED: acyl-protein thioesterase 2-like [Nicotiana sylvestris]
Length=255

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF+GS+  S  RT+  SF FGRT+VV+PKGKH+ATIVWLHGLGD GSSWS L E+LPLP
Sbjct  1    MSFSGSTAGSGSRTSQTSFEFGRTHVVRPKGKHEATIVWLHGLGDKGSSWSQLFESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            N+KWICPTAP RP+  FGGFP TAWFDV ++SE+A DD+
Sbjct  61   NVKWICPTAPTRPVAAFGGFPCTAWFDVGDISEDAPDDL  99



>ref|XP_008785111.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Phoenix dactylifera]
 ref|XP_008785118.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Phoenix dactylifera]
 ref|XP_008785126.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Phoenix dactylifera]
 ref|XP_008785135.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Phoenix dactylifera]
 ref|XP_008785144.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Phoenix dactylifera]
Length=261

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  SS+AS  +TA R F +GRT+VV+PKG+HQATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGSSSLASGAKTAARPFEYGRTHVVRPKGRHQATIVWLHGLGDNGASWSQLLETLPLP  60

Query  315  N----IKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            N    IKWICPTAP RP+ +FGGFP TAWFDV +LSE+  DDV
Sbjct  61   NSLMQIKWICPTAPTRPVAVFGGFPCTAWFDVGDLSEDGPDDV  103



>ref|XP_006427186.1| hypothetical protein CICLE_v10026074mg [Citrus clementina]
 gb|ESR40426.1| hypothetical protein CICLE_v10026074mg [Citrus clementina]
Length=325

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  129  EGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLP  308
            E MS++  +V S  R A R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE+LP
Sbjct  67   EKMSYSHQTVGSGSRAARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLP  126

Query  309  LPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            LPNIKWICPTAP RP+ + GGFP TAWFDV ELS++  +D
Sbjct  127  LPNIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPED  166



>ref|XP_010920065.1| PREDICTED: acyl-protein thioesterase 2-like [Elaeis guineensis]
Length=258

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGR-SFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPL  311
            M++  SS AS  R+A R SF +GRTYVV+PKG+HQATIVWLHGLGDNG+SWS LLETLPL
Sbjct  1    MNYGSSSYASGPRSATRRSFEYGRTYVVRPKGRHQATIVWLHGLGDNGASWSQLLETLPL  60

Query  312  PNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            PNIKWICPTAP RP+  FGGFP TAWFDV +LS++  DDV
Sbjct  61   PNIKWICPTAPTRPVAAFGGFPCTAWFDVRDLSDDGPDDV  100



>ref|XP_004968388.1| PREDICTED: acyl-protein thioesterase 2-like [Setaria italica]
Length=255

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF GSS  + G  A R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSFGGSSSVATG--AKRPFEYGRTHVVRPKGTHKATIVWLHGLGDNGASWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+++FGGFPSTAWFDV +LSE+A DDV
Sbjct  59   NIKWICPTAPTRPVSVFGGFPSTAWFDVADLSEDAPDDV  97



>ref|XP_009789313.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like [Nicotiana 
sylvestris]
Length=256

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+   S  S  RT+  +F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYLNPSTGSGSRTSRMTFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ + GGFP TAWFDV ELS++  DD+
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPDDL  99



>gb|AAM29178.1| biostress-resistance-related protein [Triticum aestivum]
Length=324

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +3

Query  129  EGMSFTG-SSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETL  305
             GMSF G SSVA+ G+   R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETL
Sbjct  67   RGMSFGGASSVAAGGK---RPFEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETL  123

Query  306  PLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            PLPNIKWICPTAP RP+ +FGGFPSTAWFDV +LSE++ DDV
Sbjct  124  PLPNIKWICPTAPTRPVAIFGGFPSTAWFDVADLSEDSPDDV  165



>ref|XP_009629002.1| PREDICTED: acyl-protein thioesterase 1 homolog 1 [Nicotiana tomentosiformis]
 ref|XP_009629003.1| PREDICTED: acyl-protein thioesterase 1 homolog 1 [Nicotiana tomentosiformis]
Length=256

 Score =   159 bits (401),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+   S  S  RT+  +F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYLNPSTGSGSRTSRMTFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ + GGFP TAWFDV ELS++  DD+
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPDDL  99



>ref|NP_001150035.1| acyl-protein thioesterase 2 [Zea mays]
 ref|XP_008672922.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Zea mays]
 ref|XP_008672923.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Zea mays]
 ref|XP_008672924.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Zea mays]
 gb|ACF82577.1| unknown [Zea mays]
 gb|ACF84020.1| unknown [Zea mays]
 gb|ACG32084.1| acyl-protein thioesterase 2 [Zea mays]
 gb|ACG37582.1| acyl-protein thioesterase 2 [Zea mays]
 gb|ACR38609.1| unknown [Zea mays]
 tpg|DAA53212.1| TPA: acyl-protein thioesterase 2 isoform 1 [Zea mays]
 tpg|DAA53213.1| TPA: acyl-protein thioesterase 2 isoform 2 [Zea mays]
 tpg|DAA53214.1| TPA: acyl-protein thioesterase 2 isoform 3 [Zea mays]
 tpg|DAA53215.1| TPA: acyl-protein thioesterase 2 isoform 4 [Zea mays]
Length=255

 Score =   159 bits (401),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF GSS  ++G  A R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSFGGSSSLASG--AKRPFEYGRTHVVRPKGTHKATIVWLHGLGDNGASWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+++FGGFPSTAWFDV +LSE+A DD+
Sbjct  59   NIKWICPTAPSRPVSVFGGFPSTAWFDVADLSEDAPDDI  97



>ref|XP_006427188.1| hypothetical protein CICLE_v10026074mg [Citrus clementina]
 ref|XP_006427189.1| hypothetical protein CICLE_v10026074mg [Citrus clementina]
 gb|ESR40428.1| hypothetical protein CICLE_v10026074mg [Citrus clementina]
 gb|ESR40429.1| hypothetical protein CICLE_v10026074mg [Citrus clementina]
Length=257

 Score =   159 bits (401),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  +V S  R A R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYSHQTVGSGSRAARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWFDV ELS++  +D
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPED  98



>ref|XP_006465384.1| PREDICTED: acyl-protein thioesterase 2-like [Citrus sinensis]
 gb|KDO52896.1| hypothetical protein CISIN_1g025139mg [Citrus sinensis]
 gb|KDO52897.1| hypothetical protein CISIN_1g025139mg [Citrus sinensis]
 gb|KDO52898.1| hypothetical protein CISIN_1g025139mg [Citrus sinensis]
 gb|KDO52899.1| hypothetical protein CISIN_1g025139mg [Citrus sinensis]
Length=257

 Score =   159 bits (401),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  +V S  R A R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYSHQTVGSGSRAARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWFDV ELS++  +D
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPED  98



>gb|AFW80178.1| hypothetical protein ZEAMMB73_309051 [Zea mays]
Length=260

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +3

Query  117  SVLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLL  296
            + +  GMS+ GSS  + G  A R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LL
Sbjct  72   AAIVRGMSYGGSSSLAPG--AKRPFEYGRTHVVRPKGTHKATIVWLHGLGDNGTSWSQLL  129

Query  297  ETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            ETLPLPNIKWICPTAP RP++LFGGFP TAWFDV +LSE+A DD 
Sbjct  130  ETLPLPNIKWICPTAPSRPVSLFGGFPCTAWFDVADLSEDAPDDT  174



>ref|XP_009126414.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Brassica 
rapa]
 ref|XP_009126415.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Brassica 
rapa]
Length=252

 Score =   158 bits (400),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G+++ S GR  GR+  FG+T+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSISGAALGS-GRILGRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFGGFPSTAWFDV  ++E+  DDV
Sbjct  60   NIKWICPTAPSQPISLFGGFPSTAWFDVVGINEDGPDDV  98



>ref|XP_010322678.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Solanum 
lycopersicum]
Length=256

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+   S  S  RT+  +F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYLNPSTGSGSRTSRMTFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWFDV ELS++  DD
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPDD  98



>ref|XP_006356194.1| PREDICTED: acyl-protein thioesterase 2-like [Solanum tuberosum]
Length=256

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+   S  S  RT+  +F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYLNPSTGSGSRTSRMTFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWFDV ELS++  DD
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPDD  98



>ref|XP_010230528.1| PREDICTED: acyl-protein thioesterase 1 homolog 1 [Brachypodium 
distachyon]
 ref|XP_010230529.1| PREDICTED: acyl-protein thioesterase 1 homolog 1 [Brachypodium 
distachyon]
Length=255

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF G S  +AG  A R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSFGGGSSVAAG--AKRPFEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFPSTAWFDV +LSE++ DDV
Sbjct  59   NIKWICPTAPTRPVAIFGGFPSTAWFDVADLSEDSPDDV  97



>ref|XP_011035658.1| PREDICTED: acyl-protein thioesterase 2-like [Populus euphratica]
Length=258

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  153  SVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWIC  332
            S+ S  R A R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE LPLPNIKWIC
Sbjct  8    SMGSGSRPARRNFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLENLPLPNIKWIC  67

Query  333  PTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            PTAP RP+ L GGFP TAWFDV E+SE++ DD
Sbjct  68   PTAPTRPVALLGGFPCTAWFDVGEISEDSPDD  99



>ref|XP_008809651.1| PREDICTED: acyl-protein thioesterase 2-like [Phoenix dactylifera]
Length=258

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGR-SFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPL  311
            M++  SS AS  RTA R SF +GRTYVV+PKG+HQATIVWLHGLGDNG+SWS LLETLPL
Sbjct  1    MNYGSSSRASGPRTATRRSFEYGRTYVVRPKGRHQATIVWLHGLGDNGASWSQLLETLPL  60

Query  312  PNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            PN+KWICPTAP RP+  FGGFP TAWFDV +LS +  DDV
Sbjct  61   PNVKWICPTAPTRPVAAFGGFPCTAWFDVKDLSVDGPDDV  100



>ref|XP_002308652.2| hypothetical protein POPTR_0006s26730g [Populus trichocarpa]
 gb|EEE92175.2| hypothetical protein POPTR_0006s26730g [Populus trichocarpa]
Length=257

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+  S  R   R+F FGRT+VV+PKGKHQATIVWLHGLGD GSSWS LLETLPLP
Sbjct  1    MSYNTSAAGSGSRNTTRTFEFGRTHVVRPKGKHQATIVWLHGLGDKGSSWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAW DV ++SE+A DD+
Sbjct  61   NIKWICPTAPTRPVAIFGGFPCTAWSDVGDISEDAPDDL  99



>ref|NP_197506.1| phospholipase/carboxylesterase family protein [Arabidopsis thaliana]
 ref|NP_974815.1| phospholipase/carboxylesterase family protein [Arabidopsis thaliana]
 ref|NP_001031909.1| phospholipase/carboxylesterase family protein [Arabidopsis thaliana]
 gb|AAM65714.1| putative lysophospholipase [Arabidopsis thaliana]
 gb|AAN17405.1| putative protein [Arabidopsis thaliana]
 gb|AAN65062.1| putative protein [Arabidopsis thaliana]
 gb|AED92787.1| phospholipase/carboxylesterase family protein [Arabidopsis thaliana]
 gb|AED92788.1| phospholipase/carboxylesterase family protein [Arabidopsis thaliana]
 gb|AED92789.1| phospholipase/carboxylesterase family protein [Arabidopsis thaliana]
Length=252

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G++V S GR   R+  FG+T+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSISGAAVGS-GRNLRRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFGGFPSTAWFDV +++E+  DD+
Sbjct  60   NIKWICPTAPSQPISLFGGFPSTAWFDVVDINEDGPDDM  98



>ref|XP_007023935.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY26557.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=286

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 87/112 (78%), Gaps = 6/112 (5%)
 Frame = +3

Query  93   YNCSNSLLSVLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDN  272
            +  S  L+++ F   +F GS      RT  RSF+FGRT+VV+PKGKHQATIVWLHGLGDN
Sbjct  23   FASSTLLIALNFIDANFLGS------RTTRRSFDFGRTHVVRPKGKHQATIVWLHGLGDN  76

Query  273  GSSWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            GSSWS LLE+LPLPNIKWICPTAP RP+ L GGFP TAWFDV ELSE+  DD
Sbjct  77   GSSWSQLLESLPLPNIKWICPTAPTRPVALLGGFPCTAWFDVGELSEDGPDD  128



>ref|XP_006400572.1| hypothetical protein EUTSA_v10014480mg [Eutrema salsugineum]
 gb|ESQ42025.1| hypothetical protein EUTSA_v10014480mg [Eutrema salsugineum]
Length=252

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF+ ++V S+ R   R+  FG+T+VVKPKGKHQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSFSSAAVGSS-RNLRRAVEFGKTHVVKPKGKHQATIVWLHGLGDNGSSWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFGGFPSTAWFDV +++E+  DDV
Sbjct  60   NIKWICPTAPSQPISLFGGFPSTAWFDVVDINEDGPDDV  98



>ref|XP_002871919.1| phospholipase/carboxylesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48178.1| phospholipase/carboxylesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=252

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G++V S GR   R+  FG+T+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSISGAAVGS-GRNLRRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFGGFPSTAWFDV +++E+  DD+
Sbjct  60   NIKWICPTAPSQPISLFGGFPSTAWFDVVDINEDGPDDM  98



>gb|ACN35659.1| unknown [Zea mays]
 gb|AFW80177.1| acyl-protein thioesterase 2 [Zea mays]
Length=332

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +3

Query  117  SVLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLL  296
            + +  GMS+ GSS  + G  A R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LL
Sbjct  72   AAIVRGMSYGGSSSLAPG--AKRPFEYGRTHVVRPKGTHKATIVWLHGLGDNGTSWSQLL  129

Query  297  ETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            ETLPLPNIKWICPTAP RP++LFGGFP TAWFDV +LSE+A DD 
Sbjct  130  ETLPLPNIKWICPTAPSRPVSLFGGFPCTAWFDVADLSEDAPDDT  174



>gb|ACF79577.1| unknown [Zea mays]
Length=202

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+ GSS  + G  A R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGGSSSLAPG--AKRPFEYGRTHVVRPKGTHKATIVWLHGLGDNGTSWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++LFGGFP TAWFDV +LSE+A DD 
Sbjct  59   NIKWICPTAPSRPVSLFGGFPCTAWFDVADLSEDAPDDT  97



>ref|XP_006288411.1| hypothetical protein CARUB_v10001666mg [Capsella rubella]
 gb|EOA21309.1| hypothetical protein CARUB_v10001666mg [Capsella rubella]
Length=279

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +3

Query  123  LFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLET  302
            L   MS +G++V S GR   R+  FG+T+VV+PKGKHQATIVWLHGLGDNGSSWS +LET
Sbjct  24   LSSSMSISGAAVGS-GRNFRRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQILET  82

Query  303  LPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            LPLPNIKWICPTAP +PI+LFGGFPSTAWFDV +++EN  DD+
Sbjct  83   LPLPNIKWICPTAPSQPISLFGGFPSTAWFDVVDINENGPDDM  125



>ref|XP_002285335.1| PREDICTED: acyl-protein thioesterase 2 [Vitis vinifera]
 ref|XP_010654745.1| PREDICTED: acyl-protein thioesterase 2 [Vitis vinifera]
Length=257

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  RTA R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE LPLP
Sbjct  1    MSYSNHSMGSGSRTARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLENLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELS  410
            NIKWICPTAP RP+ + GGFP TAWFDV ELS
Sbjct  61   NIKWICPTAPTRPVAVLGGFPCTAWFDVGELS  92



>ref|XP_009589216.1| PREDICTED: acyl-protein thioesterase 2-like [Nicotiana tomentosiformis]
Length=255

 Score =   156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +GS+  S  RT+  SF FGRT+VV+PKGKH+ATIVWLHGLGD GSSWS L E+LPLP
Sbjct  1    MSVSGSTAGSGSRTSRTSFEFGRTHVVRPKGKHEATIVWLHGLGDKGSSWSQLFESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            N+KWICPTAP RP+  FGGFP TAWFDV ++SE+A DD+
Sbjct  61   NVKWICPTAPTRPVAAFGGFPCTAWFDVGDISEDAPDDL  99



>gb|KHG30420.1| Acyl-protein thioesterase 2 [Gossypium arboreum]
Length=256

 Score =   156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  +V S   TA ++F+FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS +LE+LPLP
Sbjct  1    MSYSYQTVGSGSGTARKTFDFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQILESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWFD  ELSE+  DD
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDAGELSEDGPDD  98



>gb|KJB56648.1| hypothetical protein B456_009G129700 [Gossypium raimondii]
Length=256

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  +V S   TA ++F+FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS +LE+LPLP
Sbjct  1    MSYSYQTVGSGSGTARKTFDFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQILESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWFD  ELSE+  DD
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFDAGELSEDGPDD  98



>emb|CBI36259.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   157 bits (397),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  RTA R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE LPLP
Sbjct  36   MSYSNHSMGSGSRTARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLENLPLP  95

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELS  410
            NIKWICPTAP RP+ + GGFP TAWFDV ELS
Sbjct  96   NIKWICPTAPTRPVAVLGGFPCTAWFDVGELS  127



>ref|XP_009380412.1| PREDICTED: acyl-protein thioesterase 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380413.1| PREDICTED: acyl-protein thioesterase 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380414.1| PREDICTED: acyl-protein thioesterase 2-like [Musa acuminata subsp. 
malaccensis]
Length=257

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  SS+ S  +T  R+F +GRT+VV+PKG+H AT+VWLHGLGD+G+SWS LLETLPLP
Sbjct  1    MSYGSSSITSGAKTTARTFEYGRTHVVRPKGRHLATVVWLHGLGDHGASWSQLLETLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFPS AWFDV +LSE+  +D+
Sbjct  61   NIKWICPTAPTRPVAVFGGFPSNAWFDVGDLSESGPEDI  99



>ref|XP_010925246.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Elaeis guineensis]
Length=294

 Score =   157 bits (397),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +3

Query  156  VASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICP  335
            V++  +TA R F +GRT+VV+PKG+HQATIVWLHGLGDNG+SWS LLETLPLPNIKWICP
Sbjct  46   VSAGAKTAARPFEYGRTHVVRPKGRHQATIVWLHGLGDNGASWSQLLETLPLPNIKWICP  105

Query  336  TAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            TAP RP+ +FGGFP TAWFDV +LSE+  DDV
Sbjct  106  TAPTRPVAVFGGFPCTAWFDVGDLSEDGPDDV  137



>ref|NP_001042168.2| Os01g0175000 [Oryza sativa Japonica Group]
 dbj|BAF04082.2| Os01g0175000, partial [Oryza sativa Japonica Group]
Length=301

 Score =   157 bits (397),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 5/105 (5%)
 Frame = +3

Query  123  LFEGMSFTG--SSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLL  296
            +  GMS  G  SSVAS G   G+   +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LL
Sbjct  58   IVRGMSSFGGTSSVASGG---GKRLEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLL  114

Query  297  ETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            ETLPLPNIKWICPTAP RP+ +FGGFPSTAWFDV +LSE+A DDV
Sbjct  115  ETLPLPNIKWICPTAPTRPVAVFGGFPSTAWFDVADLSEDAPDDV  159



>gb|EMT28452.1| Acyl-protein thioesterase 2 [Aegilops tauschii]
Length=292

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF G+S  +AG    R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSFGGASSVAAG--GKRPFEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFPSTAWFDV +LSE++ DDV
Sbjct  59   NIKWICPTAPTRPVAIFGGFPSTAWFDVADLSEDSPDDV  97



>gb|ABR16303.1| unknown [Picea sitchensis]
Length=258

 Score =   155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  171  RTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQR  350
            R   R+F +GRT+VVKPKGKHQATIVWLHGLGDNGSSWS LLE LPLPNIKWICPTAP R
Sbjct  14   RAQRRTFEYGRTHVVKPKGKHQATIVWLHGLGDNGSSWSQLLEMLPLPNIKWICPTAPTR  73

Query  351  PITLFGGFPSTAWFDVNELSENAIDDV  431
            PI LFGGFPSTAWFDV +LSE+A  D+
Sbjct  74   PIALFGGFPSTAWFDVGDLSEDAPADL  100



>dbj|BAH20103.1| AT5G20060 [Arabidopsis thaliana]
Length=252

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G++V S GR   R+  FG+T+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSISGAAVGS-GRNLRRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPT P +PI+LFGGFPSTAWFDV +++E+  DD+
Sbjct  60   NIKWICPTTPSQPISLFGGFPSTAWFDVVDINEDGPDDM  98



>gb|EEE53965.1| hypothetical protein OsJ_00575 [Oryza sativa Japonica Group]
Length=240

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 4/99 (4%)
 Frame = +3

Query  138  SFTG-SSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            SF G SSVAS G   G+   +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  3    SFGGTSSVASGG---GKRLEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFPSTAWFDV +LSE+A DDV
Sbjct  60   NIKWICPTAPTRPVAVFGGFPSTAWFDVADLSEDAPDDV  98



>ref|NP_001131247.2| uncharacterized protein LOC100192559 [Zea mays]
 gb|ACG30912.1| acyl-protein thioesterase 2 [Zea mays]
 gb|AFW80176.1| acyl-protein thioesterase 2 [Zea mays]
Length=255

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+ GSS  + G  A R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGGSSSLAPG--AKRPFEYGRTHVVRPKGTHKATIVWLHGLGDNGTSWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++LFGGFP TAWFDV +LSE+A DD 
Sbjct  59   NIKWICPTAPSRPVSLFGGFPCTAWFDVADLSEDAPDDT  97



>emb|CDP04787.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF+GS + S  +T GR+F FGRT+VV+P+GKHQATIVWLHGLGD G+SWS LLE+LPLP
Sbjct  1    MSFSGSCIDSGSQTTGRTFEFGRTHVVRPRGKHQATIVWLHGLGDKGASWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+   GGFP TAWFDV + +E+   D+
Sbjct  61   NIKWICPTAPTRPVAALGGFPCTAWFDVGDFAEDTSYDL  99



>emb|CDY45109.1| BnaA02g04670D [Brassica napus]
Length=716

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +3

Query  123  LFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLET  302
            L   MS +G+++ S GR  GR+  FG+T+VV+PKGKHQATIVWLHGLGDNGSSWS LLET
Sbjct  461  LLSEMSISGAALGS-GRILGRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLET  519

Query  303  LPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            LPLPNIKWICPTAP +PI+LFGGFPSTAWFDV  ++E+  DDV
Sbjct  520  LPLPNIKWICPTAPSQPISLFGGFPSTAWFDVVGINEDGPDDV  562



>dbj|BAB62566.1| putative lysophospholipase 2 [Oryza sativa Japonica Group]
 dbj|BAG95194.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG88118.1| unnamed protein product [Oryza sativa Japonica Group]
Length=257

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 4/99 (4%)
 Frame = +3

Query  138  SFTG-SSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            SF G SSVAS G   G+   +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  3    SFGGTSSVASGG---GKRLEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFPSTAWFDV +LSE+A DDV
Sbjct  60   NIKWICPTAPTRPVAVFGGFPSTAWFDVADLSEDAPDDV  98



>ref|XP_009334767.1| PREDICTED: acyl-protein thioesterase 2-like [Pyrus x bretschneideri]
Length=258

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +3

Query  171  RTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQR  350
            RT  R+F FGRT+VV+PKG+HQATIVWLHGLGD GSSWS LLE+LPLPNIKWICPTAP R
Sbjct  13   RTGSRAFEFGRTHVVRPKGRHQATIVWLHGLGDKGSSWSQLLESLPLPNIKWICPTAPSR  72

Query  351  PITLFGGFPSTAWFDVNELSENAIDDV  431
            P+ LFGGFP TAWFD+ E+SE+A DD+
Sbjct  73   PVALFGGFPCTAWFDMGEISEDAPDDM  99



>dbj|BAD68124.1| putative lysophospholipase 2 [Oryza sativa Japonica Group]
Length=240

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 4/99 (4%)
 Frame = +3

Query  138  SFTG-SSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            SF G SSVAS G   G+   +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  3    SFGGTSSVASGG---GKRLEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFPSTAWFDV +LSE+A DDV
Sbjct  60   NIKWICPTAPTRPVAVFGGFPSTAWFDVADLSEDAPDDV  98



>gb|EEC70031.1| hypothetical protein OsI_00606 [Oryza sativa Indica Group]
Length=341

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 5/105 (5%)
 Frame = +3

Query  123  LFEGMSFTG--SSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLL  296
            +  GMS  G  SSVAS G   G+   +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LL
Sbjct  81   IVRGMSSFGGTSSVASGG---GKRLEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLL  137

Query  297  ETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            ETLPLPNIKWICPTAP RP+ +FGGFPSTAWFDV +LSE+A DDV
Sbjct  138  ETLPLPNIKWICPTAPTRPVAVFGGFPSTAWFDVADLSEDAPDDV  182



>gb|EYU21607.1| hypothetical protein MIMGU_mgv1a012402mg [Erythranthe guttata]
Length=251

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R AGR   FGRTYVVKPKGKHQATIVWLHGLGDNGSSWS LLE LPL 
Sbjct  1    MSYSNPSMGSGSR-AGRRIEFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSQLLENLPLS  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ + GGFP  AWFDV EL+E+  DD+
Sbjct  60   NIKWICPTAPTRPVAILGGFPCAAWFDVGELTEDCPDDI  98



>ref|XP_002299611.1| phospholipase/carboxylesterase family protein [Populus trichocarpa]
 gb|EEE84416.1| phospholipase/carboxylesterase family protein [Populus trichocarpa]
Length=258

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  153  SVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWIC  332
            S+ S  R A R+F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE LPLPNIKWIC
Sbjct  8    SMGSGSRPARRNFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLENLPLPNIKWIC  67

Query  333  PTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            PTAP RP+ L GGFP TAW DV E+SE++ DD
Sbjct  68   PTAPTRPVALLGGFPCTAWSDVGEISEDSPDD  99



>ref|XP_007227247.1| hypothetical protein PRUPE_ppa017996mg [Prunus persica]
 gb|EMJ28446.1| hypothetical protein PRUPE_ppa017996mg [Prunus persica]
Length=250

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  162  SAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTA  341
            S  RT  R+F FGRT+VV+PKG HQATIVWLHGLGD GSSWS LLETLPLPNIKWICPTA
Sbjct  2    SGSRTPRRTFEFGRTHVVRPKGNHQATIVWLHGLGDKGSSWSQLLETLPLPNIKWICPTA  61

Query  342  PQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            P RP+ LFGGFP TAWFD+ ++SE+A DD+
Sbjct  62   PSRPVALFGGFPCTAWFDMGDISEDAPDDM  91



>ref|XP_007215843.1| hypothetical protein PRUPE_ppa010240mg [Prunus persica]
 gb|EMJ17042.1| hypothetical protein PRUPE_ppa010240mg [Prunus persica]
Length=257

 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++ S++ S  RTA R+  FGRT+VV+PKGKHQATIVWLHGLGDNGSS S LLE+LPLP
Sbjct  1    MSYSHSNMCSGSRTAKRTLEFGRTHVVRPKGKHQATIVWLHGLGDNGSSASQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWF++ ELS++  DD
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFEMGELSDDGPDD  98



>gb|EMS55551.1| Acyl-protein thioesterase 2 [Triticum urartu]
Length=453

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 4/100 (4%)
 Frame = +3

Query  135  MSFTG-SSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPL  311
            MSF G SSVA+ G+   R F +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPL
Sbjct  198  MSFGGASSVAAGGK---RPFEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPL  254

Query  312  PNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            PNIKWICPTAP RP+ +FGGFPSTAWFDV +LSE++ DDV
Sbjct  255  PNIKWICPTAPTRPVAIFGGFPSTAWFDVADLSEDSPDDV  294



>ref|XP_011459207.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 6/117 (5%)
 Frame = +3

Query  93   YNCSNSLLSVLFEG----MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHG  260
            +N  +SL+ +L+ G    MS+   +  S  RT GR   FGRT+VV+PKG HQATIVWLHG
Sbjct  19   FNKKSSLVCILYFGWSKRMSYNNPNTGSGSRT-GR-LEFGRTHVVRPKGTHQATIVWLHG  76

Query  261  LGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            LGD GSSWS LLETLPLPNIKWICPTAP RP+ LFGGFP TAWFD+ ++SE+A DD+
Sbjct  77   LGDKGSSWSQLLETLPLPNIKWICPTAPSRPVALFGGFPCTAWFDMGDISEDAPDDM  133



>ref|XP_008228643.1| PREDICTED: LOW QUALITY PROTEIN: acyl-protein thioesterase 2 [Prunus 
mume]
Length=241

 Score =   152 bits (385),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++ S++ S  RTA R+  FGRT+VV+PKGKHQATIVWLHGLGDNGSS S LLE+LPLP
Sbjct  1    MSYSHSNMCSGSRTAKRTLEFGRTHVVRPKGKHQATIVWLHGLGDNGSSASQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWF++ ELS++  DD
Sbjct  61   NIKWICPTAPTRPVAILGGFPCTAWFEMGELSDDGPDD  98



>emb|CDX70910.1| BnaC03g09940D [Brassica napus]
Length=759

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G++   + R   ++  FG+T+VVKPKGKHQATIVWLHGLGDNGSSWS +LETLPLP
Sbjct  65   MSLSGAAAVGSSRNLRKAVEFGKTHVVKPKGKHQATIVWLHGLGDNGSSWSQILETLPLP  124

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFGGFPSTAWFDV +L+EN  DDV
Sbjct  125  NIKWICPTAPSQPISLFGGFPSTAWFDVVDLTENGPDDV  163



>ref|XP_007137043.1| hypothetical protein PHAVU_009G095000g [Phaseolus vulgaris]
 gb|ESW09037.1| hypothetical protein PHAVU_009G095000g [Phaseolus vulgaris]
Length=258

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  SS+ S   ++ R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLP
Sbjct  1    MSYNSSSMTSGSGSSRRAFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGGFP TAWFDV E+SE+A  D+
Sbjct  61   NIKWICPTAPTRPVAIFGGFPCTAWFDVGEISEDAPSDL  99



>ref|XP_006483705.1| PREDICTED: acyl-protein thioesterase 2-like, partial [Citrus 
sinensis]
Length=261

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            + + GS+   +G  + R F FGRT+VV+PKGKHQATIVWLHGL D GSSWS LLETLPLP
Sbjct  5    LVYEGSNCNISGSQSRRPFEFGRTHVVRPKGKHQATIVWLHGLSDKGSSWSQLLETLPLP  64

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGG+P TAWFDV +LSE+  DD+
Sbjct  65   NIKWICPTAPTRPVAIFGGYPCTAWFDVGDLSEDGPDDL  103



>ref|XP_006450483.1| hypothetical protein CICLE_v10009080mg [Citrus clementina]
 ref|XP_006450484.1| hypothetical protein CICLE_v10009080mg [Citrus clementina]
 ref|XP_006495291.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006495292.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR63723.1| hypothetical protein CICLE_v10009080mg [Citrus clementina]
 gb|ESR63724.1| hypothetical protein CICLE_v10009080mg [Citrus clementina]
 gb|KDO61681.1| hypothetical protein CISIN_1g022847mg [Citrus sinensis]
Length=256

 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++ +++ S G  + R F FGRT+VV+PKGKHQATIVWLHGL D GSSWS LLETLPLP
Sbjct  1    MSYSSTTMGS-GSQSRRPFEFGRTHVVRPKGKHQATIVWLHGLSDKGSSWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ +FGG+P TAWFDV +LSE+  DD+
Sbjct  60   NIKWICPTAPTRPVAIFGGYPCTAWFDVGDLSEDGPDDL  98



>gb|KHN08117.1| Acyl-protein thioesterase 2, partial [Glycine soja]
Length=254

 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLPNIKWICPTAP RP+ L
Sbjct  13   RTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPVAL  72

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFD  E+SE A  D+
Sbjct  73   FGGFPCTAWFDAGEISEEAPSDL  95



>ref|XP_006450482.1| hypothetical protein CICLE_v10009080mg [Citrus clementina]
 gb|ESR63722.1| hypothetical protein CICLE_v10009080mg [Citrus clementina]
Length=291

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  VLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLE  299
            +L   MS++ +++ S G  + R F FGRT+VV+PKGKHQATIVWLHGL D GSSWS LLE
Sbjct  31   ILLLIMSYSSTTMGS-GSQSRRPFEFGRTHVVRPKGKHQATIVWLHGLSDKGSSWSQLLE  89

Query  300  TLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            TLPLPNIKWICPTAP RP+ +FGG+P TAWFDV +LSE+  DD+
Sbjct  90   TLPLPNIKWICPTAPTRPVAIFGGYPCTAWFDVGDLSEDGPDDL  133



>gb|KDO61680.1| hypothetical protein CISIN_1g022847mg [Citrus sinensis]
Length=291

 Score =   152 bits (385),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  VLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLE  299
            +L   MS++ +++ S G  + R F FGRT+VV+PKGKHQATIVWLHGL D GSSWS LLE
Sbjct  31   ILLLIMSYSSTTMGS-GSQSRRPFEFGRTHVVRPKGKHQATIVWLHGLSDKGSSWSQLLE  89

Query  300  TLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            TLPLPNIKWICPTAP RP+ +FGG+P TAWFDV +LSE+  DD+
Sbjct  90   TLPLPNIKWICPTAPTRPVAIFGGYPCTAWFDVGDLSEDGPDDL  133



>ref|NP_001240872.1| uncharacterized protein LOC100811642 [Glycine max]
 ref|XP_006577854.1| PREDICTED: uncharacterized protein LOC100811642 isoform X1 [Glycine 
max]
 ref|XP_006577855.1| PREDICTED: uncharacterized protein LOC100811642 isoform X2 [Glycine 
max]
 gb|ACU23141.1| unknown [Glycine max]
Length=258

 Score =   151 bits (381),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLPNIKWICPTAP RP+ L
Sbjct  17   RTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPVAL  76

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFD  E+SE A  D+
Sbjct  77   FGGFPCTAWFDAGEISEEAPSDL  99



>ref|XP_010493100.1| PREDICTED: acyl-protein thioesterase 2 [Camelina sativa]
Length=252

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G++V S GR   R+  FG+T+VVKPKGKHQATIVWLHGLGD GSSWS + ETLPLP
Sbjct  1    MSISGAAVGS-GRNIRRAVEFGKTHVVKPKGKHQATIVWLHGLGDVGSSWSQMFETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +P++LFGG P+TAWFDV  +SEN  DD+
Sbjct  60   NIKWICPTAPSQPVSLFGGMPATAWFDVVGISENGPDDM  98



>ref|XP_010454302.1| PREDICTED: acyl-protein thioesterase 2-like [Camelina sativa]
Length=252

 Score =   150 bits (380),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G++V S GR   R+  FG+T+VVKPKGKHQATIVWLHGLGD GSSWS + ETLPLP
Sbjct  1    MSISGAAVGS-GRNIRRAVEFGKTHVVKPKGKHQATIVWLHGLGDVGSSWSQMFETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +P++LFGG P+TAWFDV  +SEN  DD+
Sbjct  60   NIKWICPTAPSQPVSLFGGMPATAWFDVVGISENGPDDM  98



>ref|XP_003526419.1| PREDICTED: acyl-protein thioesterase 2-like [Glycine max]
 gb|KHN07092.1| Acyl-protein thioesterase 2 [Glycine soja]
Length=258

 Score =   150 bits (380),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLPNIKWICPTAP RP+ L
Sbjct  17   RTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPVAL  76

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFD  E+SE+A  D+
Sbjct  77   FGGFPCTAWFDAGEISEDAPIDL  99



>ref|XP_002515548.1| Acyl-protein thioesterase, putative [Ricinus communis]
 gb|EEF46997.1| Acyl-protein thioesterase, putative [Ricinus communis]
Length=255

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            ++F FGRT+VV+PKG+HQATIVWLHGLGD GSSWS LLETLPLPNIKWICPTAP RP+++
Sbjct  17   KTFEFGRTHVVRPKGQHQATIVWLHGLGDKGSSWSQLLETLPLPNIKWICPTAPTRPVSI  76

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFDV ++SE+A DD+
Sbjct  77   FGGFPCTAWFDVADISEDAPDDL  99



>gb|ACG39837.1| acyl-protein thioesterase 2 [Zea mays]
Length=255

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+ GSS  + G  A R F +GRT+V++PKG H+ATIVWLHGLGDNG+SWS LLETLPLP
Sbjct  1    MSYGGSSSLAPG--AKRPFEYGRTHVLRPKGTHKATIVWLHGLGDNGTSWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWI PTAP RP++LFGGFP TAWFDV +LSE+A DD 
Sbjct  59   NIKWIXPTAPSRPVSLFGGFPCTAWFDVADLSEDAPDDT  97



>ref|XP_004291485.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459208.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=256

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+   +  S  RT GR   FGRT+VV+PKG HQATIVWLHGLGD GSSWS LLETLPLP
Sbjct  1    MSYNNPNTGSGSRT-GR-LEFGRTHVVRPKGTHQATIVWLHGLGDKGSSWSQLLETLPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+ LFGGFP TAWFD+ ++SE+A DD+
Sbjct  59   NIKWICPTAPSRPVALFGGFPCTAWFDMGDISEDAPDDM  97



>ref|XP_009403010.1| PREDICTED: acyl-protein thioesterase 2-like [Musa acuminata subsp. 
malaccensis]
Length=258

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSF-NFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPL  311
            M   GSS AS  R+A R   ++GRTYVV+PKG+H+ATIVWLHGLGDNG+SW  LLETLPL
Sbjct  1    MYRGGSSYASGSRSATRRHVDYGRTYVVRPKGRHRATIVWLHGLGDNGASWYQLLETLPL  60

Query  312  PNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            PNIKWICPTAP RP+ LFGGFP TAWFDV + S++  DD 
Sbjct  61   PNIKWICPTAPTRPVALFGGFPCTAWFDVADPSQDGPDDA  100



>ref|XP_010322679.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Solanum 
lycopersicum]
Length=240

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  186  SFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLF  365
            +F FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLE+LPLPNIKWICPTAP RP+ + 
Sbjct  2    TFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLPNIKWICPTAPTRPVAIL  61

Query  366  GGFPSTAWFDVNELSENAIDD  428
            GGFP TAWFDV ELS++  DD
Sbjct  62   GGFPCTAWFDVGELSDDGPDD  82



>ref|XP_006645555.1| PREDICTED: acyl-protein thioesterase 2-like [Oryza brachyantha]
Length=256

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            +   +GRT+VV+PKG H+ATIVWLHGLGDNG+SWS LLETLPLPNIKWICPTAP RP+ +
Sbjct  15   KRLEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLPNIKWICPTAPTRPVAV  74

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFPSTAWFDV +LSE+A DDV
Sbjct  75   FGGFPSTAWFDVADLSEDAPDDV  97



>gb|EPS73326.1| hypothetical protein M569_01428, partial [Genlisea aurea]
Length=245

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 73/91 (80%), Gaps = 3/91 (3%)
 Frame = +3

Query  165  AGRTAGR---SFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICP  335
            +G   GR   SF FGRTYVVKPKGKH ATIVWLHGLGDNGSSWS LLETLPLPNIKWICP
Sbjct  1    SGSRMGRRTTSFEFGRTYVVKPKGKHLATIVWLHGLGDNGSSWSQLLETLPLPNIKWICP  60

Query  336  TAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            TAP RP+ L GGFP TAWFD  ELSE   DD
Sbjct  61   TAPTRPVALLGGFPCTAWFDAGELSEEYPDD  91



>ref|XP_011040013.1| PREDICTED: acyl-protein thioesterase 2 isoform X2 [Populus euphratica]
Length=213

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  153  SVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWIC  332
            S+ S  R A R+F FGRT VV+P+GKHQATIVWLHGLGDNGSS S LLE LPLPN+KWIC
Sbjct  8    SMGSGSRPARRNFEFGRTCVVRPQGKHQATIVWLHGLGDNGSSCSQLLENLPLPNVKWIC  67

Query  333  PTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            PTAP RP+ L GGFP TAWFDV E+SE + DD
Sbjct  68   PTAPTRPVALLGGFPCTAWFDVGEISEESPDD  99



>emb|CAN77362.1| hypothetical protein VITISV_011037 [Vitis vinifera]
Length=350

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  138  SFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPN  317
            S++  S+ S  RTA R+F FGRT+VV+PKGKHQATIVWLHGLGDNGSSWS LLE LPL N
Sbjct  106  SYSNHSMGSGSRTARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLENLPLXN  165

Query  318  IKWICPTAPQRPITLFGGFPSTAWFDVNELS  410
            IKWICPTAP RP+ + GGFP TAWFDV ELS
Sbjct  166  IKWICPTAPTRPVAVLGGFPCTAWFDVGELS  196



>gb|KCW53795.1| hypothetical protein EUGRSUZ_J03039 [Eucalyptus grandis]
Length=216

 Score =   147 bits (372),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  168  GRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQ  347
            GRTA R+F FGRT+VV+P+GKHQATIVWLHGLGDNGSS S  LE+L LPN+KWICPTAP 
Sbjct  12   GRTARRTFEFGRTHVVRPRGKHQATIVWLHGLGDNGSSLSQHLESLSLPNVKWICPTAPT  71

Query  348  RPITLFGGFPSTAWFDVNELSENAIDD  428
            RP+ L GGFP TAWFDV E+SE++ DD
Sbjct  72   RPVALLGGFPCTAWFDVREISEDSPDD  98



>ref|XP_010033922.1| PREDICTED: acyl-protein thioesterase 1 isoform X1 [Eucalyptus 
grandis]
Length=278

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  129  EGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLP  308
             GMS+   S +S GRTA R+F FGRT+VV+P+GKHQATIVWLHGLGDNGSS S  LE+L 
Sbjct  21   RGMSYQQQSSSSGGRTARRTFEFGRTHVVRPRGKHQATIVWLHGLGDNGSSLSQHLESLS  80

Query  309  LPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            LPN+KWICPTAP RP+ L GGFP TAWFDV E+SE++ DD
Sbjct  81   LPNVKWICPTAPTRPVALLGGFPCTAWFDVREISEDSPDD  120



>ref|XP_003603430.1| Acyl-protein thioesterase [Medicago truncatula]
 gb|AES73681.1| acyl thioesterase-like protein [Medicago truncatula]
Length=258

 Score =   148 bits (374),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R+F FGRT+VV+PKGKHQATIVWLHG+GDNGSSWS LLETLPLPNIKWICPTAP RP+ L
Sbjct  17   RTFEFGRTHVVRPKGKHQATIVWLHGIGDNGSSWSQLLETLPLPNIKWICPTAPTRPVAL  76

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAW DV ++SE+A +D+
Sbjct  77   FGGFPCTAWSDVGDISEDAPNDL  99



>ref|XP_010420838.1| PREDICTED: acyl-protein thioesterase 2-like [Camelina sativa]
 ref|XP_010420840.1| PREDICTED: acyl-protein thioesterase 2-like [Camelina sativa]
Length=252

 Score =   148 bits (374),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G++V S GR   ++  FG+T+VVKPKGKHQATIVWLHGLGD GSSWS + ETLPLP
Sbjct  1    MSISGAAVGS-GRNIRKAVEFGKTHVVKPKGKHQATIVWLHGLGDVGSSWSQMFETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKW+CPTAP +P++LFGG P+TAWFDV  +SEN  DD+
Sbjct  60   NIKWLCPTAPSQPVSLFGGMPATAWFDVVGISENGPDDM  98



>emb|CDX88861.1| BnaA03g07880D [Brassica napus]
Length=1405

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G++   + R   ++  FG+T+VV+PKGK+QATIVWLHGLGDNGSSWS +LETLPLP
Sbjct  378  MSLSGAAAVGSSRNLRKAVEFGKTHVVRPKGKNQATIVWLHGLGDNGSSWSQILETLPLP  437

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFGGFPSTAWFDV +L+EN  DDV
Sbjct  438  NIKWICPTAPSQPISLFGGFPSTAWFDVVDLTENGPDDV  476



>ref|XP_007135729.1| hypothetical protein PHAVU_010G153400g [Phaseolus vulgaris]
 gb|ESW07723.1| hypothetical protein PHAVU_010G153400g [Phaseolus vulgaris]
Length=256

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+    + S  RTA RS  FG+T+VV+PKGKHQATIVWLHGLGDNG S   LLE+LPLP
Sbjct  1    MSYAHYHMGSGSRTARRSLEFGKTHVVRPKGKHQATIVWLHGLGDNGLSSYQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+T+ GGF  TAWFD+ ELSE+  DD
Sbjct  61   NIKWICPTAPTRPVTILGGFSCTAWFDMGELSEDGPDD  98



>ref|XP_002304161.1| phospholipase/carboxylesterase family protein [Populus trichocarpa]
 gb|EEE79140.1| phospholipase/carboxylesterase family protein [Populus trichocarpa]
Length=258

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  153  SVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWIC  332
            S+ S  R A R+F FGRT VV+P+GKHQATIVWLHGLGDNGSS S LLE LPLPN+KWIC
Sbjct  8    SMGSGSRPARRNFEFGRTCVVRPQGKHQATIVWLHGLGDNGSSCSQLLENLPLPNVKWIC  67

Query  333  PTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            PTAP RP+ L GGFP TAWFDV E+SE + DD
Sbjct  68   PTAPTRPVALLGGFPCTAWFDVGEISEESPDD  99



>ref|XP_011040012.1| PREDICTED: acyl-protein thioesterase 2 isoform X1 [Populus euphratica]
Length=258

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  153  SVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWIC  332
            S+ S  R A R+F FGRT VV+P+GKHQATIVWLHGLGDNGSS S LLE LPLPN+KWIC
Sbjct  8    SMGSGSRPARRNFEFGRTCVVRPQGKHQATIVWLHGLGDNGSSCSQLLENLPLPNVKWIC  67

Query  333  PTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            PTAP RP+ L GGFP TAWFDV E+SE + DD
Sbjct  68   PTAPTRPVALLGGFPCTAWFDVGEISEESPDD  99



>ref|XP_008350420.1| PREDICTED: acyl-protein thioesterase 2-like [Malus domestica]
 ref|XP_008350421.1| PREDICTED: acyl-protein thioesterase 2-like [Malus domestica]
Length=256

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+T S+++S  RTA R   FGRT+VV+PKGKHQAT+VWLHGLGDNGSS S +LE+LPLP
Sbjct  1    MSYTHSNMSSGSRTAKR-IEFGRTHVVRPKGKHQATMVWLHGLGDNGSSTSQMLESLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWF++ ELS++  DD
Sbjct  60   NIKWICPTAPTRPVAVLGGFPCTAWFEMGELSDDGPDD  97



>ref|XP_010033923.1| PREDICTED: acyl-protein thioesterase 1 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010033924.1| PREDICTED: acyl-protein thioesterase 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW53794.1| hypothetical protein EUGRSUZ_J03039 [Eucalyptus grandis]
Length=256

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  168  GRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQ  347
            GRTA R+F FGRT+VV+P+GKHQATIVWLHGLGDNGSS S  LE+L LPN+KWICPTAP 
Sbjct  12   GRTARRTFEFGRTHVVRPRGKHQATIVWLHGLGDNGSSLSQHLESLSLPNVKWICPTAPT  71

Query  348  RPITLFGGFPSTAWFDVNELSENAIDD  428
            RP+ L GGFP TAWFDV E+SE++ DD
Sbjct  72   RPVALLGGFPCTAWFDVREISEDSPDD  98



>ref|XP_004302945.1| PREDICTED: acyl-protein thioesterase 2 [Fragaria vesca subsp. 
vesca]
Length=257

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+++S  RTA R+  FGRT+VV+PKGKHQAT+VWLHGLGDNGSS S LLE+L LP
Sbjct  1    MSYLRSNMSSGSRTARRTLEFGRTHVVRPKGKHQATMVWLHGLGDNGSSASQLLESLSLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GG+  TAWF+V ELSE+  DD
Sbjct  61   NIKWICPTAPTRPVAILGGYSCTAWFEVGELSEDGPDD  98



>ref|XP_006305405.1| hypothetical protein CARUB_v10009797mg, partial [Capsella rubella]
 gb|EOA38303.1| hypothetical protein CARUB_v10009797mg, partial [Capsella rubella]
Length=315

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +3

Query  123  LFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLET  302
            L + MS++  S+AS  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+
Sbjct  57   LEQQMSYSRQSMASGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMES  115

Query  303  LPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            L LPNIKWICPTAP RP+T  GGF  TAWFDV E+SE+  DD
Sbjct  116  LRLPNIKWICPTAPSRPVTSLGGFTCTAWFDVGEISEDGHDD  157



>ref|XP_003531704.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Glycine 
max]
 gb|KHN47783.1| Acyl-protein thioesterase 2 [Glycine soja]
Length=256

 Score =   146 bits (369),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+    + S  RTA RS  FG+T+VV+PKGKHQATIVWLHGLGDNG S   LLE+LPLP
Sbjct  1    MSYPHYHMGSGSRTARRSLEFGKTHVVRPKGKHQATIVWLHGLGDNGLSSYQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+T+ GGF  TAWFD+ ELSE+  DD
Sbjct  61   NIKWICPTAPTRPVTILGGFSCTAWFDMGELSEDGPDD  98



>gb|AAD55595.1|AC008016_5 F6D8.5 [Arabidopsis thaliana]
Length=195

 Score =   144 bits (364),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+++L LP
Sbjct  1    MSYSHQSMGSGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMDSLHLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+T  GGF  TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPSRPVTSLGGFTCTAWFDVGEISEDGHDDL  98



>gb|KEH37960.1| acyl-protein thioesterase [Medicago truncatula]
Length=248

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 79/99 (80%), Gaps = 9/99 (9%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF  SSV   GR+A  ++ FGRTYVV+PKGKHQATIVWLHGLGDNGSSWS LLET+PLP
Sbjct  1    MSFAASSVG--GRSAATAYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLETIPLP  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++LFG       FDV ELSE A DD+
Sbjct  59   NIKWICPTAPTRPMSLFG-------FDVAELSEEAPDDL  90



>ref|XP_011084000.1| PREDICTED: acyl-protein thioesterase 2-like [Sesamum indicum]
 ref|XP_011084064.1| PREDICTED: acyl-protein thioesterase 2-like [Sesamum indicum]
Length=239

 Score =   145 bits (365),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  195  FGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGGF  374
            FGRT+VV+PKG HQATIVWLHGLGD GSSWS LLETLPLPNIKWICPTAP RP++LFGGF
Sbjct  5    FGRTHVVRPKGTHQATIVWLHGLGDKGSSWSQLLETLPLPNIKWICPTAPTRPVSLFGGF  64

Query  375  PSTAWFDVNELSENAIDDV  431
            PSTAWFD  ++SE+A DD+
Sbjct  65   PSTAWFDAVDVSEDAPDDL  83



>ref|XP_007013823.1| Acyl-protein thioesterase 2 [Theobroma cacao]
 gb|EOY31442.1| Acyl-protein thioesterase 2 [Theobroma cacao]
Length=249

 Score =   145 bits (366),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  162  SAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTA  341
            S+G    R+F FGRT+VV+PKG HQATI+WLHGLGD GSSWS LLETLPLPNIKWICPTA
Sbjct  2    SSGSGTTRTFEFGRTHVVRPKGNHQATIIWLHGLGDKGSSWSQLLETLPLPNIKWICPTA  61

Query  342  PQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            P RP+ +FGG P TAWFDV +LS +  DD+
Sbjct  62   PTRPVAIFGGHPCTAWFDVGDLSGDGPDDL  91



>ref|XP_008377618.1| PREDICTED: acyl-protein thioesterase 2 [Malus domestica]
Length=257

 Score =   145 bits (366),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +3

Query  138  SFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPN  317
            S+T S+++S  RTA R   FGRT+VV+PKGKHQAT+VWLHGLGDNGSS S +LE+LPLPN
Sbjct  3    SYTHSNMSSGSRTA-RRIEFGRTHVVRPKGKHQATMVWLHGLGDNGSSTSQMLESLPLPN  61

Query  318  IKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            IKWICPTAP+RP+ + GGF  TAWF V ELSE+  DD
Sbjct  62   IKWICPTAPKRPVAMLGGFACTAWFAVGELSEDGPDD  98



>ref|XP_011081941.1| PREDICTED: acyl-protein thioesterase 2-like [Sesamum indicum]
 ref|XP_011081942.1| PREDICTED: acyl-protein thioesterase 2-like [Sesamum indicum]
 ref|XP_011081943.1| PREDICTED: acyl-protein thioesterase 2-like [Sesamum indicum]
Length=253

 Score =   145 bits (366),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF  S  A   +T+   F FGRT+VV+PKG+HQATIVWLHGLGD GSSWS LLE+LPL 
Sbjct  1    MSFNIS--AGGSQTSRTMFEFGRTHVVRPKGRHQATIVWLHGLGDKGSSWSQLLESLPLQ  58

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            N+KWICPTAP RP++LFGGFP TAWFD  +++E+A DD+
Sbjct  59   NVKWICPTAPTRPVSLFGGFPCTAWFDAQDITEDAPDDL  97



>ref|XP_006392878.1| hypothetical protein EUTSA_v10011726mg [Eutrema salsugineum]
 gb|ESQ30164.1| hypothetical protein EUTSA_v10011726mg [Eutrema salsugineum]
Length=255

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LP
Sbjct  1    MSYSHQSMGSGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLHLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++  GGF  TAWFDV E+SE++ DD+
Sbjct  60   NIKWICPTAPTRPVSSLGGFTCTAWFDVGEISEDSHDDM  98



>emb|CDY72010.1| BnaC03g78050D [Brassica napus]
Length=199

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LP
Sbjct  1    MSYSHQSMGSGFRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLHLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPTRPVSSLGGFTCTAWFDVGEISEDGHDDM  98



>ref|XP_009333641.1| PREDICTED: acyl-protein thioesterase 2 [Pyrus x bretschneideri]
Length=255

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+  S+++S  RTA R   FGRT+VV+PKG+HQAT+VWLHGLGDNGSS S +LE+LPLP
Sbjct  1    MSYAHSNMSSGSRTAKR-IEFGRTHVVRPKGRHQATMVWLHGLGDNGSSTSQMLESLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+ + GGFP TAWF++ ELS++  DD
Sbjct  60   NIKWICPTAPTRPVAVLGGFPCTAWFEMGELSDDGPDD  97



>ref|XP_009107020.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like isoform 
X1 [Brassica rapa]
Length=255

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LP
Sbjct  1    MSYSHQSMGSGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLHLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPTRPVSSLGGFTCTAWFDVGEISEDGHDDM  98



>ref|NP_175679.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE32841.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=255

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+++L LP
Sbjct  1    MSYSHQSMGSGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMDSLHLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP+T  GGF  TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPSRPVTSLGGFTCTAWFDVGEISEDGHDDL  98



>ref|XP_006361514.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361515.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Solanum 
tuberosum]
Length=255

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF+GS+  S   T   S  FGRT+VV+PKGKH+ATIVWLHGLGD GSSWS LLE+ PLP
Sbjct  1    MSFSGSTAGSGSGTTRTSLEFGRTHVVRPKGKHEATIVWLHGLGDKGSSWSQLLESFPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            N+KWICPTAP RP+  FGGFP TAWFDV ++SE+A DD+
Sbjct  61   NVKWICPTAPTRPVAAFGGFPCTAWFDVGDISEDAPDDL  99



>ref|XP_004501308.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like [Cicer 
arietinum]
Length=258

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R+F FGRT+VV+PKGKHQATIVWLHG+GDNGSSWS LLE+LPL NIKWICPTAP RP+ L
Sbjct  17   RTFEFGRTHVVRPKGKHQATIVWLHGIGDNGSSWSQLLESLPLSNIKWICPTAPTRPVAL  76

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFDV ++S++A  D+
Sbjct  77   FGGFPCTAWFDVGDISDDAPIDL  99



>ref|XP_004245199.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like [Solanum 
lycopersicum]
Length=255

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MSF+GS+  S   T   S  FGRT+VV+PKGKH+ATIVWLHGLGD GSSWS LLE+ PLP
Sbjct  1    MSFSGSTAGSGSGTTRTSLEFGRTHVVRPKGKHEATIVWLHGLGDKGSSWSQLLESFPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            N+KWICPTAP RP+  FGGFP TAWFDV ++SE+A DD+
Sbjct  61   NVKWICPTAPTRPVAAFGGFPCTAWFDVGDISEDAPDDL  99



>ref|XP_010500884.1| PREDICTED: acyl-protein thioesterase 2-like isoform X3 [Camelina 
sativa]
Length=255

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LP
Sbjct  1    MSYSHQSMGSGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLRLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            N+KWICPTAP RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  60   NVKWICPTAPSRPVSSLGGFTCTAWFDVGEISEDGHDDL  98



>ref|XP_009107021.1| PREDICTED: acyl-protein thioesterase 1-like isoform X2 [Brassica 
rapa]
Length=249

 Score =   144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LP
Sbjct  1    MSYSHQSMGSGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLHLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPTRPVSSLGGFTCTAWFDVGEISEDGHDDM  98



>gb|ACU24196.1| unknown [Glycine max]
Length=256

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+    + S  RTA RS  FG+T+VV+PKGKHQATIVWLHGLGDNG S   LLE+LPLP
Sbjct  1    MSYPHYHMGSGSRTASRSLEFGKTHVVRPKGKHQATIVWLHGLGDNGLSSYQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+T+ GGF  TAWFD+ ELSE+   D
Sbjct  61   NIKWICPTAPSRPVTILGGFSCTAWFDMGELSEDGPVD  98



>ref|XP_010479784.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Camelina 
sativa]
Length=277

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +3

Query  114  LSVLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSL  293
            +  L + MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L
Sbjct  16   VGTLEQQMSYSHQSMGSGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQL  74

Query  294  LETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            +E+L LPN+KWICPTAP RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  75   MESLRLPNVKWICPTAPLRPVSSLGGFTCTAWFDVGEISEDGHDDL  120



>ref|XP_009144821.1| PREDICTED: acyl-protein thioesterase 2 [Brassica rapa]
 ref|XP_009144823.1| PREDICTED: acyl-protein thioesterase 2 [Brassica rapa]
 ref|XP_009144824.1| PREDICTED: acyl-protein thioesterase 2 [Brassica rapa]
 ref|XP_009144825.1| PREDICTED: acyl-protein thioesterase 2 [Brassica rapa]
Length=255

 Score =   144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LP
Sbjct  1    MSYSHQSMGSGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLHLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++  GG+  TAWFDV E+SE++ DD+
Sbjct  60   NIKWICPTAPTRPVSSLGGYTCTAWFDVGEISEDSHDDL  98



>ref|XP_010462117.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Camelina 
sativa]
Length=255

 Score =   144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LP
Sbjct  1    MSYSHQSMGSGSRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLRLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            N+KWICPTAP RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  60   NVKWICPTAPTRPVSSLGGFTCTAWFDVGEISEDGHDDL  98



>ref|XP_003528353.1| PREDICTED: acyl-protein thioesterase 2-like [Glycine max]
 gb|KHN01350.1| Acyl-protein thioesterase 2 [Glycine soja]
Length=256

 Score =   144 bits (362),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS+    + S  RTA RS  FG+T+VV+PKGKHQATIVWLHGLGDNG S   LLE+LPLP
Sbjct  1    MSYPHYHMGSGSRTASRSLEFGKTHVVRPKGKHQATIVWLHGLGDNGLSSYQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDD  428
            NIKWICPTAP RP+T+ GGF  TAWFD+ ELSE+   D
Sbjct  61   NIKWICPTAPSRPVTILGGFSCTAWFDMGELSEDGPVD  98



>emb|CDY02538.1| BnaA08g01450D [Brassica napus]
Length=255

 Score =   143 bits (360),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LP
Sbjct  1    MSYSHQSMGSGFRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLHLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPTRPVSSLGGFTCTAWFDVGEISEDGHDDM  98



>ref|XP_009400510.1| PREDICTED: acyl-protein thioesterase 2-like [Musa acuminata subsp. 
malaccensis]
Length=255

 Score =   143 bits (360),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +3

Query  147  GSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKW  326
            GSS  ++G T  R   FGR+YVV+PKG+HQATIVWLHGLGD G+S S L+ETLPLPNIKW
Sbjct  4    GSSSYASGATR-RPVEFGRSYVVRPKGRHQATIVWLHGLGDTGASCSHLVETLPLPNIKW  62

Query  327  ICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            ICPTAP RP+ +FGGF  TAWFD+ E+SE+  DDV
Sbjct  63   ICPTAPTRPVAMFGGFACTAWFDIGEISEDGADDV  97



>ref|XP_008775038.1| PREDICTED: acyl-protein thioesterase 2-like [Phoenix dactylifera]
Length=318

 Score =   144 bits (364),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  174  TAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRP  353
            T  RS  +GRTYVV+PKG+HQATIVWLHGLGDNG+S S LLETLPLPNIKWICPTAP RP
Sbjct  75   TTRRSLEYGRTYVVRPKGRHQATIVWLHGLGDNGASGSRLLETLPLPNIKWICPTAPTRP  134

Query  354  ITLFGGFPSTAWFDVNELSENAIDDV  431
            +  FGGFP TAWFDV EL E+   DV
Sbjct  135  VAAFGGFPCTAWFDVGELPEDGPGDV  160



>ref|XP_010061942.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like [Eucalyptus 
grandis]
 gb|KCW68988.1| hypothetical protein EUGRSUZ_F02550 [Eucalyptus grandis]
Length=257

 Score =   142 bits (359),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  186  SFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLF  365
            +  FGRTYVV+PKG+HQATIVWLHGLGDNGSSWS +L++LPLPNIKWICPTAP RP+TL 
Sbjct  18   TLEFGRTYVVRPKGRHQATIVWLHGLGDNGSSWSQVLDSLPLPNIKWICPTAPTRPVTLL  77

Query  366  GGFPSTAWFDVNELSENAIDD  428
            GGF  TAWFDV +LSE+  DD
Sbjct  78   GGFSCTAWFDVGDLSEDGPDD  98



>ref|XP_010691200.1| PREDICTED: acyl-protein thioesterase 2 [Beta vulgaris subsp. 
vulgaris]
Length=256

 Score =   142 bits (359),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S  S  R A R+F FGRT+VV+PKG+H ATIVWLHGLGDNG+S   LLE+LPLP
Sbjct  1    MSYSNYSTGSGARGARRTFEFGRTHVVRPKGRHLATIVWLHGLGDNGASACQLLESLPLP  60

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            N+K+ICPTAP R + L GGF  TAWFDV E+SE++ DD+
Sbjct  61   NVKFICPTAPTRSVALLGGFACTAWFDVTEISEDSQDDL  99



>ref|XP_006585644.1| PREDICTED: acyl-protein thioesterase 2-like isoform X3 [Glycine 
max]
Length=255

 Score =   142 bits (359),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  171  RTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQR  350
            RTA RS  FG+T+VV+PKGKHQATIVWLHGLGDNG S   LLE+LPLPNIKWICPTAP R
Sbjct  12   RTARRSLEFGKTHVVRPKGKHQATIVWLHGLGDNGLSSYQLLESLPLPNIKWICPTAPTR  71

Query  351  PITLFGGFPSTAWFDVNELSENAIDD  428
            P+T+ GGF  TAWFD+ ELSE+  DD
Sbjct  72   PVTILGGFSCTAWFDMGELSEDGPDD  97



>ref|XP_004152217.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis sativus]
Length=255

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  189  FNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFG  368
              FGRT+VV+PKGKHQATIVWLHGLGDNGSS S LLETLPLPNIKWICPTAP RP++L G
Sbjct  20   LEFGRTHVVRPKGKHQATIVWLHGLGDNGSSSSQLLETLPLPNIKWICPTAPTRPVSLLG  79

Query  369  GFPSTAWFDVNELSENAIDD  428
            GFP TAWFDV E SE   DD
Sbjct  80   GFPCTAWFDVGEFSEEGPDD  99



>ref|XP_004156814.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis sativus]
 gb|KGN52867.1| hypothetical protein Csa_4G004780 [Cucumis sativus]
Length=257

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  189  FNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFG  368
              FGRT+VV+PKGKHQATIVWLHGLGDNGSS S LLETLPLPNIKWICPTAP RP++L G
Sbjct  20   LEFGRTHVVRPKGKHQATIVWLHGLGDNGSSSSQLLETLPLPNIKWICPTAPTRPVSLLG  79

Query  369  GFPSTAWFDVNELSENAIDD  428
            GFP TAWFDV E SE   DD
Sbjct  80   GFPCTAWFDVGEFSEEGPDD  99



>emb|CDY60557.1| BnaA05g35750D [Brassica napus]
Length=255

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R A R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LP
Sbjct  1    MSYSHQSMGSGFRNA-RGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLHLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++  GG+  TAWFDV E+SE++ DD+
Sbjct  60   NIKWICPTAPTRPVSSLGGYTCTAWFDVGEISEDSHDDL  98



>gb|KDP33625.1| hypothetical protein JCGZ_07196 [Jatropha curcas]
Length=255

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            ++F FGRT+VV+P+G+HQATIVWLHGLGD GSSWS LLE   LPNIKWICPTAP RP+ L
Sbjct  17   KTFEFGRTHVVRPRGQHQATIVWLHGLGDKGSSWSQLLEAFHLPNIKWICPTAPTRPVAL  76

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFDV ++SE+A +D+
Sbjct  77   FGGFPCTAWFDVGDISEDAAEDL  99



>ref|XP_008454274.1| PREDICTED: acyl-protein thioesterase 2 [Cucumis melo]
Length=257

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  189  FNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFG  368
              FGRT+VV+PKGKHQATIVWLHGLGDNGSS S LLETLPLPNIKWICPTAP RP++L G
Sbjct  20   LEFGRTHVVRPKGKHQATIVWLHGLGDNGSSSSQLLETLPLPNIKWICPTAPTRPVSLLG  79

Query  369  GFPSTAWFDVNELSENAIDD  428
            GFP TAWFDV E SE   DD
Sbjct  80   GFPCTAWFDVGEFSEEGPDD  99



>ref|NP_001189903.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE75709.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=274

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 82/118 (69%), Gaps = 20/118 (17%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGS------------  278
            MS++  S+ S  R+  R + FGRTYVV+PKGKHQATIVWLHGLGDNGS            
Sbjct  1    MSYSRQSMGSGSRST-RGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSRILACSLITTSH  59

Query  279  -------SWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
                   S S LLE+LPLPNIKWICPTAP RP++L GGFP TAWFDV E+SE+  DD+
Sbjct  60   FGSVSFCSSSQLLESLPLPNIKWICPTAPSRPVSLLGGFPCTAWFDVGEISEDLHDDI  117



>ref|XP_006585643.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Glycine 
max]
Length=268

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  171  RTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQR  350
            RTA RS  FG+T+VV+PKGKHQATIVWLHGLGDNG S   LLE+LPLPNIKWICPTAP R
Sbjct  25   RTARRSLEFGKTHVVRPKGKHQATIVWLHGLGDNGLSSYQLLESLPLPNIKWICPTAPTR  84

Query  351  PITLFGGFPSTAWFDVNELSENAIDD  428
            P+T+ GGF  TAWFD+ ELSE+  DD
Sbjct  85   PVTILGGFSCTAWFDMGELSEDGPDD  110



>ref|XP_004969150.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like [Setaria 
italica]
Length=254

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  189  FNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFG  368
              +GRTYVV+PKG+HQATIVWLHGLGDNG+SWS LL++LPLPNIKWICPTAP RP+  FG
Sbjct  16   LEYGRTYVVRPKGRHQATIVWLHGLGDNGASWSQLLDSLPLPNIKWICPTAPTRPVAAFG  75

Query  369  GFPSTAWFDVNELSENAIDDV  431
            GFP TAWFDV E S +  DD+
Sbjct  76   GFPCTAWFDVEETSLDGRDDI  96



>ref|NP_001052156.2| Os04g0174900 [Oryza sativa Japonica Group]
 dbj|BAF14070.2| Os04g0174900 [Oryza sativa Japonica Group]
Length=126

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R   +GRTY+V+PKG+HQATIVWLHGLGDNG+SWS LL++L LPNIKWICPTA  RP+T 
Sbjct  15   RRVEYGRTYIVRPKGRHQATIVWLHGLGDNGASWSQLLDSLSLPNIKWICPTAATRPVTA  74

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFDV ++S +  DD+
Sbjct  75   FGGFPCTAWFDVEDISVDGRDDI  97



>ref|XP_003569345.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like [Brachypodium 
distachyon]
Length=249

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  192  NFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGG  371
             +GRTYVV+PKG+HQATIVWLHG+GDNGSSWS LL+ LPLPNIKWICPTAP RP+  FGG
Sbjct  12   EYGRTYVVRPKGRHQATIVWLHGIGDNGSSWSQLLDNLPLPNIKWICPTAPTRPVAAFGG  71

Query  372  FPSTAWFDVNELSENAIDDV  431
            FP TAWFDV + S +  DD+
Sbjct  72   FPCTAWFDVEDTSVDGRDDI  91



>gb|EYU29226.1| hypothetical protein MIMGU_mgv1a012792mg [Erythranthe guttata]
 gb|EYU29227.1| hypothetical protein MIMGU_mgv1a012792mg [Erythranthe guttata]
 gb|EYU29228.1| hypothetical protein MIMGU_mgv1a012792mg [Erythranthe guttata]
Length=239

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  186  SFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLF  365
            +F FGRT+VV+PKG H+ATIVWLHGLGD GSSWS +LE LPL N+KWICPTAP RP++LF
Sbjct  2    TFEFGRTHVVRPKGTHKATIVWLHGLGDKGSSWSQILENLPLQNVKWICPTAPTRPVSLF  61

Query  366  GGFPSTAWFDVNELSENAIDDV  431
            GGFPSTAWFD  ++S++A DD+
Sbjct  62   GGFPSTAWFDAQDISDDAPDDL  83



>ref|NP_001043556.1| Os01g0612500 [Oryza sativa Japonica Group]
 dbj|BAD61215.1| lysophospholipase 2-like [Oryza sativa Japonica Group]
 dbj|BAD61505.1| lysophospholipase 2-like [Oryza sativa Japonica Group]
 dbj|BAF05470.1| Os01g0612500 [Oryza sativa Japonica Group]
 dbj|BAG91270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=243

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  192  NFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGG  371
             +GRTYVV+PKG+HQATIVWLHGLGDNG+SWS LL++LPLPNIKWICPTAP RP+  FGG
Sbjct  17   EYGRTYVVRPKGRHQATIVWLHGLGDNGASWSQLLDSLPLPNIKWICPTAPTRPVAAFGG  76

Query  372  FPSTAWFDVNELSENAIDDV  431
            FP TAWFDV + S +  DD+
Sbjct  77   FPCTAWFDVEDTSVDGRDDI  96



>gb|EEE54977.1| hypothetical protein OsJ_02584 [Oryza sativa Japonica Group]
Length=254

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  192  NFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGG  371
             +GRTYVV+PKG+HQATIVWLHGLGDNG+SWS LL++LPLPNIKWICPTAP RP+  FGG
Sbjct  17   EYGRTYVVRPKGRHQATIVWLHGLGDNGASWSQLLDSLPLPNIKWICPTAPTRPVAAFGG  76

Query  372  FPSTAWFDVNELSENAIDDV  431
            FP TAWFDV + S +  DD+
Sbjct  77   FPCTAWFDVEDTSVDGRDDI  96



>ref|XP_006652102.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like [Oryza 
brachyantha]
Length=254

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R   +GRTYVV+PKG+HQATIVWLHGLGDNG+SWS LL++L LPNIKWICPTA  RP+T 
Sbjct  15   RRVEYGRTYVVRPKGRHQATIVWLHGLGDNGASWSQLLDSLSLPNIKWICPTAATRPVTA  74

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFDV+++S +  DD+
Sbjct  75   FGGFPCTAWFDVDDISVDGHDDI  97



>ref|XP_009763809.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=277

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  96   NCSNSLLSVLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNG  275
            N S   +S L   MS+   S+ S  RTA R+  FGRTYVV+PKGKHQATI+WLHGLGDNG
Sbjct  8    NYSEGWVSFLKADMSYMNPSMGSGSRTARRALEFGRTYVVRPKGKHQATIIWLHGLGDNG  67

Query  276  SSWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            SS S LLE+L  PNIKWICPTAP RP+ + GGFP TAWFD  ELS++  DD+
Sbjct  68   SSSSQLLESLSTPNIKWICPTAPTRPVAMLGGFPCTAWFDAGELSDDTTDDL  119



>ref|XP_009603471.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=296

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 93/139 (67%), Gaps = 2/139 (1%)
 Frame = +3

Query  15   HN*DFLRTGESEALRKLHVIEISGEIYNCSNSLLSVLFEGMSFTGSSVASAGRTAGRSFN  194
            +N  FL  G    L+      ++ + Y  S   +S L   MS+   S+ S  RTA R+  
Sbjct  2    YNNVFLGGGSRHNLQLFLTYLVAFQKY--SEGCVSFLKADMSYMNPSMGSGSRTARRTLE  59

Query  195  FGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGGF  374
            FGRTYVV+PKGKHQATI+WLHGLGDNGSS S LLE+L  PNIKWICPTAP RP+ + GGF
Sbjct  60   FGRTYVVRPKGKHQATIIWLHGLGDNGSSSSQLLESLSTPNIKWICPTAPTRPVAMLGGF  119

Query  375  PSTAWFDVNELSENAIDDV  431
            P TAWFD  ELS++  DD+
Sbjct  120  PCTAWFDAGELSDDTTDDL  138



>gb|EEC76867.1| hypothetical protein OsI_15057 [Oryza sativa Indica Group]
Length=254

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R   +GRTY+V+PKG+HQATIVWLHGLGDNG+SWS LL++L LPNIKWICPTA  RP+T 
Sbjct  15   RRVEYGRTYIVRPKGRHQATIVWLHGLGDNGASWSQLLDSLSLPNIKWICPTAATRPVTA  74

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFDV ++S +  DD+
Sbjct  75   FGGFPCTAWFDVEDISVDGRDDI  97



>dbj|BAH00877.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60604.1| hypothetical protein OsJ_14006 [Oryza sativa Japonica Group]
Length=254

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R   +GRTY+V+PKG+HQATIVWLHGLGDNG+SWS LL++L LPNIKWICPTA  RP+T 
Sbjct  15   RRVEYGRTYIVRPKGRHQATIVWLHGLGDNGASWSQLLDSLSLPNIKWICPTAATRPVTA  74

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFDV ++S +  DD+
Sbjct  75   FGGFPCTAWFDVEDISVDGRDDI  97



>ref|XP_006406938.1| hypothetical protein EUTSA_v10021374mg [Eutrema salsugineum]
 ref|XP_006406939.1| hypothetical protein EUTSA_v10021374mg [Eutrema salsugineum]
 gb|ESQ48391.1| hypothetical protein EUTSA_v10021374mg [Eutrema salsugineum]
 gb|ESQ48392.1| hypothetical protein EUTSA_v10021374mg [Eutrema salsugineum]
Length=255

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R+A R + FGRTYVV+PKGKHQATIVWLHGLGDNGSS S LLE+LPLP
Sbjct  1    MSYSHQSMGSGSRSA-RGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSSSQLLESLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++L GGFP TAWFDV E+SEN  DDV
Sbjct  60   NIKWICPTAPSRPVSLLGGFPCTAWFDVGEISENLHDDV  98



>ref|XP_009763808.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Nicotiana 
sylvestris]
Length=290

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  96   NCSNSLLSVLFEGMSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNG  275
            N S   +S L   MS+   S+ S  RTA R+  FGRTYVV+PKGKHQATI+WLHGLGDNG
Sbjct  21   NYSEGWVSFLKADMSYMNPSMGSGSRTARRALEFGRTYVVRPKGKHQATIIWLHGLGDNG  80

Query  276  SSWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            SS S LLE+L  PNIKWICPTAP RP+ + GGFP TAWFD  ELS++  DD+
Sbjct  81   SSSSQLLESLSTPNIKWICPTAPTRPVAMLGGFPCTAWFDAGELSDDTTDDL  132



>ref|XP_009603470.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=304

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +3

Query  27   FLRTGESEALRKLHVIEISGEIYNCSNSLLSVLFEGMSFTGSSVASAGRTAGRSFNFGRT  206
            FL  G    L+      ++ + Y  S   +S L   MS+   S+ S  RTA R+  FGRT
Sbjct  14   FLGGGSRHNLQLFLTYLVAFQKY--SEGCVSFLKADMSYMNPSMGSGSRTARRTLEFGRT  71

Query  207  YVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTA  386
            YVV+PKGKHQATI+WLHGLGDNGSS S LLE+L  PNIKWICPTAP RP+ + GGFP TA
Sbjct  72   YVVRPKGKHQATIIWLHGLGDNGSSSSQLLESLSTPNIKWICPTAPTRPVAMLGGFPCTA  131

Query  387  WFDVNELSENAIDDV  431
            WFD  ELS++  DD+
Sbjct  132  WFDAGELSDDTTDDL  146



>ref|XP_006644361.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like [Oryza 
brachyantha]
Length=254

 Score =   138 bits (347),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  192  NFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGG  371
             +GRTYVV+PKG+HQATIVWLHGLGDNG+SWS LL++LPLPNIKWICPTAP R +  FGG
Sbjct  17   EYGRTYVVRPKGRHQATIVWLHGLGDNGASWSQLLDSLPLPNIKWICPTAPTRAVAAFGG  76

Query  372  FPSTAWFDVNELSENAIDDV  431
            FP TAWFDV + S +  DD+
Sbjct  77   FPCTAWFDVEDTSVDGRDDI  96



>ref|XP_010500881.1| PREDICTED: acyl-protein thioesterase 2-like isoform X1 [Camelina 
sativa]
Length=266

 Score =   138 bits (348),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  TGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIK  323
            +G  +  +G    R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LPN+K
Sbjct  14   SGLCLDVSGSRNARGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLRLPNVK  73

Query  324  WICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            WICPTAP RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  74   WICPTAPSRPVSSLGGFTCTAWFDVGEISEDGHDDL  109



>ref|XP_010500882.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Camelina 
sativa]
Length=263

 Score =   138 bits (347),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  TGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIK  323
            +G  +  +G    R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LPN+K
Sbjct  14   SGLCLDVSGSRNARGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLRLPNVK  73

Query  324  WICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            WICPTAP RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  74   WICPTAPSRPVSSLGGFTCTAWFDVGEISEDGHDDL  109



>ref|XP_010462118.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Camelina 
sativa]
Length=246

 Score =   137 bits (346),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  168  GRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQ  347
            G    R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LPN+KWICPTAP 
Sbjct  2    GSRNARGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLRLPNVKWICPTAPT  61

Query  348  RPITLFGGFPSTAWFDVNELSENAIDDV  431
            RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  62   RPVSSLGGFTCTAWFDVGEISEDGHDDL  89



>gb|KFK35776.1| hypothetical protein AALP_AA4G034500 [Arabis alpina]
Length=246

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  168  GRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQ  347
            G    R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+++L LPNIKWICPTAP 
Sbjct  2    GSRNARGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMDSLQLPNIKWICPTAPT  61

Query  348  RPITLFGGFPSTAWFDVNELSENAIDDV  431
            RP++  GGF  TAWFDV E+SE++ DD+
Sbjct  62   RPVSSLGGFTCTAWFDVGEISEDSHDDL  89



>ref|XP_010479785.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Camelina 
sativa]
Length=246

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  168  GRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQ  347
            G    R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LPN+KWICPTAP 
Sbjct  2    GSRNARGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLRLPNVKWICPTAPL  61

Query  348  RPITLFGGFPSTAWFDVNELSENAIDDV  431
            RP++  GGF  TAWFDV E+SE+  DD+
Sbjct  62   RPVSSLGGFTCTAWFDVGEISEDGHDDL  89



>ref|XP_002455943.1| hypothetical protein SORBIDRAFT_03g027720 [Sorghum bicolor]
 gb|EES01063.1| hypothetical protein SORBIDRAFT_03g027720 [Sorghum bicolor]
Length=227

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  195  FGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGGF  374
            +GRTYVV+PKG+H ATIVWLHGLGDNGSSWS LL++LPLPN+KWICPTAP RP+  FGGF
Sbjct  18   YGRTYVVRPKGRHLATIVWLHGLGDNGSSWSQLLDSLPLPNVKWICPTAPTRPVAAFGGF  77

Query  375  PSTAWFDVNELSENAIDDV  431
            P TAWFDV+E S +   DV
Sbjct  78   PCTAWFDVDETSLDGHADV  96



>ref|XP_010670669.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=237

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  186  SFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLF  365
            +  FG T+VVKPKGKHQATIVWLHG+GD G SWS LLET PLPNIKWICPTAP RP+ L 
Sbjct  24   NLEFGATHVVKPKGKHQATIVWLHGMGDKGLSWSQLLETFPLPNIKWICPTAPTRPVALL  83

Query  366  GGFPSTAWFDVNELSENAIDDV  431
            GGFP T+WFDV ++SE+  DD+
Sbjct  84   GGFPCTSWFDVEDVSESGSDDL  105



>ref|XP_009126416.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Brassica 
rapa]
Length=245

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 8/99 (8%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS +G+++ S GR  GR+  FG+T+VV+PKGKHQATIVWLHGLGDNGSSWS LLETLPLP
Sbjct  1    MSISGAALGS-GRILGRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP +PI+LFG       FDV  ++E+  DDV
Sbjct  60   NIKWICPTAPSQPISLFG-------FDVVGINEDGPDDV  91



>gb|ACG37850.1| hypothetical protein [Zea mays]
Length=233

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  213  VKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGGFPSTAWF  392
            V+PKG H+ATIVWLHGLGDNG+SWS LLETLPLPNIKWICPTAP RP+++FGGFPSTAWF
Sbjct  3    VRPKGTHKATIVWLHGLGDNGASWSQLLETLPLPNIKWICPTAPSRPVSVFGGFPSTAWF  62

Query  393  DVNELSENAIDDV  431
            DV +LSE+A DD+
Sbjct  63   DVADLSEDAPDDI  75



>ref|XP_008675489.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like [Zea mays]
 tpg|DAA58948.1| TPA: hypothetical protein ZEAMMB73_749417 [Zea mays]
Length=249

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  192  NFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGG  371
             +GRTYVV+PKG+HQATIVWLHG+GDNG SWS LL++LPLPN+KWICPTAP RP+  FGG
Sbjct  17   EYGRTYVVRPKGRHQATIVWLHGIGDNGGSWSQLLDSLPLPNVKWICPTAPTRPVAAFGG  76

Query  372  FPSTAWFDVNELSENAIDDV  431
            FP TAWFDV+E S +   D+
Sbjct  77   FPCTAWFDVDETSLDGHADI  96



>ref|XP_010487396.1| PREDICTED: acyl-protein thioesterase 2-like [Camelina sativa]
Length=255

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R+A R + FGRTYVV+PKGKHQATIVWLHGLGDNGSS S LLE+LPLP
Sbjct  1    MSYSHQSMGSGSRSA-RGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSSSQLLESLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++L GGFP TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPSRPVSLLGGFPCTAWFDVGEISEDLHDDI  98



>ref|XP_006654857.1| PREDICTED: acyl-protein thioesterase 2-like [Oryza brachyantha]
Length=254

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            +   +GRTYVV+PKG+HQATI+WLHGLGDNG+SWS LL++LPLP+IKWICPTA  RP+T 
Sbjct  15   QRVEYGRTYVVRPKGRHQATILWLHGLGDNGASWSQLLDSLPLPSIKWICPTAATRPVTA  74

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP TAWFDV + S +  DD+
Sbjct  75   FGGFPCTAWFDVEDTSVDGRDDI  97



>ref|XP_009403127.1| PREDICTED: acyl-protein thioesterase 2-like [Musa acuminata subsp. 
malaccensis]
Length=256

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  RSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITL  362
            R  ++GRTYV  PKG+H+AT+VWLHGLGDNG+SW  LLETLPLPNIKWICPTAP RP++L
Sbjct  16   RHVDYGRTYVAWPKGRHRATVVWLHGLGDNGASWYQLLETLPLPNIKWICPTAPTRPVSL  75

Query  363  FGGFPSTAWFDVNELSENAIDDV  431
            FGGFP  AWFD+ + S++  DD 
Sbjct  76   FGGFPCAAWFDIADPSQDGPDDA  98



>ref|XP_010670667.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670668.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=244

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  186  SFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLF  365
            +  FG T+VVKPKGKHQATIVWLHG+GD G SWS LLET PLPNIKWICPTAP RP+ L 
Sbjct  3    NLEFGATHVVKPKGKHQATIVWLHGMGDKGLSWSQLLETFPLPNIKWICPTAPTRPVALL  62

Query  366  GGFPSTAWFDVNELSENAIDDV  431
            GGFP T+WFDV ++SE+  DD+
Sbjct  63   GGFPCTSWFDVEDVSESGSDDL  84



>ref|XP_009146212.1| PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Brassica 
rapa]
Length=255

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R+A R + FGRTYVV+PKGKHQATIVWLHGLGDNGSS S LLE+LPLP
Sbjct  1    MSYSHQSMGSGSRSA-RGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSSSQLLESLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++L GGFP TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPSRPVSLLGGFPCTAWFDVGEISEDLQDDI  98



>emb|CDY62011.1| BnaCnng38960D [Brassica napus]
Length=293

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  168  GRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQ  347
            G    R + FGRTYVV+PKGKHQAT+VWLHGLGDNGSS S L+E+L LPNIKWICPTAP 
Sbjct  49   GSRNARGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMESLHLPNIKWICPTAPT  108

Query  348  RPITLFGGFPSTAWFDVNELSENAIDDV  431
            RP++  GG+  TAWFDV E+SE++ DD+
Sbjct  109  RPVSSLGGYTCTAWFDVGEISEDSHDDL  136



>ref|XP_006298382.1| hypothetical protein CARUB_v10014451mg [Capsella rubella]
 gb|EOA31280.1| hypothetical protein CARUB_v10014451mg [Capsella rubella]
Length=255

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R+A R + FGRTYVV+PKGKHQATIVWLHGLGDNGSS S LLE+LPLP
Sbjct  1    MSYSHQSMGSGSRSA-RGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSSSQLLESLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++L GGFP TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPSRPVSLLGGFPCTAWFDVGEISEDLHDDI  98



>gb|EEC71077.1| hypothetical protein OsI_02836 [Oryza sativa Indica Group]
Length=254

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  192  NFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLFGG  371
             +GRTYVV+PKG+HQATIVWLHGLGDNG+SWS LL +LPLPNIKWICPTAP R +  FGG
Sbjct  17   EYGRTYVVRPKGRHQATIVWLHGLGDNGASWSQLLASLPLPNIKWICPTAPTRAVAAFGG  76

Query  372  FPSTAWFDVNELSENAIDDV  431
            FP TAWFDV + S +  DD+
Sbjct  77   FPCTAWFDVEDTSVDGRDDI  96



>ref|XP_010670666.1| PREDICTED: acyl-protein thioesterase 1 homolog 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=265

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  186  SFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLPNIKWICPTAPQRPITLF  365
            +  FG T+VVKPKGKHQATIVWLHG+GD G SWS LLET PLPNIKWICPTAP RP+ L 
Sbjct  24   NLEFGATHVVKPKGKHQATIVWLHGMGDKGLSWSQLLETFPLPNIKWICPTAPTRPVALL  83

Query  366  GGFPSTAWFDVNELSENAIDDV  431
            GGFP T+WFDV ++SE+  DD+
Sbjct  84   GGFPCTSWFDVEDVSESGSDDL  105



>emb|CDX97691.1| BnaA05g23880D [Brassica napus]
Length=255

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +3

Query  135  MSFTGSSVASAGRTAGRSFNFGRTYVVKPKGKHQATIVWLHGLGDNGSSWSSLLETLPLP  314
            MS++  S+ S  R+A R + FGRTYVV+PKGKHQATIVWLHGLGDNGSS S LLE+LPLP
Sbjct  1    MSYSHQSMGSGHRSA-RGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSSSQLLESLPLP  59

Query  315  NIKWICPTAPQRPITLFGGFPSTAWFDVNELSENAIDDV  431
            NIKWICPTAP RP++L GGFP TAWFDV E+SE+  DD+
Sbjct  60   NIKWICPTAPSRPVSLLGGFPCTAWFDVGEISEDLQDDI  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800