BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J09

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q40089.1|ATP4_IPOBA  RecName: Full=ATP synthase subunit delta'...    291   8e-97   Ipomoea batatas [batate]
ref|XP_004239978.1|  PREDICTED: ATP synthase subunit delta', mito...    276   5e-91   
ref|XP_006365336.1|  PREDICTED: ATP synthase subunit delta', mito...    272   2e-89   Solanum tuberosum [potatoes]
ref|XP_009779336.1|  PREDICTED: ATP synthase subunit delta', mito...    271   4e-89   Nicotiana sylvestris
ref|XP_009599438.1|  PREDICTED: ATP synthase subunit delta', mito...    271   6e-89   Nicotiana tomentosiformis
ref|XP_009759179.1|  PREDICTED: ATP synthase subunit delta', mito...    271   6e-89   Nicotiana sylvestris
ref|XP_009620706.1|  PREDICTED: ATP synthase subunit delta', mito...    271   7e-89   Nicotiana tomentosiformis
ref|XP_006357311.1|  PREDICTED: ATP synthase subunit delta', mito...    268   5e-88   Solanum tuberosum [potatoes]
ref|XP_004235207.1|  PREDICTED: ATP synthase subunit delta', mito...    267   1e-87   Solanum lycopersicum
ref|XP_009791481.1|  PREDICTED: ATP synthase subunit delta', mito...    267   3e-87   Nicotiana sylvestris
ref|XP_006358177.1|  PREDICTED: ATP synthase subunit delta', mito...    261   3e-85   Solanum tuberosum [potatoes]
ref|XP_010269876.1|  PREDICTED: ATP synthase subunit delta', mito...    246   5e-79   Nelumbo nucifera [Indian lotus]
ref|XP_007052407.1|  ATPase, F1 complex, delta/epsilon subunit          242   1e-77   
emb|CDP13863.1|  unnamed protein product                                242   1e-77   Coffea canephora [robusta coffee]
gb|KJB51738.1|  hypothetical protein B456_008G229700                    241   4e-77   Gossypium raimondii
gb|KJB51737.1|  hypothetical protein B456_008G229700                    240   6e-77   Gossypium raimondii
emb|CAN84027.1|  hypothetical protein VITISV_044183                     240   7e-77   Vitis vinifera
ref|XP_006440120.1|  hypothetical protein CICLE_v10022328mg             240   7e-77   Citrus clementina [clementine]
gb|ACS83603.1|  ATP synthase delta subunit 2                            240   7e-77   Gossypium hirsutum [American cotton]
gb|KJB24920.1|  hypothetical protein B456_004G167800                    240   9e-77   Gossypium raimondii
ref|XP_010056468.1|  PREDICTED: ATP synthase subunit delta', mito...    239   2e-76   Eucalyptus grandis [rose gum]
ref|XP_006477040.1|  PREDICTED: ATP synthase subunit delta', mito...    237   1e-75   Citrus sinensis [apfelsine]
ref|XP_011084773.1|  PREDICTED: ATP synthase subunit delta', mito...    238   2e-75   Sesamum indicum [beniseed]
gb|EYU20149.1|  hypothetical protein MIMGU_mgv1a014037mg                237   2e-75   Erythranthe guttata [common monkey flower]
ref|XP_010089775.1|  ATP synthase subunit delta'                        236   5e-75   Morus notabilis
gb|KFK31412.1|  hypothetical protein AALP_AA6G108600                    234   1e-74   Arabis alpina [alpine rockcress]
ref|XP_010531701.1|  PREDICTED: ATP synthase subunit delta', mito...    234   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_006576693.1|  PREDICTED: ATP synthase subunit delta', mito...    233   7e-74   Glycine max [soybeans]
ref|XP_006583520.1|  PREDICTED: ATP synthase subunit delta', mito...    232   7e-74   Glycine max [soybeans]
ref|XP_011076551.1|  PREDICTED: ATP synthase subunit delta', mito...    232   9e-74   Sesamum indicum [beniseed]
ref|XP_007209616.1|  hypothetical protein PRUPE_ppa011618mg             232   1e-73   
gb|ACS83604.1|  ATP synthase delta subunit 3                            231   2e-73   Gossypium hirsutum [American cotton]
ref|XP_011032008.1|  PREDICTED: ATP synthase subunit delta', mito...    231   2e-73   Populus euphratica
ref|XP_002267995.1|  PREDICTED: ATP synthase subunit delta', mito...    231   2e-73   Vitis vinifera
ref|XP_002528798.1|  ATP synthase delta chain, mitochondrial, put...    231   2e-73   Ricinus communis
ref|XP_008343927.1|  PREDICTED: ATP synthase subunit delta', mito...    230   7e-73   Malus domestica [apple tree]
ref|XP_008438277.1|  PREDICTED: ATP synthase subunit delta', mito...    230   8e-73   Cucumis melo [Oriental melon]
gb|EPS69430.1|  hypothetical protein M569_05335                         230   8e-73   Genlisea aurea
ref|XP_007039618.1|  ATPase, F1 complex, delta/epsilon subunit          229   1e-72   
emb|CDY37171.1|  BnaA02g24900D                                          229   1e-72   Brassica napus [oilseed rape]
ref|XP_009128923.1|  PREDICTED: ATP synthase subunit delta', mito...    229   1e-72   Brassica rapa
emb|CDY43639.1|  BnaC02g33050D                                          229   2e-72   Brassica napus [oilseed rape]
ref|XP_009400218.1|  PREDICTED: ATP synthase subunit delta', mito...    229   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_199514.1|  ATP synthase subunit delta'                           229   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370943.1|  PREDICTED: ATP synthase subunit delta', mito...    229   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_009114309.1|  PREDICTED: ATP synthase subunit delta', mito...    228   4e-72   Brassica rapa
gb|ABL97963.1|  hydrogen-transporting ATP synthase                      228   4e-72   Brassica rapa
ref|XP_009371865.1|  PREDICTED: ATP synthase subunit delta', mito...    228   4e-72   Pyrus x bretschneideri [bai li]
ref|XP_009385938.1|  PREDICTED: ATP synthase subunit delta', mito...    228   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010540791.1|  PREDICTED: ATP synthase subunit delta', mito...    228   5e-72   Tarenaya hassleriana [spider flower]
gb|KDP28899.1|  hypothetical protein JCGZ_14670                         229   6e-72   Jatropha curcas
ref|XP_004133965.1|  PREDICTED: ATP synthase subunit delta', mito...    227   9e-72   Cucumis sativus [cucumbers]
gb|ABK94340.1|  unknown                                                 227   9e-72   Populus trichocarpa [western balsam poplar]
ref|XP_006281122.1|  hypothetical protein CARUB_v10027152mg             227   1e-71   Capsella rubella
ref|XP_008346511.1|  PREDICTED: ATP synthase subunit delta', mito...    227   1e-71   
emb|CDY33509.1|  BnaA06g35640D                                          227   1e-71   Brassica napus [oilseed rape]
ref|XP_009101456.1|  PREDICTED: ATP synthase subunit delta', mito...    226   2e-71   Brassica rapa
emb|CDX77730.1|  BnaC07g19840D                                          226   2e-71   
ref|XP_009390524.1|  PREDICTED: ATP synthase subunit delta', mito...    226   5e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006398397.1|  hypothetical protein EUTSA_v10001028mg             225   5e-71   Eutrema salsugineum [saltwater cress]
ref|XP_010274560.1|  PREDICTED: ATP synthase subunit delta', mito...    225   7e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010494912.1|  PREDICTED: ATP synthase subunit delta', mito...    224   1e-70   Camelina sativa [gold-of-pleasure]
emb|CDY03164.1|  BnaC09g19920D                                          224   1e-70   
ref|XP_010441514.1|  PREDICTED: ATP synthase subunit delta', mito...    224   2e-70   Camelina sativa [gold-of-pleasure]
emb|CDY43449.1|  BnaAnng07210D                                          224   2e-70   Brassica napus [oilseed rape]
ref|XP_010481382.1|  PREDICTED: ATP synthase subunit delta', mito...    224   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008232343.1|  PREDICTED: ATP synthase subunit delta', mito...    224   2e-70   Prunus mume [ume]
gb|KHG13715.1|  ATP synthase subunit delta', mitochondrial              224   2e-70   Gossypium arboreum [tree cotton]
gb|ACS83601.1|  ATP synthase delta subunit 1                            223   3e-70   Gossypium hirsutum [American cotton]
ref|XP_008786212.1|  PREDICTED: ATP synthase subunit delta', mito...    223   3e-70   Phoenix dactylifera
gb|KJB22816.1|  hypothetical protein B456_004G068100                    223   4e-70   Gossypium raimondii
ref|XP_007218442.1|  hypothetical protein PRUPE_ppa011691mg             223   5e-70   Prunus persica
ref|XP_010056469.1|  PREDICTED: ATP synthase subunit delta', mito...    223   9e-70   Eucalyptus grandis [rose gum]
ref|XP_010933544.1|  PREDICTED: ATP synthase subunit delta', mito...    222   9e-70   Elaeis guineensis
ref|XP_006375197.1|  H+-transporting two-sector ATPase family pro...    222   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_009369681.1|  PREDICTED: ATP synthase subunit delta', mito...    222   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_008229506.1|  PREDICTED: ATP synthase subunit delta', mito...    222   1e-69   Prunus mume [ume]
ref|XP_002865149.1|  ATP synthase delta                                 221   3e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_011032752.1|  PREDICTED: ATP synthase subunit delta', mito...    220   6e-69   Populus euphratica
gb|ACN26750.1|  unknown                                                 220   7e-69   Zea mays [maize]
ref|NP_001147558.1|  ATP synthase delta chain                           220   8e-69   Zea mays [maize]
ref|XP_008788654.1|  PREDICTED: ATP synthase subunit delta', mito...    220   9e-69   Phoenix dactylifera
ref|XP_004307265.1|  PREDICTED: ATP synthase subunit delta', mito...    219   2e-68   Fragaria vesca subsp. vesca
ref|XP_004516996.1|  PREDICTED: ATP synthase subunit delta', mito...    218   3e-68   Cicer arietinum [garbanzo]
ref|XP_010919828.1|  PREDICTED: ATP synthase subunit delta', mito...    218   4e-68   Elaeis guineensis
gb|AFK44473.1|  unknown                                                 218   6e-68   Lotus japonicus
gb|KDP45971.1|  hypothetical protein JCGZ_11874                         217   7e-68   Jatropha curcas
ref|XP_008794858.1|  PREDICTED: ATP synthase subunit delta', mito...    216   2e-67   Phoenix dactylifera
ref|XP_007134380.1|  hypothetical protein PHAVU_010G042900g             216   3e-67   Phaseolus vulgaris [French bean]
ref|NP_001130528.1|  uncharacterized protein LOC100191627               214   2e-66   Zea mays [maize]
ref|XP_006836816.1|  hypothetical protein AMTR_s00099p00037820          213   2e-66   Amborella trichopoda
ref|XP_010274559.1|  PREDICTED: ATP synthase subunit delta', mito...    211   2e-65   Nelumbo nucifera [Indian lotus]
ref|XP_002460732.1|  hypothetical protein SORBIDRAFT_02g033950          210   3e-65   Sorghum bicolor [broomcorn]
ref|XP_004957771.1|  PREDICTED: ATP synthase subunit delta', mito...    210   7e-65   Setaria italica
ref|XP_010677211.1|  PREDICTED: ATP synthase subunit delta', mito...    206   1e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003626769.1|  ATP synthase delta subunit                         206   1e-63   Medicago truncatula
ref|NP_001059694.1|  Os07g0495200                                       206   1e-63   
emb|CDP09388.1|  unnamed protein product                                206   2e-63   Coffea canephora [robusta coffee]
sp|Q41000.1|ATP4_PEA  RecName: Full=ATP synthase subunit delta', ...    205   3e-63   Pisum sativum [garden pea]
ref|XP_004301716.1|  PREDICTED: ATP synthase subunit delta', mito...    205   5e-63   Fragaria vesca subsp. vesca
gb|ABK22219.1|  unknown                                                 204   1e-62   Picea sitchensis
gb|ABK22036.1|  unknown                                                 203   3e-62   Picea sitchensis
ref|XP_003563079.1|  PREDICTED: ATP synthase subunit delta', mito...    196   1e-59   Brachypodium distachyon [annual false brome]
ref|XP_006658574.1|  PREDICTED: ATP synthase subunit delta', mito...    191   4e-58   Oryza brachyantha
ref|XP_008365889.1|  PREDICTED: LOW QUALITY PROTEIN: ATP synthase...    191   1e-57   
ref|XP_011085472.1|  PREDICTED: ATP synthase subunit delta', mito...    185   2e-55   Sesamum indicum [beniseed]
ref|XP_001780880.1|  predicted protein                                  177   2e-52   
gb|EMT19627.1|  ATP synthase subunit delta', mitochondrial              178   2e-52   
ref|XP_001752929.1|  predicted protein                                  178   2e-52   
ref|XP_001752624.1|  predicted protein                                  175   1e-51   
gb|KHN01619.1|  ATP synthase subunit delta', mitochondrial              171   1e-50   Glycine soja [wild soybean]
ref|XP_010691993.1|  PREDICTED: ATP synthase subunit delta', mito...    169   3e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002964565.1|  hypothetical protein SELMODRAFT_166842             149   4e-41   Selaginella moellendorffii
gb|EYU40328.1|  hypothetical protein MIMGU_mgv1a019389mg                144   6e-40   Erythranthe guttata [common monkey flower]
ref|XP_003056730.1|  H+-or Na+-translocating f-type, v-type and A...    131   2e-34   Micromonas pusilla CCMP1545
ref|XP_011397664.1|  ATP synthase subunit delta', mitochondrial         124   9e-32   Auxenochlorella protothecoides
ref|XP_002506165.1|  H+-or Na+-translocating f-type, v-type and A...    123   5e-31   Micromonas commoda
ref|XP_008382231.1|  PREDICTED: ATP synthase subunit delta', mito...    117   3e-30   
tpg|DAA40913.1|  TPA: hypothetical protein ZEAMMB73_724426              116   9e-30   
gb|EAZ39886.1|  hypothetical protein OsJ_24324                          118   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006385594.1|  hypothetical protein POPTR_0003s08430g             115   6e-29   
ref|XP_008373716.1|  PREDICTED: ATP synthase subunit delta', mito...    115   7e-29   
ref|XP_010058557.1|  PREDICTED: ATP synthase subunit delta', mito...    115   8e-29   
emb|CEF98937.1|  ATPase, F1 complex, delta/epsilon subunit              117   8e-29   Ostreococcus tauri
gb|KCW73220.1|  hypothetical protein EUGRSUZ_E01680                     114   9e-29   Eucalyptus grandis [rose gum]
gb|KCW73233.1|  hypothetical protein EUGRSUZ_E01700                     113   1e-28   Eucalyptus grandis [rose gum]
ref|XP_001419486.1|  F-ATPase family transporter: protons (mitoch...    113   9e-28   Ostreococcus lucimarinus CCE9901
gb|ABK94500.1|  unknown                                                 110   2e-27   Populus trichocarpa [western balsam poplar]
gb|EMS66972.1|  ATP synthase subunit delta', mitochondrial              115   2e-27   Triticum urartu
ref|XP_005643910.1|  hypothetical protein COCSUDRAFT_48924              110   2e-26   Coccomyxa subellipsoidea C-169
gb|KJB14864.1|  hypothetical protein B456_002G150400                    107   1e-25   Gossypium raimondii
gb|KJB15688.1|  hypothetical protein B456_002G190900                    105   2e-25   Gossypium raimondii
ref|XP_003081047.1|  putative ATP synthase delta chain, mitochond...    105   2e-24   
gb|KDD77022.1|  hypothetical protein H632_c38p3                         104   3e-24   Helicosporidium sp. ATCC 50920
gb|KDO85422.1|  hypothetical protein CISIN_1g041201mg                 95.9    7e-22   Citrus sinensis [apfelsine]
gb|EEE67209.1|  hypothetical protein OsJ_24326                        92.0    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ03945.1|  hypothetical protein OsI_26081                        97.8    5e-20   Oryza sativa Indica Group [Indian rice]
dbj|BAC21368.1|  unknown protein                                      91.3    5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005837911.1|  hypothetical protein GUITHDRAFT_151115           92.8    6e-20   Guillardia theta CCMP2712
ref|NP_001059696.2|  Os07g0495400                                     90.1    1e-19   
ref|XP_009824242.1|  hypothetical protein H257_02353                  85.1    3e-17   Aphanomyces astaci
ref|XP_002947644.1|  hypothetical protein VOLCADRAFT_109632           85.1    7e-17   Volvox carteri f. nagariensis
gb|KIZ01401.1|  F-type H+-transporting ATPase subunit delta           83.2    2e-16   Monoraphidium neglectum
ref|XP_002904018.1|  ATP synthase subunit delta', putative            82.0    4e-16   Phytophthora infestans T30-4
gb|ADE92943.1|  mitochondrial ATP synthase subunit delta              82.8    4e-16   Polytomella sp. Pringsheim 198.80
ref|XP_005704291.1|  F-type H+-transporting ATPase subunit delta      81.3    7e-16   Galdieria sulphuraria
ref|XP_008807294.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  83.6    9e-16   
ref|XP_008915127.1|  hypothetical protein PPTG_18704                  80.9    1e-15   Phytophthora parasitica INRA-310
gb|KCW73219.1|  hypothetical protein EUGRSUZ_E016791                  79.0    2e-15   Eucalyptus grandis [rose gum]
ref|XP_008864102.1|  hypothetical protein H310_02387                  80.9    2e-15   Aphanomyces invadans
emb|CCI41129.1|  unnamed protein product                              80.5    2e-15   Albugo candida
emb|CCF54673.1|  probable ATP synthase delta chain precursor, mit...  79.3    4e-15   Ustilago hordei
ref|XP_001698736.1|  mitochondrial F1F0 ATP synthase, delta subunit   80.1    4e-15   Chlamydomonas reinhardtii
ref|XP_009537353.1|  hypothetical protein PHYSODRAFT_288955           79.3    5e-15   Phytophthora sojae
dbj|GAC72673.1|  mitochondrial F1F0-ATP synthase, subunit delta/A...  78.6    7e-15   Moesziomyces antarcticus T-34
emb|CBJ32297.1|  conserved unknown protein                            78.2    1e-14   Ectocarpus siliculosus
gb|KIP11597.1|  hypothetical protein PHLGIDRAFT_63599                 76.6    3e-14   Phlebiopsis gigantea 11061_1 CR5-6
gb|KDO33613.1|  ATP synthase F1                                       76.6    3e-14   Saprolegnia parasitica CBS 223.65
emb|CCA27041.1|  ATP synthase subunit delta' putative                 77.0    3e-14   Albugo laibachii Nc14
ref|XP_008615983.1|  hypothetical protein SDRG_11712                  76.6    4e-14   Saprolegnia diclina VS20
dbj|GAM20322.1|  hypothetical protein SAMD00019534_034970             76.6    5e-14   Acytostelium subglobosum LB1
emb|CDI52039.1|  probable ATP synthase delta chain precursor, mit...  76.3    5e-14   Melanopsichium pennsylvanicum 4
ref|XP_005537275.1|  mitochondrial F-type ATPase F1 subunit delta...  76.3    6e-14   Cyanidioschyzon merolae strain 10D
ref|XP_007510691.1|  predicted protein                                76.3    7e-14   Bathycoccus prasinos
ref|XP_011387060.1|  putative ATP synthase delta chain precursor      75.1    1e-13   Ustilago maydis 521
gb|ESA20032.1|  hypothetical protein GLOINDRAFT_131507                75.1    1e-13   
gb|EXX55065.1|  F1F0 ATP synthase subunit delta                       75.1    2e-13   Rhizophagus irregularis DAOM 197198w
gb|EST06298.1|  mitochondrial F1F0-ATP synthase, subunit delta/ATP16  75.1    2e-13   Kalmanozyma brasiliensis GHG001
gb|EFA75061.1|  ATP synthase F1 delta                                 74.7    2e-13   Heterostelium album PN500
emb|CBQ70506.1|  probable ATP synthase delta chain precursor, mit...  74.7    2e-13   Sporisorium reilianum SRZ2
gb|KHG28342.1|  hypothetical protein F383_12537                       72.0    2e-13   Gossypium arboreum [tree cotton]
gb|EFX00562.1|  ATP synthase delta mitochondrial                      74.3    2e-13   Grosmannia clavigera kw1407
emb|CDX73450.1|  BnaC08g25530D                                        72.4    2e-13   
emb|CEP63956.1|  LALA0S09e06282g1_1                                   73.9    3e-13   Lachancea lanzarotensis
ref|NP_984853.1|  AEL008Wp                                            73.9    3e-13   Eremothecium gossypii ATCC 10895
gb|AGO12349.1|  AaceriAEL008Wp                                        73.6    4e-13   Saccharomycetaceae sp. 'Ashbya aceri'
emb|CAM82775.1|  putative ATP synthase                                73.9    4e-13   Nidula niveotomentosa
ref|XP_011076550.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    4e-13   Sesamum indicum [beniseed]
ref|XP_007409227.1|  hypothetical protein MELLADRAFT_35471            73.2    4e-13   Melampsora larici-populina 98AG31
ref|XP_445369.1|  hypothetical protein                                73.2    6e-13   [Candida] glabrata
pdb|2HLD|H  Chain H, Crystal Structure Of Yeast Mitochondrial F1-...  72.8    6e-13   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_005790233.1|  ATP synthase delta chain, mitochondrial          74.3    6e-13   Emiliania huxleyi CCMP1516
pdb|4B2Q|H  Chain H, Model Of The Yeast F1fo-atp Synthase Dimer B...  72.4    8e-13   Saccharomyces cerevisiae [brewer's yeast]
pdb|3OE7|H  Chain H, Structure Of Four Mutant Forms Of Yeast F1 A...  72.4    8e-13   Saccharomyces cerevisiae [brewer's yeast]
gb|EHN03237.1|  Atp16p                                                72.8    8e-13   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EJT43511.1|  ATP16-like protein                                    72.8    8e-13   Saccharomyces kudriavzevii IFO 1802
ref|XP_003327514.1|  ATP synthase F1, epsilon subunit                 72.8    1e-12   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_001269823.1|  ATP synthase delta chain, mitochondrial prec...  72.8    1e-12   Aspergillus clavatus NRRL 1
gb|EGA75634.1|  Atp16p                                                72.4    1e-12   Saccharomyces cerevisiae AWRI796
emb|CDH49933.1|  atp synthase delta mitochondrial                     72.4    1e-12   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003681204.1|  hypothetical protein TDEL_0D04090                72.0    1e-12   Torulaspora delbrueckii
ref|XP_007910854.1|  putative atp synthase delta mitochondrial pr...  72.0    2e-12   Phaeoacremonium minimum UCRPA7
gb|EGA83722.1|  Atp16p                                                71.2    2e-12   Saccharomyces cerevisiae Lalvin QA23
ref|NP_010280.1|  F1F0 ATP synthase subunit delta                     71.6    2e-12   Saccharomyces cerevisiae S288C
emb|CDS06037.1|  hypothetical protein LRAMOSA08565                    71.6    2e-12   Lichtheimia ramosa
gb|EJK46633.1|  hypothetical protein THAOC_34688                      72.4    2e-12   Thalassiosira oceanica
dbj|GAA22236.1|  K7_Atp16p                                            71.6    2e-12   Saccharomyces cerevisiae Kyokai no. 7
gb|EGA62700.1|  Atp16p                                                70.9    2e-12   Saccharomyces cerevisiae FostersO
ref|XP_007878120.1|  hypothetical protein PFL1_02417                  71.6    2e-12   Anthracocystis flocculosa PF-1
gb|EGA59490.1|  Atp16p                                                71.2    3e-12   Saccharomyces cerevisiae FostersB
ref|XP_002494558.1|  ZYRO0A04312p                                     71.2    3e-12   Zygosaccharomyces rouxii
gb|KDN41412.1|  putative ATP synthase delta chain precursor, mito...  71.2    4e-12   Tilletiaria anomala UBC 951
ref|XP_455744.1|  hypothetical protein                                70.5    6e-12   Kluyveromyces lactis
ref|XP_007875374.1|  hypothetical protein PNEG_03299                  70.5    6e-12   Pneumocystis murina B123
ref|XP_011102894.1|  atp16p                                           70.1    7e-12   
gb|KDR75146.1|  hypothetical protein GALMADRAFT_249073                70.1    7e-12   Galerina marginata CBS 339.88
ref|XP_002555757.1|  KLTH0G16632p                                     70.9    7e-12   Lachancea thermotolerans CBS 6340
gb|KIM31462.1|  hypothetical protein M408DRAFT_259983                 70.1    8e-12   Serendipita vermifera MAFF 305830
gb|KFH49026.1|  ATP synthase subunit delta-like protein               70.1    8e-12   Acremonium chrysogenum ATCC 11550
dbj|BAO39482.1|  ATP synthase subunit delta                           70.1    8e-12   Kluyveromyces marxianus DMKU3-1042
ref|XP_004354697.1|  ATP synthase F1 delta                            70.1    1e-11   Cavenderia fasciculata
tpe|CBF89828.1|  TPA: ATP synthase delta chain, mitochondrial pre...  69.7    1e-11   Aspergillus nidulans FGSC A4
emb|CDO96086.1|  unnamed protein product                              69.3    1e-11   Kluyveromyces dobzhanskii CBS 2104
ref|XP_006965242.1|  ATP synthase delta chain                         69.3    1e-11   Trichoderma reesei QM6a
ref|XP_002372941.1|  ATP synthase delta chain, mitochondrial prec...  69.3    1e-11   Aspergillus flavus NRRL3357
emb|CCT66321.1|  probable ATP synthase delta chain precursor, mit...  69.3    1e-11   Fusarium fujikuroi IMI 58289
ref|XP_001731452.1|  hypothetical protein MGL_1635                    69.3    1e-11   Malassezia globosa CBS 7966
ref|XP_001830304.1|  ATP-synthase delta-subunit                       69.3    1e-11   Coprinopsis cinerea okayama7#130
ref|XP_007266650.1|  epsilon subunit of F1F0-ATP synthase N-termi...  69.3    2e-11   Fomitiporia mediterranea MF3/22
gb|EMD90059.1|  hypothetical protein COCHEDRAFT_1225615               68.9    2e-11   Bipolaris maydis C5
ref|XP_007795292.1|  putative atp synthase delta mitochondrial pr...  68.9    2e-11   
emb|CDH10324.1|  probable ATP synthase subunit delta,mitochondrial    68.6    2e-11   Zygosaccharomyces bailii ISA1307
ref|XP_777009.1|  hypothetical protein CNBB5350                       68.9    2e-11   Cryptococcus neoformans var. neoformans B-3501A
ref|XP_007685583.1|  hypothetical protein COCMIDRAFT_34625            68.9    2e-11   Bipolaris oryzae ATCC 44560
gb|EHK41394.1|  F1F0 ATP synthase delta chain mitochondrial precu...  68.9    2e-11   Trichoderma atroviride IMI 206040
emb|CDF89093.1|  ZYBA0S03-08988g1_1                                   68.6    2e-11   Zygosaccharomyces bailii CLIB 213
ref|XP_007712519.1|  hypothetical protein COCCADRAFT_5247             68.9    2e-11   Bipolaris zeicola 26-R-13
ref|XP_003678096.1|  hypothetical protein NCAS_0I00830                68.9    2e-11   Naumovozyma castellii CBS 4309
gb|KII92771.1|  hypothetical protein PLICRDRAFT_155575                68.6    2e-11   Plicaturopsis crispa FD-325 SS-3
gb|KJA27879.1|  hypothetical protein HYPSUDRAFT_35053                 68.6    2e-11   Hypholoma sublateritium FD-334 SS-4
emb|CEG73298.1|  Putative ATP synthase F1, epsilon subunit            68.6    3e-11   Rhizopus microsporus
gb|ESW97704.1|  F0F1-type ATP synthase, epsilon subunit (mitochon...  68.6    3e-11   Ogataea parapolymorpha DL-1
emb|CEJ05096.1|  Putative ATP synthase F1, epsilon subunit            68.6    3e-11   Rhizopus microsporus
gb|ERS97170.1|  ATP synthase subunit delta, mitochondrial             68.6    3e-11   Sporothrix schenckii ATCC 58251
gb|EIF48104.1|  atp synthase delta mitochondrial precursor            68.6    3e-11   Brettanomyces bruxellensis AWRI1499
ref|XP_001907803.1|  hypothetical protein                             68.6    3e-11   Podospora anserina S mat+
gb|EJU04325.1|  ATP-synthase delta-subunit                            68.2    3e-11   Dacryopinax primogenitus
gb|KEZ42619.1|  hypothetical protein SAPIO_CDS5862                    68.2    3e-11   Scedosporium apiospermum
gb|AFR93033.2|  F-type H -transporting ATPase subunit delta           68.2    3e-11   Cryptococcus neoformans var. grubii H99
ref|XP_007328284.1|  ATP16 delta subunit of the central stalk of ...  68.2    3e-11   Agaricus bisporus var. burnettii JB137-S8
emb|CDR43691.1|  CYFA0S12e03290g1_1                                   68.2    3e-11   Cyberlindnera fabianii
ref|XP_006460755.1|  ATP16 delta subunit of the central stalk of ...  68.2    3e-11   Agaricus bisporus var. bisporus H97
ref|XP_008076037.1|  Epsilon subunit of F1F0-ATP synthase N-terminal  68.2    3e-11   Glarea lozoyensis ATCC 20868
ref|XP_007830565.1|  ATP synthase subunit delta                       68.2    3e-11   Pestalotiopsis fici W106-1
ref|XP_002624591.1|  ATP synthase F1 epsilon subunit                  68.2    4e-11   Blastomyces gilchristii SLH14081
ref|XP_003052364.1|  predicted protein                                68.2    4e-11   [Nectria] haematococca mpVI 77-13-4
ref|XP_009268989.1|  hypothetical protein J056_001086                 68.2    4e-11   Wallemia ichthyophaga EXF-994
gb|EMS24053.1|  ATP-synthase delta chain                              68.2    4e-11   Rhodotorula toruloides NP11
dbj|GAA94604.1|  hypothetical protein E5Q_01256                       68.6    4e-11   Mixia osmundae IAM 14324
ref|XP_007281769.1|  ATP synthase delta mitochondrial                 68.2    4e-11   
ref|XP_007381202.1|  epsilon subunit of F1F0-ATP synthase N-termi...  67.8    4e-11   Punctularia strigosozonata HHB-11173 SS5
ref|XP_005791117.1|  hypothetical protein EMIHUDRAFT_77818            68.2    4e-11   Emiliania huxleyi CCMP1516
gb|EIE83556.1|  hypothetical protein RO3G_08261                       67.8    4e-11   Rhizopus delemar RA 99-880
ref|XP_007289453.1|  hypothetical protein MBM_01564                   67.8    5e-11   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
emb|CCD51070.1|  similar to mitochondrial ATP synthase delta chain    67.8    6e-11   Botrytis cinerea T4
gb|KDE03942.1|  ATP synthase subunit delta                            67.4    6e-11   Microbotryum lychnidis-dioicae p1A1 Lamole
gb|EIE91686.1|  hypothetical protein RO3G_16397                       67.4    6e-11   Rhizopus delemar RA 99-880
ref|XP_007397245.1|  hypothetical protein PHACADRAFT_258487           67.4    6e-11   Phanerochaete carnosa HHB-10118-sp
ref|XP_001388919.1|  ATP synthase subunit delta                       67.4    6e-11   Aspergillus niger CBS 513.88
gb|EHK15583.1|  hypothetical protein TRIVIDRAFT_38411                 67.4    6e-11   Trichoderma virens Gv29-8
ref|XP_006959596.1|  putative ATP synthase delta chain mitochondr...  67.4    7e-11   Wallemia mellicola CBS 633.66
ref|XP_009159984.1|  ATP synthase subunit delta, mitochondrial        67.4    7e-11   Exophiala dermatitidis NIH/UT8656
ref|XP_003710657.1|  ATP synthase subunit delta                       67.4    7e-11   Magnaporthe oryzae 70-15
ref|XP_001877394.1|  predicted protein                                67.0    8e-11   Laccaria bicolor S238N-H82
ref|XP_001591609.1|  ATP synthase delta chain, mitochondrial prec...  67.4    8e-11   Sclerotinia sclerotiorum 1980 UF-70
emb|CCA66354.1|  probable ATP synthase delta chain precursor, mit...  67.0    8e-11   Serendipita indica DSM 11827
ref|XP_008026717.1|  hypothetical protein SETTUDRAFT_177711           67.0    8e-11   Exserohilum turcica Et28A
gb|KEI39555.1|  hypothetical protein L969DRAFT_87505                  67.4    8e-11   Mixia osmundae IAM 14324
ref|XP_003030085.1|  hypothetical protein SCHCODRAFT_68954            67.0    9e-11   Schizophyllum commune H4-8
gb|KID79784.1|  ATPase, F1 complex, delta/epsilon subunit             67.0    9e-11   Metarhizium brunneum ARSEF 3297
ref|WP_020697952.1|  hypothetical protein                             66.6    9e-11   Reyranella massiliensis
gb|EPT04534.1|  hypothetical protein FOMPIDRAFT_1021792               67.0    9e-11   Fomitopsis pinicola FP-58527 SS1
ref|XP_957271.2|  ATP synthase subunit delta                          67.0    9e-11   Neurospora crassa OR74A
emb|CCK72506.1|  hypothetical protein KNAG_0K01440                    67.0    9e-11   Kazachstania naganishii CBS 8797
gb|EWM27238.1|  atp synthase subunit delta                            67.0    9e-11   Nannochloropsis gaditana
gb|KIK09979.1|  hypothetical protein K443DRAFT_671296                 67.0    9e-11   Laccaria amethystina LaAM-08-1
ref|XP_750060.1|  ATP synthase delta chain, mitochondrial precursor   67.0    9e-11   Aspergillus fumigatus Af293
emb|CCL99098.1|  predicted protein                                    67.0    1e-10   Fibroporia radiculosa
gb|KEY78981.1|  ATP synthase delta chain mitochondrial                67.0    1e-10   Aspergillus fumigatus var. RP-2014
ref|XP_011326273.1|  ATP synthase subunit delta                       67.0    1e-10   
gb|AAC15908.1|  ATP synthase F1 deta subunit                          66.6    1e-10   
gb|KIM45294.1|  hypothetical protein M413DRAFT_8556                   70.5    1e-10   
gb|EMD37326.1|  hypothetical protein CERSUDRAFT_113978                66.6    1e-10   
ref|XP_009224266.1|  ATP synthase subunit delta                       66.6    1e-10   
emb|CCU99815.1|  unnamed protein product                              66.6    1e-10   
gb|KHJ32927.1|  putative atp synthase delta mitochondrial precursor   66.6    1e-10   
ref|XP_003668217.1|  hypothetical protein NDAI_0A08200                66.6    1e-10   
ref|XP_657881.1|  hypothetical protein AN0277.2                       69.7    1e-10   
emb|CCJ29758.1|  unnamed protein product                              66.6    1e-10   
gb|KIW51389.1|  ATP synthase subunit delta, mitochondrial             66.6    1e-10   
ref|XP_006680588.1|  hypothetical protein BATDEDRAFT_90133            66.2    1e-10   
gb|EPS28068.1|  hypothetical protein PDE_03014                        66.2    2e-10   
gb|EUB57486.1|  ATP synthase subunit delta                            66.2    2e-10   
emb|CCG80896.1|  ATP synthase subunit delta,mitochondrial             66.2    2e-10   
gb|KIW20444.1|  ATP synthase subunit delta, mitochondrial             66.2    2e-10   
gb|KIW38436.1|  ATP synthase subunit delta, mitochondrial             66.2    2e-10   
emb|CCE31723.1|  probable ATP synthase delta chain precursor,mito...  66.2    2e-10   
ref|XP_003662955.1|  hypothetical protein MYCTH_2079768               66.2    2e-10   
gb|KIV77223.1|  ATP synthase subunit delta, mitochondrial             66.2    2e-10   
ref|XP_001937489.1|  ATP synthase delta chain, mitochondrial prec...  66.2    2e-10   
emb|CDS18726.1|  ATP synthase subunit delta mitochondrial             66.2    2e-10   
ref|XP_007741478.1|  ATP synthase subunit delta, mitochondrial        65.9    2e-10   
ref|XP_007759163.1|  ATP synthase subunit delta, mitochondrial        65.9    2e-10   
gb|KIM95070.1|  hypothetical protein OIDMADRAFT_184173                65.9    2e-10   
ref|XP_001265337.1|  ATP synthase delta chain, mitochondrial prec...  65.9    2e-10   
ref|XP_010763153.1|  ATP synthase subunit delta, mitochondrial        65.9    2e-10   
ref|XP_007317777.1|  delta subunit of the central stalk of mitoch...  65.9    2e-10   
ref|XP_008725701.1|  ATP synthase subunit delta, mitochondrial        65.9    2e-10   
emb|CEJ81999.1|  Putative F1F0 ATP synthase delta chain mitochond...  65.9    2e-10   
ref|XP_007863962.1|  epsilon subunit of F1F0-ATP synthase N-termi...  65.9    2e-10   
gb|EXV03911.1|  ATP synthase, Delta/Epsilon chain                     65.5    3e-10   
ref|XP_007920108.1|  hypothetical protein MYCFIDRAFT_54841            65.5    3e-10   
ref|XP_007362172.1|  epsilon subunit of F1F0-ATP synthase N-termi...  65.5    3e-10   
ref|XP_003300649.1|  hypothetical protein PTT_11953                   68.9    3e-10   
emb|CDJ01798.1|  ATP synthase subunit delta, mitochondrial            65.5    3e-10   
ref|XP_007766932.1|  epsilon subunit of F1F0-ATP synthase N-termi...  65.5    3e-10   
ref|XP_646828.1|  ATP synthase F1 delta                               65.5    3e-10   
ref|XP_007678424.1|  hypothetical protein BAUCODRAFT_111711           65.5    3e-10   
gb|KIV95500.1|  ATP synthase subunit delta, mitochondrial             65.1    4e-10   
ref|XP_007339261.1|  ATP-synthase delta-subunit                       65.1    4e-10   
gb|KIH90662.1|  F-type H+-transporting ATPase subunit delta           65.1    4e-10   
ref|XP_006692879.1|  ATP synthase-like protein                        65.1    4e-10   
gb|KIK40743.1|  hypothetical protein CY34DRAFT_806924                 65.1    4e-10   
ref|XP_006668013.1|  ATP synthase delta chain, putative               65.1    4e-10   
gb|KFG86249.1|  hypothetical protein MANI_026894                      65.1    4e-10   
gb|EPZ34783.1|  ATPase, F1 complex, delta/epsilon subunit domain-...  64.7    4e-10   
gb|AIF09869.1|  F0F1-type ATP synthase, epsilon subunit (mitochon...  64.7    4e-10   
gb|KIW65104.1|  ATP synthase subunit delta, mitochondrial             65.1    5e-10   
gb|EMF17269.1|  epsilon subunit of F1F0-ATP synthase N-terminal d...  64.7    5e-10   
gb|KIW83269.1|  ATP synthase subunit delta, mitochondrial             64.7    6e-10   
gb|KIY44397.1|  epsilon subunit of F1F0-ATP synthase N-terminal d...  64.7    6e-10   
gb|KIX99083.1|  ATP synthase subunit delta, mitochondrial             64.7    6e-10   
ref|XP_002792320.1|  ATP synthase delta chain                         64.7    6e-10   
ref|WP_022700627.1|  F0F1 ATP synthase subunit epsilon                63.9    6e-10   
gb|KIW92223.1|  ATP synthase subunit delta, mitochondrial             64.7    6e-10   
ref|WP_009802195.1|  F0F1 ATP synthase subunit epsilon                63.9    6e-10   
ref|XP_001229413.1|  hypothetical protein CHGG_02897                  64.3    7e-10   
gb|KGK39456.1|  hypothetical protein JL09_g1386                       64.3    7e-10   
gb|KID85412.1|  ATPase, F1 complex, delta/epsilon subunit             64.3    7e-10   
gb|ETS61049.1|  hypothetical protein PaG_04987                        65.1    8e-10   
gb|KIY74337.1|  epsilon subunit of F1F0-ATP synthase N-terminal d...  63.9    8e-10   
ref|XP_008034643.1|  epsilon subunit of F1F0-ATP synthase N-termi...  64.3    8e-10   
ref|XP_009467430.1|  PREDICTED: ATP synthase subunit delta, mitoc...  63.9    9e-10   
ref|XP_007004039.1|  hypothetical protein TREMEDRAFT_56865            63.9    1e-09   
gb|EME48750.1|  hypothetical protein DOTSEDRAFT_67702                 63.9    1e-09   
ref|WP_018997150.1|  F0F1 ATP synthase subunit epsilon                63.2    1e-09   
ref|XP_003838453.1|  hypothetical protein LEMA_P113890.1              63.9    1e-09   
gb|KIK91186.1|  hypothetical protein PAXRUDRAFT_831056                63.5    1e-09   
ref|XP_007737458.1|  ATP synthase subunit delta, mitochondrial        63.9    1e-09   
gb|KIX01505.1|  ATP synthase subunit delta, mitochondrial             63.5    1e-09   
ref|XP_003291559.1|  hypothetical protein DICPUDRAFT_92704            63.5    1e-09   
ref|XP_001791009.1|  hypothetical protein SNOG_00319                  63.5    1e-09   
ref|XP_007307992.1|  epsilon subunit of F1F0-ATP synthase N-termi...  63.5    1e-09   
ref|XP_003006497.1|  ATP synthase delta chain                         63.5    1e-09   
emb|CDY53025.1|  BnaC04g00050D                                        62.0    1e-09   
ref|XP_009651941.1|  ATP synthase delta chain                         63.5    2e-09   
gb|EYE93590.1|  epsilon subunit of F1F0-ATP synthase N-terminal d...  63.2    2e-09   
emb|CEP18469.1|  hypothetical protein                                 63.2    2e-09   
dbj|GAN00991.1|  epsilon subunit of F1F0-ATP synthase N-terminal ...  63.2    2e-09   
gb|KIW22844.1|  ATP synthase subunit delta, mitochondrial             63.2    2e-09   
ref|XP_009546967.1|  mitochondrial F1F0-ATP synthase, subunit del...  63.2    2e-09   
gb|EPB81592.1|  ATP synthase F1, epsilon subunit                      63.2    2e-09   
ref|XP_002566450.1|  Pc22g25650                                       63.2    2e-09   
gb|EYB28245.1|  hypothetical protein FG05_12954                       66.2    2e-09   
ref|XP_008720942.1|  ATP synthase subunit delta, mitochondrial        63.2    2e-09   
ref|XP_007844125.1|  atp synthase delta mitochondrial                 63.2    2e-09   
ref|XP_002295699.1|  F-type H-ATPase delta subunit                    62.4    2e-09   
emb|CCF37276.1|  ATP synthase subunit delta                           62.8    2e-09   
ref|XP_002490577.1|  Delta subunit of the central stalk of mitoch...  62.8    2e-09   
dbj|GAD92557.1|  ATP synthase delta chain, mitochondrial precursor    62.8    3e-09   
gb|EZF25258.1|  hypothetical protein H100_02391                       63.2    3e-09   
gb|KIN96205.1|  hypothetical protein M404DRAFT_16955                  62.8    3e-09   
gb|EZF25260.1|  hypothetical protein H100_02391                       62.4    3e-09   
ref|XP_503135.1|  YALI0D22022p                                        62.4    3e-09   
gb|KIJ18703.1|  hypothetical protein PAXINDRAFT_167265                62.8    3e-09   
gb|EPQ66901.1|  hypothetical protein BGT96224_1050                    62.8    3e-09   
gb|KDQ27780.1|  delta subunit of the central stalk of mitochondri...  62.8    3e-09   
gb|KIJ05824.1|  hypothetical protein PAXINDRAFT_103618                62.8    3e-09   
ref|XP_003655622.1|  hypothetical protein THITE_2119499               62.8    3e-09   
dbj|GAM37787.1|  ATP synthase chain, mitochondrial                    62.8    3e-09   
emb|CDO69228.1|  hypothetical protein BN946_scf185042.g130            65.9    3e-09   
ref|XP_002484362.1|  ATP synthase delta chain, mitochondrial prec...  62.8    3e-09   
ref|XP_002149899.1|  ATP synthase delta chain, mitochondrial prec...  62.4    3e-09   
emb|CCU80314.1|  ATP synthase delta chain, mitochondrial precursor    62.4    3e-09   
ref|XP_003233160.1|  ATP synthase F1 epsilon subunit                  62.4    3e-09   
gb|EKV05334.1|  ATP synthase delta chain, mitochondrial, putative     62.4    4e-09   
ref|XP_008594234.1|  ATP synthase delta chain                         62.4    4e-09   
ref|XP_002149900.1|  ATP synthase delta chain, mitochondrial prec...  62.8    4e-09   
gb|KGO76238.1|  ATPase, F1 complex, delta/epsilon subunit, N-term...  62.4    4e-09   
gb|KIM69774.1|  hypothetical protein SCLCIDRAFT_1208303               62.4    4e-09   
ref|XP_003853046.1|  hypothetical protein MYCGRDRAFT_104198           62.4    4e-09   
gb|EGU88457.1|  hypothetical protein FOXB_01060                       65.5    4e-09   
ref|XP_002836040.1|  hypothetical protein                             62.4    4e-09   
ref|XP_003171467.1|  ATP synthase F1                                  62.0    4e-09   
gb|EPE07271.1|  atp synthase delta mitochondrial                      62.4    4e-09   
gb|KDQ57450.1|  hypothetical protein JAAARDRAFT_193779                62.0    4e-09   
gb|EGE00338.1|  ATP synthase F1 epsilon subunit                       62.0    4e-09   
ref|WP_027300407.1|  ATP synthase subunit epsilon                     62.0    4e-09   
ref|XP_003956209.1|  hypothetical protein KAFR_0C00790                62.0    4e-09   
ref|XP_002846082.1|  ATP synthase delta chain                         62.0    4e-09   
ref|WP_010315359.1|  F0F1 ATP synthase subunit epsilon                61.6    5e-09   
ref|XP_004181543.1|  hypothetical protein TBLA_0G00770                62.0    5e-09   
gb|EZF32011.1|  hypothetical protein H101_04401                       62.0    5e-09   
gb|KIJ67788.1|  hypothetical protein HYDPIDRAFT_173550                62.0    5e-09   
ref|WP_027284775.1|  ATP synthase subunit epsilon                     61.2    6e-09   
ref|XP_003344240.1|  hypothetical protein SMAC_12083                  61.6    6e-09   
dbj|GAC97163.1|  ATP-synthase delta-subunit                           63.5    6e-09   
ref|WP_010310883.1|  F0F1 ATP synthase subunit epsilon                61.2    7e-09   
ref|NP_596259.2|  F1-ATPase delta subunit (predicted)                 61.6    7e-09   
ref|WP_039710475.1|  ATP synthase F0F1 subunit epsilon                60.8    8e-09   
gb|ENH77861.1|  ATP synthase delta mitochondrial                      61.2    9e-09   
ref|XP_002546319.1|  ATP synthase delta chain, mitochondrial prec...  61.2    9e-09   
gb|KIM83247.1|  hypothetical protein PILCRDRAFT_819488                60.8    1e-08   
gb|AHZ64886.2|  ATP synthase subunit delta                            60.8    1e-08   
ref|WP_038602530.1|  hypothetical protein                             60.5    1e-08   
gb|KIL62571.1|  hypothetical protein M378DRAFT_165596                 60.8    1e-08   
ref|XP_005531242.1|  PREDICTED: ATP synthase subunit delta, mitoc...  60.8    1e-08   
dbj|GAM82624.1|  hypothetical protein ANO11243_006060                 60.8    1e-08   
ref|NP_001266179.1|  ATP synthase, H+ transporting, mitochondrial...  60.8    1e-08   
gb|EMG49176.1|  ATP synthase delta chain, mitochondrial               60.8    1e-08   
gb|KFY51086.1|  hypothetical protein V496_08967                       60.8    1e-08   
ref|XP_011123634.1|  hypothetical protein AOL_s00083g153              60.8    1e-08   
gb|ACH44387.1|  putative ATP synthase H+ transporting mitochondri...  60.5    1e-08   
gb|KIW02657.1|  ATP synthase subunit delta, mitochondrial             60.8    1e-08   
ref|XP_011113291.1|  hypothetical protein H072_7538                   60.5    1e-08   
ref|WP_026439990.1|  ATP synthase F1 subunit epsilon                  60.1    1e-08   
gb|KIJ49565.1|  hypothetical protein M422DRAFT_204984                 60.5    2e-08   
ref|XP_001245358.1|  hypothetical protein CIMG_04799                  60.5    2e-08   
emb|CCE42386.1|  hypothetical protein CPAR2_200290                    60.5    2e-08   
ref|XP_003869023.1|  subunit of the mitochondrial F1F0 ATP synthase   60.1    2e-08   
dbj|GAA83449.1|  ATP synthase delta chain, mitochondrial precursor    60.5    2e-08   
gb|KEQ76817.1|  epsilon subunit of F1F0-ATP synthase N-terminal d...  60.1    2e-08   
gb|EKG18269.1|  ATPase F1 complex delta/epsilon subunit               60.1    2e-08   
ref|WP_014746499.1|  ATP synthase subunit epsilon                     59.7    2e-08   
gb|EPX72464.1|  F1-ATPase delta subunit                               60.1    2e-08   
gb|ESZ91280.1|  putative ATP synthase delta chain, mitochondrial ...  60.1    2e-08   
gb|KEQ60814.1|  epsilon subunit of F1F0-ATP synthase N-terminal d...  60.1    2e-08   
gb|KGO38482.1|  ATPase, F1 complex, delta/epsilon subunit, N-term...  60.1    2e-08   
gb|KEQ78948.1|  epsilon subunit of F1F0-ATP synthase N-terminal d...  60.1    2e-08   
gb|KFH73855.1|  F-type H+-transporting ATPase subunit delta           59.7    2e-08   
gb|KFY30234.1|  hypothetical protein V494_08211                       60.1    2e-08   
emb|CEL61037.1|  ATP synthase subunit delta, mitochondrial OS=Aga...  60.1    2e-08   
gb|KFY08564.1|  hypothetical protein V492_06119                       60.1    2e-08   
gb|EUC64373.1|  F0F1 ATP synthase subunit epsilon                     60.1    3e-08   
emb|CDM27125.1|  ATP synthase subunit delta, mitochondrial            59.7    3e-08   
sp|P80504.1|ATPO_SOLTU  RecName: Full=ATP synthase subunit O, mit...  57.4    3e-08   
gb|KEQ98859.1|  hypothetical protein AUEXF2481DRAFT_1689              60.8    3e-08   
gb|ELR05996.1|  ATP synthase subunit delta, mitochondrial             59.7    3e-08   
gb|KFX87122.1|  hypothetical protein V490_08525                       59.7    3e-08   
ref|WP_029312863.1|  ATP synthase F1 subunit epsilon                  59.3    3e-08   
ref|XP_001632656.1|  predicted protein                                58.9    3e-08   
ref|WP_007101655.1|  F0F1 ATP synthase subunit epsilon                58.9    3e-08   
ref|XP_007593722.1|  ATP synthase                                     59.3    4e-08   
gb|KFY05858.1|  hypothetical protein V491_08987                       59.3    4e-08   
ref|XP_009494367.1|  hypothetical protein H696_02194                  59.3    4e-08   
ref|YP_002048873.1|  ATP synthase subunit epsilon                     58.9    4e-08   
ref|XP_011272512.1|  hypothetical protein BN7_5176                    59.3    4e-08   
ref|WP_036510444.1|  ATP synthase F0F1 subunit epsilon                58.9    4e-08   
gb|EPY53965.1|  F1-ATPase delta subunit                               58.9    5e-08   
ref|XP_002583750.1|  ATP synthase F1, epsilon subunit                 58.9    6e-08   
ref|WP_022693360.1|  F0F1 ATP synthase subunit epsilon                58.2    6e-08   
gb|KIK67151.1|  hypothetical protein GYMLUDRAFT_54990                 58.5    7e-08   
ref|WP_011936278.1|  F0F1 ATP synthase subunit epsilon                58.2    7e-08   
ref|WP_031583396.1|  ATP synthase F1 subunit epsilon                  58.2    7e-08   
ref|XP_004347552.1|  ATP synthase subunit delta                       58.5    8e-08   
ref|XP_006688644.1|  epsilon subunit of F1F0-ATP synthase N-termi...  58.5    8e-08   
gb|KFY73393.1|  hypothetical protein V499_06520                       58.5    8e-08   
gb|KFZ08687.1|  hypothetical protein V501_05842                       58.5    8e-08   
gb|KIO32262.1|  hypothetical protein M407DRAFT_112130                 58.2    9e-08   
ref|XP_001523411.1|  ATP synthase delta chain, mitochondrial prec...  58.2    1e-07   
ref|XP_456939.1|  DEHA2A14014p                                        58.2    1e-07   
gb|EQB48975.1|  hypothetical protein CGLO_11731                       61.2    1e-07   
gb|EMT64169.1|  ATP synthase subunit delta, mitochondrial             58.2    1e-07   
ref|XP_002114008.1|  expressed hypothetical protein                   58.2    1e-07   
gb|KFY86208.1|  hypothetical protein V498_07574                       60.8    1e-07   
ref|XP_005428640.1|  PREDICTED: ATP synthase subunit delta, mitoc...  58.9    1e-07   
ref|XP_001386981.1|  ATP synthase delta subunit                       57.8    1e-07   
ref|WP_042696243.1|  ATP synthase subunit epsilon                     57.4    1e-07   
ref|WP_035829457.1|  ATP synthase F0F1 subunit epsilon                57.4    1e-07   
ref|WP_007098821.1|  F0F1 ATP synthase subunit epsilon                57.4    1e-07   
gb|KFH68637.1|  F-type H+-transporting ATPase subunit delta           57.8    1e-07   
ref|WP_012975053.1|  ATP synthase subunit epsilon                     57.4    1e-07   
ref|WP_007423082.1|  ATP synthase F1 subunit epsilon                  57.4    1e-07   
ref|WP_014248781.1|  ATP synthase subunit epsilon                     57.4    1e-07   
gb|KFY82917.1|  hypothetical protein V500_10258                       57.8    1e-07   
ref|XP_002422540.1|  ATP synthase delta chain, mitochondrial prec...  57.8    1e-07   
ref|WP_043369132.1|  ATP synthase F0F1 subunit epsilon                57.0    2e-07   
ref|XP_004196312.1|  Piso0_005767                                     57.4    2e-07   
gb|ACO13055.1|  ATP synthase subunit delta, mitochondrial precursor   57.4    2e-07   
ref|WP_022698198.1|  F0F1 ATP synthase subunit epsilon                57.0    2e-07   
ref|WP_011942415.1|  MULTISPECIES: ATP synthase F1 subunit epsilon    57.0    2e-07   
ref|XP_002767153.1|  conserved hypothetical protein                   57.4    2e-07   
ref|XP_002616235.1|  conserved hypothetical protein                   57.4    2e-07   
gb|KFY19408.1|  hypothetical protein V493_07972                       57.4    2e-07   
gb|KDN71361.1|  putative ATP synthase                                 57.4    2e-07   
gb|EQL03146.1|  ATPase, F1 complex, delta/epsilon subunit             57.0    2e-07   
ref|XP_010209211.1|  PREDICTED: ATP synthase subunit delta, mitoc...  56.6    2e-07   
ref|XP_003683959.1|  hypothetical protein TPHA_0A04520                57.0    2e-07   
ref|XP_006876778.1|  PREDICTED: ATP synthase subunit delta, mitoc...  57.0    2e-07   
dbj|GAK44313.1|  ATP synthase F1, epsilon subunit                     56.6    2e-07   



>sp|Q40089.1|ATP4_IPOBA RecName: Full=ATP synthase subunit delta', mitochondrial; AltName: 
Full=F-ATPase delta' subunit; Flags: Precursor [Ipomoea 
batatas]
 dbj|BAA01511.1| mitochondrial F1-ATPase delta subunit [Ipomoea batatas]
Length=200

 Score =   291 bits (745),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFRHSSRLL RA TM WRRPFSTDLPAE AADSTF+EAWKK+IPNVDPPKTPSAYM+PRP
Sbjct  1    MFRHSSRLLARATTMGWRRPFSTDLPAETAADSTFVEAWKKLIPNVDPPKTPSAYMAPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH
Sbjct  61   ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV+KYFVSGGFAFIHANSFADIIAV
Sbjct  121  EGNDVSKYFVSGGFAFIHANSFADIIAV  148



>ref|XP_004239978.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Solanum 
lycopersicum]
Length=200

 Score =   276 bits (706),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFRH SR L RA TM WRRPF+TDL AE  ADS+F EAWKKV+PNVDPPKTPSA+MSPRP
Sbjct  1    MFRHGSRFLARATTMTWRRPFATDLQAEYVADSSFAEAWKKVVPNVDPPKTPSAFMSPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIPSKLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHVATIAELKPG++SVH
Sbjct  61   ATPSSIPSKLTVNFVLPYTSELSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGILSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDVNKYFVSGGFAF+HANSFADIIA+
Sbjct  121  EGNDVNKYFVSGGFAFVHANSFADIIAI  148



>ref|XP_006365336.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Solanum 
tuberosum]
Length=200

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFRH SR L RA TM WRRPF+TDL A   ADS F EAWKKV+PNVDPPKTPSA+M+PRP
Sbjct  1    MFRHGSRFLARATTMTWRRPFATDLQAGYVADSNFTEAWKKVVPNVDPPKTPSAFMAPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIPSKLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHVATIAELKPG++SVH
Sbjct  61   ATPSSIPSKLTVNFVLPYTSELSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGILSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDVNKYFVSGGFAF+HANSFADIIA+
Sbjct  121  EGNDVNKYFVSGGFAFVHANSFADIIAI  148



>ref|XP_009779336.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Nicotiana 
sylvestris]
Length=201

 Score =   271 bits (694),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAAT-MRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFRH SR L RA T M+WRRPFSTDLPAE  ADS F+EAW+KV+PNV+PPKTPSA+M+ R
Sbjct  1    MFRHGSRFLTRATTTMKWRRPFSTDLPAESVADSNFIEAWRKVVPNVEPPKTPSAFMAAR  60

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            PATPSSIPSKLTVNFVLPYSSEL+GKEVDMVIIPATTGQMGVLPGHVATIAELKPGV+SV
Sbjct  61   PATPSSIPSKLTVNFVLPYSSELSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVLSV  120

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEGNDV KYFVSGGFAF+HANSFADIIAV
Sbjct  121  HEGNDVTKYFVSGGFAFVHANSFADIIAV  149



>ref|XP_009599438.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Nicotiana 
tomentosiformis]
Length=201

 Score =   271 bits (693),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = +1

Query  106  MFRHSSR-LLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFRH SR LL RA TMRWRRPFST LPAEP  DSTF+EAWKK+IPN +PPKTPSA+M PR
Sbjct  1    MFRHGSRQLLARATTMRWRRPFSTGLPAEPRVDSTFVEAWKKLIPNTEPPKTPSAFMDPR  60

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            PATPSSIP+KLTVNFVLPYSSEL+GKEVDMVIIPATTGQMGVLPGHVATIAELKPG++SV
Sbjct  61   PATPSSIPTKLTVNFVLPYSSELSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGLLSV  120

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEGNDV KYFVSGGFAF+H NSFADIIA+
Sbjct  121  HEGNDVTKYFVSGGFAFVHTNSFADIIAI  149



>ref|XP_009759179.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Nicotiana 
sylvestris]
Length=201

 Score =   271 bits (692),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = +1

Query  106  MFRHSSR-LLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFRH SR L+GRA TMRWRRPFST LPAEP  DSTF+EAWKK+IPN +PPKTP A+M PR
Sbjct  1    MFRHGSRQLIGRATTMRWRRPFSTGLPAEPRVDSTFVEAWKKLIPNTEPPKTPFAFMDPR  60

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            PATPSSIP+KLTVNFVLPYSSEL+GKEVDMVIIPATTGQMGVLPGHVATIAELKPG++SV
Sbjct  61   PATPSSIPTKLTVNFVLPYSSELSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGLLSV  120

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEGNDV KYFVSGGFAF+HANSFADIIA+
Sbjct  121  HEGNDVTKYFVSGGFAFVHANSFADIIAI  149



>ref|XP_009620706.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Nicotiana 
tomentosiformis]
Length=201

 Score =   271 bits (692),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAAT-MRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFRH SR L RA T M+WRRPFSTDLPAE  ADS F+EAW+KV+PNV+PPKTPSA+M+ R
Sbjct  1    MFRHGSRFLTRATTSMKWRRPFSTDLPAESVADSNFIEAWRKVVPNVEPPKTPSAFMATR  60

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            PATPSSIPSKLTVNFVLPYSSEL+GKEVDMVIIPATTGQMGVLPGHVATIAELKPGV+SV
Sbjct  61   PATPSSIPSKLTVNFVLPYSSELSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVLSV  120

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEGNDV KYFVSGGFAF+HANSFADIIAV
Sbjct  121  HEGNDVTKYFVSGGFAFVHANSFADIIAV  149



>ref|XP_006357311.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Solanum 
tuberosum]
Length=200

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFRHSSR L RA+TMRWRRPFSTDLPAE   +S F+EAW+K IP V+PP TPSA+M+ RP
Sbjct  1    MFRHSSRFLSRASTMRWRRPFSTDLPAEAYKNSNFVEAWRKAIPTVEPPSTPSAFMATRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIPSKLTVNFVLPYSSEL+GKEVDMVIIPATTGQMGVLPGHVATIAELKPG++SVH
Sbjct  61   ATPSSIPSKLTVNFVLPYSSELSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGILSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV+KYFVSGGFA++HANSFADIIAV
Sbjct  121  EGNDVSKYFVSGGFAYVHANSFADIIAV  148



>ref|XP_004235207.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Solanum 
lycopersicum]
Length=200

 Score =   267 bits (683),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R SSRLL RA TM+WRRPFSTDLPA  + DSTF +AWKKVIPN +PP TPSA+M PRP
Sbjct  1    MLRQSSRLLTRATTMKWRRPFSTDLPAANSVDSTFSDAWKKVIPNTEPPMTPSAFMKPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIPSKL+VNFVLPYSSEL+GKEVDMVIIPATTGQMGVLPGHVATIAELKPGV+SVH
Sbjct  61   ATPSSIPSKLSVNFVLPYSSELSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV KYFVSGGFAF+HANSFADI+AV
Sbjct  121  EGNDVTKYFVSGGFAFVHANSFADIVAV  148



>ref|XP_009791481.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Nicotiana 
sylvestris]
Length=200

 Score =   267 bits (682),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M RH SRL+ RA TMRWRRPFSTDL AE   DS FLEAW+K IPNV+PPKTPSA+M+ RP
Sbjct  1    MLRHGSRLVSRATTMRWRRPFSTDLAAEAPVDSNFLEAWRKAIPNVEPPKTPSAFMATRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIPSKLTVNFVLPYSSEL+ KEVDMVIIP+TTGQMGVLPGHVATIAELKPGV+SVH
Sbjct  61   ATPSSIPSKLTVNFVLPYSSELSSKEVDMVIIPSTTGQMGVLPGHVATIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV+KYFVSGGFAF+HANSFADIIA+
Sbjct  121  EGNDVSKYFVSGGFAFVHANSFADIIAI  148



>ref|XP_006358177.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Solanum 
tuberosum]
Length=200

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R SSRLL RA TM WRRPFSTDLPA    DSTF EAWKKVIP  +PP TPSA+M PRP
Sbjct  1    MLRQSSRLLTRATTMTWRRPFSTDLPAANRVDSTFPEAWKKVIPTTEPPMTPSAFMKPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSSIPSKL+VNFVLPYSSEL+GKEVDMVIIPATTGQMGVLPGHVATIAELKPGV+SVH
Sbjct  61   VTPSSIPSKLSVNFVLPYSSELSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV KYFVSGGFAF+HANSFADI+AV
Sbjct  121  EGNDVTKYFVSGGFAFVHANSFADIVAV  148



>ref|XP_010269876.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Nelumbo 
nucifera]
Length=200

 Score =   246 bits (627),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR + RLL RA +M   R FSTDLPA    DS+F+EAWKKVIPN+DPPKTP ++M PRP
Sbjct  1    MFRQAPRLLARATSMMRTRSFSTDLPAAQTVDSSFVEAWKKVIPNIDPPKTPLSFMQPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPS+IP KLTVNFVLPY SEL+ KEVDMVIIPATTGQMGVLPGHVATIAELKPG++SVH
Sbjct  61   PTPSTIPGKLTVNFVLPYQSELSTKEVDMVIIPATTGQMGVLPGHVATIAELKPGILSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV KYF+S GFAFIHANSFADI+AV
Sbjct  121  EGNDVTKYFLSSGFAFIHANSFADIVAV  148



>ref|XP_007052407.1| ATPase, F1 complex, delta/epsilon subunit [Theobroma cacao]
 gb|EOX96564.1| ATPase, F1 complex, delta/epsilon subunit [Theobroma cacao]
Length=200

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R +S LL R       RPFSTDLPA   AD+TF+EAWKKVIPN+DPPKTP ++M PRP
Sbjct  1    MLRRASGLLARPILAARARPFSTDLPAAQTADATFVEAWKKVIPNMDPPKTPLSFMQPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSSIPSKLTVNFVLPY+SELA KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+SVH
Sbjct  61   PTPSSIPSKLTVNFVLPYASELATKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGN+V KYF+S GFAFIHANSFAD+IAV
Sbjct  121  EGNEVTKYFISSGFAFIHANSFADVIAV  148



>emb|CDP13863.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAAT--MRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSP  279
            M RH+ RLL RA +  MRWRRPFST++PAE   D+ F+E+W+  IPN++PPKTPSA+M+P
Sbjct  1    MLRHAPRLLSRATSSAMRWRRPFSTNVPAETPVDAKFVESWRSTIPNIEPPKTPSAFMTP  60

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            RP TPS+IPSKLT+N VLPY+S  + KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+S
Sbjct  61   RPPTPSTIPSKLTINVVLPYNSIFSAKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLS  120

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            VHEGNDV KYFVSGGFAFIHANS ADIIAV
Sbjct  121  VHEGNDVTKYFVSGGFAFIHANSVADIIAV  150



>gb|KJB51738.1| hypothetical protein B456_008G229700 [Gossypium raimondii]
Length=202

 Score =   241 bits (615),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRP--FSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSP  279
            MFR +SRLL R  T  WRR   FS+D+PA PA DS+F+E+W KVIPN+DPPKTPS++M+P
Sbjct  1    MFRQASRLLARTTT-PWRRSRAFSSDVPATPAQDSSFIESWSKVIPNLDPPKTPSSFMTP  59

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            RPATPS+IPSKLTVNFVLPY+SEL+ KEVDMVI+PATTGQMGVLPGHV TIAELKPG++S
Sbjct  60   RPATPSAIPSKLTVNFVLPYASELSAKEVDMVIVPATTGQMGVLPGHVPTIAELKPGILS  119

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            VHEGNDV KYF+S GFA IHANS ADIIAV
Sbjct  120  VHEGNDVTKYFLSSGFALIHANSVADIIAV  149



>gb|KJB51737.1| hypothetical protein B456_008G229700 [Gossypium raimondii]
Length=201

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRP--FSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSP  279
            MFR +SRLL R  T  WRR   FS+D+PA PA DS+F+E+W KVIPN+DPPKTPS++M+P
Sbjct  1    MFRQASRLLARTTT-PWRRSRAFSSDVPATPAQDSSFIESWSKVIPNLDPPKTPSSFMTP  59

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            RPATPS+IPSKLTVNFVLPY+SEL+ KEVDMVI+PATTGQMGVLPGHV TIAELKPG++S
Sbjct  60   RPATPSAIPSKLTVNFVLPYASELSAKEVDMVIVPATTGQMGVLPGHVPTIAELKPGILS  119

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            VHEGNDV KYF+S GFA IHANS ADIIAV
Sbjct  120  VHEGNDVTKYFLSSGFALIHANSVADIIAV  149



>emb|CAN84027.1| hypothetical protein VITISV_044183 [Vitis vinifera]
Length=206

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 128/154 (83%), Gaps = 6/154 (4%)
 Frame = +1

Query  106  MFRHSSRLLGRAA------TMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSA  267
            M R ++RLL R A           RPFSTDLPA PA DSTF++AWKK+IPN+DPP TP  
Sbjct  1    MLRQATRLLARPAIASSSSFAARARPFSTDLPAAPAEDSTFIDAWKKIIPNIDPPATPLT  60

Query  268  YMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKP  447
            +M PRP TPSSIPSKLTVNFVLPY+SEL+ KEVDMVIIPATTGQMGVLPGHVATIAELKP
Sbjct  61   FMQPRPQTPSSIPSKLTVNFVLPYASELSAKEVDMVIIPATTGQMGVLPGHVATIAELKP  120

Query  448  GVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            GVMSVHEGNDV KYF+S GFA IHANSFADIIA+
Sbjct  121  GVMSVHEGNDVTKYFISSGFAVIHANSFADIIAI  154



>ref|XP_006440120.1| hypothetical protein CICLE_v10022328mg [Citrus clementina]
 gb|ESR53360.1| hypothetical protein CICLE_v10022328mg [Citrus clementina]
 gb|KDO52683.1| hypothetical protein CISIN_1g029006mg [Citrus sinensis]
Length=200

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR +SRLL RA+ +   R FS+ +PA PA DSTF+E+WKKV PN++PPKTPS YM+PRP
Sbjct  1    MFRQASRLLARASAVTRSRAFSSQVPAAPAVDSTFVESWKKVNPNMEPPKTPSVYMTPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TP+SIPSKLTVNFVLPY+SEL+ KEVDMVI+PA+TGQMGVLPGHV TIAELKPGV+SVH
Sbjct  61   QTPTSIPSKLTVNFVLPYASELSAKEVDMVIVPASTGQMGVLPGHVPTIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +GND  KYFVS GFAFIHANS ADIIAV
Sbjct  121  DGNDTKKYFVSSGFAFIHANSVADIIAV  148



>gb|ACS83603.1| ATP synthase delta subunit 2 [Gossypium hirsutum]
Length=201

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR--RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSP  279
            MFR +SRLL R  T  WR  R FS+D+PA PA DS+F+E+W KVIPN+DPPKTPS++M+P
Sbjct  1    MFRQASRLLARTTT-PWRGSRAFSSDVPATPAQDSSFIESWSKVIPNLDPPKTPSSFMTP  59

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            RPATPS+IPSKLTVNFVLPY+SEL+ KEVDMVI+PATTGQMG+LPGHV TIAELKPG++S
Sbjct  60   RPATPSAIPSKLTVNFVLPYASELSAKEVDMVIVPATTGQMGILPGHVPTIAELKPGILS  119

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            VHEGNDV KYF+S GFA IHANS ADIIAV
Sbjct  120  VHEGNDVTKYFLSSGFALIHANSVADIIAV  149



>gb|KJB24920.1| hypothetical protein B456_004G167800 [Gossypium raimondii]
Length=201

 Score =   240 bits (612),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            M R +S LL R   +  R RPFSTDLPA P+AD+TF EAW KVIPN+DPPKTP ++M PR
Sbjct  1    MLRRASMLLARRPILAARARPFSTDLPAAPSADATFTEAWTKVIPNMDPPKTPLSFMQPR  60

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TPSSIPSKLTVNFVLPY+SELA KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+SV
Sbjct  61   PPTPSSIPSKLTVNFVLPYASELATKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSV  120

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEG++V KYFVS GF FIHANSFADIIAV
Sbjct  121  HEGSEVTKYFVSSGFVFIHANSFADIIAV  149



>ref|XP_010056468.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Eucalyptus 
grandis]
 gb|KCW73232.1| hypothetical protein EUGRSUZ_E01697 [Eucalyptus grandis]
Length=207

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 133/155 (86%), Gaps = 7/155 (5%)
 Frame = +1

Query  106  MFRHSSRLLGR-------AATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPS  264
            MFRH+++LL R       AA+   RRPFS+DLPA   AD  F+EAWKK+IPN+DPPKTP 
Sbjct  1    MFRHAAKLLRRPVPTTSPAASAVSRRPFSSDLPAAETADPAFVEAWKKLIPNIDPPKTPL  60

Query  265  AYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELK  444
            ++M PRPATP+SIP+KLTVNFVLPY+SEL+ KEVDMVI+PATTGQ+GVLPGHV TIAEL+
Sbjct  61   SFMQPRPATPASIPTKLTVNFVLPYASELSAKEVDMVIVPATTGQLGVLPGHVPTIAELR  120

Query  445  PGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            PG+MSVH+GNDV KYFVS GFAFIHANSFADIIAV
Sbjct  121  PGLMSVHDGNDVTKYFVSSGFAFIHANSFADIIAV  155



>ref|XP_006477040.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Citrus 
sinensis]
Length=200

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR +SRLL RA+ +   R FS+++PA PA DSTF+E+WKKV P ++PPKTPS YM+PRP
Sbjct  1    MFRQASRLLARASAVTRSRAFSSEVPATPAVDSTFVESWKKVNPIMEPPKTPSVYMTPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TP+SIPSKLTVNFVLPY+SEL+ KEVDMVI+PA+TGQMGVLPGHV TIAELKPGV+SVH
Sbjct  61   QTPTSIPSKLTVNFVLPYASELSAKEVDMVIVPASTGQMGVLPGHVPTIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +GND  KYFVS GFAFIHANS ADIIAV
Sbjct  121  DGNDTKKYFVSSGFAFIHANSVADIIAV  148



>ref|XP_011084773.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Sesamum 
indicum]
Length=249

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = +1

Query  106  MFRHSSRLL---GRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMS  276
            M R + R L     A+  R  RPFSTDLPAE A DS F++AWKK+IPN+DPPKTPSAYM+
Sbjct  47   MLRQAQRFLLTRASASATRSTRPFSTDLPAETAGDSKFIDAWKKLIPNMDPPKTPSAYMA  106

Query  277  PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVM  456
            PRP TPS+IPSKLTVN VLPY S L+ KEVDMVI+PATTGQMGVLPGHVATIAELKPG++
Sbjct  107  PRPPTPSTIPSKLTVNLVLPYDSVLSAKEVDMVIVPATTGQMGVLPGHVATIAELKPGIL  166

Query  457  SVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            SVHEGNDV KYF+SGGFAF+HANS ADIIA+
Sbjct  167  SVHEGNDVTKYFLSGGFAFVHANSVADIIAI  197



>gb|EYU20149.1| hypothetical protein MIMGU_mgv1a014037mg [Erythranthe guttata]
Length=203

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = +1

Query  106  MFRHSSRLL---GRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMS  276
            M R   R L     AATMRW R ++ DLPAE + DS F++AWKK+IP +DPP+TPSAYM+
Sbjct  1    MLRQGPRFLLSRASAATMRWTRQYAADLPAETSGDSKFVDAWKKLIPTIDPPRTPSAYMA  60

Query  277  PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVM  456
            PRP TPS+IPSKLTVN VLPY S L+ K+VDMVIIPATTGQMGVLPGHVATIAELKPGV+
Sbjct  61   PRPPTPSTIPSKLTVNLVLPYDSVLSAKQVDMVIIPATTGQMGVLPGHVATIAELKPGVI  120

Query  457  SVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            SVHEGND++KYF+SGGFAFIHANS ADIIA+
Sbjct  121  SVHEGNDISKYFLSGGFAFIHANSVADIIAI  151



>ref|XP_010089775.1| ATP synthase subunit delta' [Morus notabilis]
 gb|EXB38367.1| ATP synthase subunit delta' [Morus notabilis]
Length=202

 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 2/150 (1%)
 Frame = +1

Query  106  MFRH-SSRLLGRAATMRWR-RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSP  279
            MFR  ++ LLGRA     R RPFSTD+PA    DS F EAWKKVIPN++PPKTP ++M P
Sbjct  1    MFRRATTSLLGRATAFSGRARPFSTDVPAAQTGDSAFAEAWKKVIPNIEPPKTPLSFMQP  60

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            RP  PSS+PSKLTVNFVLPY+SEL+ KEVDMVIIPATTGQMGVLPGHV+TIAELKPGV+S
Sbjct  61   RPPIPSSVPSKLTVNFVLPYASELSAKEVDMVIIPATTGQMGVLPGHVSTIAELKPGVLS  120

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            VHEGNDV KYFVS GFAFIHANSF DIIAV
Sbjct  121  VHEGNDVTKYFVSSGFAFIHANSFTDIIAV  150



>gb|KFK31412.1| hypothetical protein AALP_AA6G108600 [Arabis alpina]
Length=201

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 131/151 (87%), Gaps = 5/151 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRA---ATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMS  276
            MFR +SRLL R+   A+   RR FST+LP+    DSTF+E+WKKV PN+DPP+TPS++M 
Sbjct  1    MFRQASRLLSRSVAVASATSRRAFSTELPS--TLDSTFVESWKKVAPNMDPPQTPSSFMK  58

Query  277  PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVM  456
            PRP+TPSS+P+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG+M
Sbjct  59   PRPSTPSSLPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPGIM  118

Query  457  SVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            SVHEG D+ KYFVS GFAF+HANS ADIIA+
Sbjct  119  SVHEGTDIKKYFVSSGFAFLHANSVADIIAI  149



>ref|XP_010531701.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Tarenaya 
hassleriana]
Length=198

 Score =   234 bits (597),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR ++RLL R  +    R FS+D+PA  AADS F+E+WKKV+PN+DPP+TP ++M PRP
Sbjct  1    MFRQTARLLARRVSAV--RSFSSDVPANAAADSNFIESWKKVVPNLDPPQTPLSFMKPRP  58

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TP+++P+KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHV TIAELKPGV SVH
Sbjct  59   ETPATLPTKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVPTIAELKPGVFSVH  118

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV KYF+S GFAFIHANS ADIIAV
Sbjct  119  EGNDVKKYFLSSGFAFIHANSVADIIAV  146



>ref|XP_006576693.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Glycine 
max]
 gb|KHN19720.1| ATP synthase subunit delta', mitochondrial [Glycine soja]
Length=197

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            + R +S LL  A+    RR  S+D+PA PAADS F EAWKKV PN+DPPKTP AYM PRP
Sbjct  2    LRRATSSLLTGAS----RRRLSSDVPATPAADSAFAEAWKKVSPNIDPPKTPLAYMKPRP  57

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPS++PSKLTVNFVLPYSS+LA KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+SVH
Sbjct  58   PTPSALPSKLTVNFVLPYSSQLAAKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSVH  117

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV KYFVS GFAFIHANS ADIIAV
Sbjct  118  EGNDVTKYFVSSGFAFIHANSVADIIAV  145



>ref|XP_006583520.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Glycine 
max]
Length=197

 Score =   232 bits (592),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R ++  L   A+   RR  STD+PA PAADS F EAWKKV PN+DPPKTP AYM PRP
Sbjct  1    MLRRATTSLISGAS---RRRLSTDVPATPAADSVFAEAWKKVSPNIDPPKTPLAYMKPRP  57

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPS++PSKLTVNFVLPY+S+LA KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+SVH
Sbjct  58   PTPSTLPSKLTVNFVLPYASQLAAKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSVH  117

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV KYFVS GFAFIHANS ADIIAV
Sbjct  118  EGNDVTKYFVSSGFAFIHANSVADIIAV  145



>ref|XP_011076551.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Sesamum 
indicum]
Length=186

 Score =   232 bits (591),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  148  MRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNF  327
            M WRR  S+DLPAE   DS F +AWKK+IPN+DPPKTPSAYMSPRP TPS+IPSKLTVN 
Sbjct  1    MIWRRQLSSDLPAETVGDSKFNDAWKKLIPNMDPPKTPSAYMSPRPPTPSTIPSKLTVNL  60

Query  328  VLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGF  507
            VLPY S LA KEVDMVI+PATTGQMGVLPGHVATIAELKPG++SVHEGND+ KYF+SGGF
Sbjct  61   VLPYESVLAAKEVDMVIVPATTGQMGVLPGHVATIAELKPGILSVHEGNDITKYFLSGGF  120

Query  508  AFIHANSFADIIAV  549
            AF+HANS ADIIAV
Sbjct  121  AFVHANSVADIIAV  134



>ref|XP_007209616.1| hypothetical protein PRUPE_ppa011618mg [Prunus persica]
 gb|EMJ10815.1| hypothetical protein PRUPE_ppa011618mg [Prunus persica]
Length=203

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPA-EPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFR +S LLGR A     R   T++PA  P ADS F+E+WKKVIP +DPPKTPS YM PR
Sbjct  3    MFRQASSLLGRPACPSRFRALCTEVPAANPNADSAFIESWKKVIPIMDPPKTPSTYMEPR  62

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TPSS+PSKLTVNFVLPYSSEL+GKEVDMV++PATTGQMGVLPGHVATIAELKPG++SV
Sbjct  63   PPTPSSLPSKLTVNFVLPYSSELSGKEVDMVMVPATTGQMGVLPGHVATIAELKPGILSV  122

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEG++V KYFVS GFAFIHANS ADI+AV
Sbjct  123  HEGSEVTKYFVSSGFAFIHANSVADIVAV  151



>gb|ACS83604.1| ATP synthase delta subunit 3 [Gossypium hirsutum]
Length=201

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            M   +S LL   + +  R RPFSTDLPA P+AD+TF EAW KVIPN+DPPKTP ++M PR
Sbjct  1    MLGRASMLLPCRSILPARARPFSTDLPAAPSADATFTEAWTKVIPNMDPPKTPLSFMQPR  60

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TPSSIPSKLTVNFVLPY+SELA KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+SV
Sbjct  61   PPTPSSIPSKLTVNFVLPYASELATKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSV  120

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEG+++ KYFVS GF FIHANSFADIIAV
Sbjct  121  HEGSEMTKYFVSSGFVFIHANSFADIIAV  149



>ref|XP_011032008.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Populus 
euphratica]
Length=207

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 124/155 (80%), Gaps = 7/155 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-------RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPS  264
            M R +SRLL R+     +       RP STDLPA P  DS F+E+WKKV PN+DPPKTPS
Sbjct  1    MLRQASRLLTRSIATTQQPIRVMAARPMSTDLPATPVEDSAFVESWKKVAPNIDPPKTPS  60

Query  265  AYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELK  444
            A+M PRP TPS+IPSK+TVNFVLPY+SEL  KEVDMVIIPATTGQMGVLPGHV TIAELK
Sbjct  61   AFMKPRPPTPSTIPSKITVNFVLPYTSELTSKEVDMVIIPATTGQMGVLPGHVPTIAELK  120

Query  445  PGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            PGV+SVHEGNDV KYF+S GF F+HANS ADI+ V
Sbjct  121  PGVLSVHEGNDVKKYFLSSGFVFVHANSVADIVVV  155



>ref|XP_002267995.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Vitis 
vinifera]
 emb|CBI16711.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 126/154 (82%), Gaps = 6/154 (4%)
 Frame = +1

Query  106  MFRHSSRLLGRAA------TMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSA  267
            M R ++RLL R A           R FSTDLP  PA DSTF++AWKK+IPN+DPP TP  
Sbjct  1    MLRQATRLLARPAIASSSSFAARARSFSTDLPTAPAEDSTFIDAWKKIIPNIDPPATPLT  60

Query  268  YMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKP  447
            +M PRP TPSSIPSKLTVNFVLPY+SEL+ KEVDMVIIPATTGQMGVLPGHVATIAELKP
Sbjct  61   FMQPRPQTPSSIPSKLTVNFVLPYASELSAKEVDMVIIPATTGQMGVLPGHVATIAELKP  120

Query  448  GVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            GVMSVHEGNDV KYF+S GFA IHANSFADIIA+
Sbjct  121  GVMSVHEGNDVTKYFISSGFAVIHANSFADIIAI  154



>ref|XP_002528798.1| ATP synthase delta chain, mitochondrial, putative [Ricinus communis]
 gb|EEF33620.1| ATP synthase delta chain, mitochondrial, putative [Ricinus communis]
Length=204

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 129/152 (85%), Gaps = 4/152 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRAAT----MRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYM  273
            M R +SRL GR+ T    M   R  ST++PA  + DS F+E+W+KV+PN+DPPKTP+A+M
Sbjct  1    MLRQTSRLFGRSLTQQPKMMMGRAMSTEVPATASVDSDFVESWRKVVPNMDPPKTPAAFM  60

Query  274  SPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGV  453
             PRP+TPS+IPSKLTVNFVLPY+SEL+ KEVDMVI+PATTGQMGVLPGHV TIAELKPG+
Sbjct  61   QPRPSTPSTIPSKLTVNFVLPYASELSTKEVDMVIMPATTGQMGVLPGHVPTIAELKPGI  120

Query  454  MSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +SVHEGNDV KYF+S GFAFIHANS ADIIAV
Sbjct  121  LSVHEGNDVTKYFLSSGFAFIHANSVADIIAV  152



>ref|XP_008343927.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Malus 
domestica]
Length=200

 Score =   230 bits (586),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR ++ LL R+      RPFSTD+     ADSTF +AWKKV+P++DPPKTP  +M PRP
Sbjct  1    MFRRATTLLTRSTIPLRARPFSTDVAESVPADSTFTDAWKKVVPHIDPPKTPLTFMKPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIP+KLTVNFVLPY+SEL+ KEVDMVIIPA+TG MGVLPGHVATIAELKPGVMSVH
Sbjct  61   ATPSSIPTKLTVNFVLPYASELSAKEVDMVIIPASTGHMGVLPGHVATIAELKPGVMSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG DV KYFVS GFAFIHANS ADIIAV
Sbjct  121  EGTDVTKYFVSSGFAFIHANSIADIIAV  148



>ref|XP_008438277.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Cucumis 
melo]
Length=200

 Score =   230 bits (586),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR +S LL R       R FS+DLPA  + +  F+ AWKKVIPN+DPPKTP ++M+PRP
Sbjct  1    MFRRASTLLARPFLSARTRSFSSDLPAAGSTEDAFVSAWKKVIPNIDPPKTPLSFMAPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIPSKLTVN VLPYSSEL+ KEVDMVIIPATTGQMGVLPGHV TIAELKPGV+SVH
Sbjct  61   ATPSSIPSKLTVNLVLPYSSELSAKEVDMVIIPATTGQMGVLPGHVPTIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG+D+ KYFVS GFAFIH NS+ADIIAV
Sbjct  121  EGSDIKKYFVSSGFAFIHGNSYADIIAV  148



>gb|EPS69430.1| hypothetical protein M569_05335 [Genlisea aurea]
Length=203

 Score =   230 bits (586),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = +1

Query  106  MFRHSSRLL---GRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMS  276
            M R SSR +     AA +   R FSTDLPAE   DS F++ WKKVIPN++PPKTPSAYM 
Sbjct  1    MLRQSSRFVVNRASAALVGRGRRFSTDLPAETGGDSKFVDDWKKVIPNLEPPKTPSAYMK  60

Query  277  PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVM  456
            PRP TPS+IPSKLTVN VLPY S L+ KEVDMVI+PA+TGQMGVLPGHVATIAELKPGV+
Sbjct  61   PRPQTPSTIPSKLTVNLVLPYDSALSAKEVDMVIVPASTGQMGVLPGHVATIAELKPGVL  120

Query  457  SVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            SVHEGNDV KYF+SGGFAF+HANS  DI+A+
Sbjct  121  SVHEGNDVTKYFLSGGFAFVHANSITDIVAI  151



>ref|XP_007039618.1| ATPase, F1 complex, delta/epsilon subunit [Theobroma cacao]
 gb|EOY24119.1| ATPase, F1 complex, delta/epsilon subunit [Theobroma cacao]
Length=203

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +1

Query  166  FSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSS  345
            FSTDLPA P  DSTF+E+WKKVIPN+DPPKTPS++M+PRPATPSSIPSK+TVNFVLPY+S
Sbjct  24   FSTDLPATPTEDSTFIESWKKVIPNMDPPKTPSSFMTPRPATPSSIPSKITVNFVLPYAS  83

Query  346  ELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHAN  525
            EL+ KEVDMVI+PATTGQMGVLPGHV TIAELKPG++SVHEGNDV KYF+S GFAFIHAN
Sbjct  84   ELSTKEVDMVIVPATTGQMGVLPGHVPTIAELKPGILSVHEGNDVTKYFLSSGFAFIHAN  143

Query  526  SFADIIAV  549
            S ADIIAV
Sbjct  144  SVADIIAV  151



>emb|CDY37171.1| BnaA02g24900D [Brassica napus]
Length=200

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 129/150 (86%), Gaps = 4/150 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMR--WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSP  279
            MFR +SRL+ R+ T +    R FST++P+    DS+F+EAWKKV PN+DPP+TPS++M P
Sbjct  1    MFRQASRLVSRSITAKSALNRAFSTEVPS--TIDSSFVEAWKKVAPNMDPPQTPSSFMKP  58

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            RP+T SSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG+MS
Sbjct  59   RPSTASSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPGIMS  118

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            VHEG D+ KYFVS GFAF+HANS ADIIAV
Sbjct  119  VHEGTDIKKYFVSSGFAFLHANSVADIIAV  148



>ref|XP_009128923.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Brassica 
rapa]
Length=200

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 129/150 (86%), Gaps = 4/150 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMR--WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSP  279
            MFR +SRL+ R+ T +    R FST++P+    DS+F+EAWKKV PN+DPP+TPS++M P
Sbjct  1    MFRQASRLVSRSITAKSATNRAFSTEVPS--TIDSSFVEAWKKVAPNMDPPQTPSSFMKP  58

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            RP+T SSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG+MS
Sbjct  59   RPSTASSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPGIMS  118

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            VHEG D+ KYFVS GFAF+HANS ADIIAV
Sbjct  119  VHEGTDIKKYFVSSGFAFLHANSVADIIAV  148



>emb|CDY43639.1| BnaC02g33050D [Brassica napus]
Length=200

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 129/150 (86%), Gaps = 4/150 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMR--WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSP  279
            MFR +SRL+ R+ T +    R FST++P+    DS+F+EAWKKV PN+DPP+TPS++M P
Sbjct  1    MFRQASRLVSRSITAKSTTNRAFSTEVPS--TIDSSFVEAWKKVAPNMDPPQTPSSFMKP  58

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            RP+T SSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG+MS
Sbjct  59   RPSTASSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPGIMS  118

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            VHEG D+ KYFVS GFAF+HANS ADIIAV
Sbjct  119  VHEGTDIKKYFVSSGFAFLHANSVADIIAV  148



>ref|XP_009400218.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 6/154 (4%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRR------PFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSA  267
            M R +SRL+ RA +    R      PFSTDLPA P+ D+ F+EAW+KV PN+DPPKTP A
Sbjct  1    MSRQASRLVTRALSGGGHRSTASFRPFSTDLPAAPSEDTAFVEAWRKVAPNIDPPKTPLA  60

Query  268  YMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKP  447
            +M PRP TPSSIPSKLTVNFV+PY SE++ KEVDMVI+PATTGQMGVLPGHVATIAELKP
Sbjct  61   FMKPRPPTPSSIPSKLTVNFVIPYQSEISNKEVDMVIVPATTGQMGVLPGHVATIAELKP  120

Query  448  GVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            GV+SVHEGN+V KYFVS GFAF+HANS  DI+AV
Sbjct  121  GVLSVHEGNEVTKYFVSSGFAFVHANSVTDIVAV  154



>ref|NP_199514.1| ATP synthase subunit delta' [Arabidopsis thaliana]
 sp|Q96252.1|ATP4_ARATH RecName: Full=ATP synthase subunit delta', mitochondrial; AltName: 
Full=F-ATPase delta' subunit; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK25885.1|AF360175_1 putative ATP synthase delta chain, mitochondrial precursor [Arabidopsis 
thaliana]
 dbj|BAA13601.1| delta-prime subunit of mitochondrial F1-ATPase [Arabidopsis thaliana]
 dbj|BAB10242.1| ATP synthase delta' chain, mitochondrial precursor [Arabidopsis 
thaliana]
 gb|AAL07198.1| putative ATP synthase delta chain, mitochondrial precursor [Arabidopsis 
thaliana]
 gb|AED95459.1| ATP synthase subunit delta' [Arabidopsis thaliana]
Length=203

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 130/153 (85%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGR---AATMR--WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            MF+ +SRLL R   AA+ +    R FST+LP+    DSTF+EAWKKV PN+DPP+TPSA+
Sbjct  1    MFKQASRLLSRSVAAASSKSVTTRAFSTELPS--TLDSTFVEAWKKVAPNMDPPQTPSAF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+TPSSIP+KLTVNFVLPY+SEL GKEVDMVIIPA+TGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTPSSIPTKLTVNFVLPYTSELTGKEVDMVIIPASTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG DV KYF+S GFAF+HANS ADIIAV
Sbjct  119  IMSVHEGTDVKKYFLSSGFAFLHANSVADIIAV  151



>ref|XP_009370943.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009376150.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Pyrus 
x bretschneideri]
Length=200

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR ++ LL R+      RPFSTD+     ADSTF +AWKKV+P+++PPKTP  +M PRP
Sbjct  1    MFRRATTLLTRSTIPLRARPFSTDVAETAPADSTFTDAWKKVVPHIEPPKTPLTFMKPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIP+KLTVNFVLPY+SEL+ KEVDMVIIPA+TG MGVLPGHVATIAELKPGVMSVH
Sbjct  61   ATPSSIPTKLTVNFVLPYASELSAKEVDMVIIPASTGHMGVLPGHVATIAELKPGVMSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG DV KYFVS GFAFIHANS ADIIAV
Sbjct  121  EGTDVTKYFVSSGFAFIHANSIADIIAV  148



>ref|XP_009114309.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Brassica 
rapa]
Length=203

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 127/153 (83%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-----RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M R +SRLL R+ T         R FST+LP+    DSTF+E+WKKV PN+DPP+TPS++
Sbjct  1    MLRQASRLLSRSVTAASSKSVTARAFSTELPS--TVDSTFVESWKKVAPNMDPPQTPSSF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+T SSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTASSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG D+ KYFVS GFAF+HANS ADIIAV
Sbjct  119  IMSVHEGTDIKKYFVSSGFAFLHANSVADIIAV  151



>gb|ABL97963.1| hydrogen-transporting ATP synthase [Brassica rapa]
Length=203

 Score =   228 bits (581),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 127/153 (83%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-----RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M R +SRLL R+ T         R FST+LP+    DSTF+E+WKKV PN+DPP+TPS++
Sbjct  1    MLRQASRLLSRSVTAASSKSVTARAFSTELPS--TVDSTFVESWKKVAPNMDPPQTPSSF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+T SSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTASSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG D+ KYFVS GFAF+HANS ADIIAV
Sbjct  119  IMSVHEGTDIKKYFVSSGFAFLHANSVADIIAV  151



>ref|XP_009371865.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Pyrus 
x bretschneideri]
Length=200

 Score =   228 bits (581),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR +SRLLGR++ +   R   T++PA    DS F+EAWKKV   ++PP+TPS YM PRP
Sbjct  1    MFRQASRLLGRSSRLPRVRAMCTEVPANSNKDSAFVEAWKKVSSTMEPPQTPSTYMEPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSS+PSKLTVNFVLPYSS+L+GKEVDMV++PATTGQMGVLPGHV TIAELKPGV+SVH
Sbjct  61   PTPSSLPSKLTVNFVLPYSSQLSGKEVDMVMVPATTGQMGVLPGHVPTIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG+DV KYFVS GFAFIHANS ADI+AV
Sbjct  121  EGSDVTKYFVSSGFAFIHANSVADIVAV  148



>ref|XP_009385938.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=201

 Score =   228 bits (581),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRA-ATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            M+RH+SR L +A      RR FSTDLPA  + D+ F+EAW+KV P++DPPKTP A+M PR
Sbjct  1    MYRHASRRLIQALGDGGRRRSFSTDLPAASSEDAAFVEAWRKVAPSIDPPKTPLAFMKPR  60

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TPSSIPSKLTVNFVLPY SE++ KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+SV
Sbjct  61   PPTPSSIPSKLTVNFVLPYQSEISNKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSV  120

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEGN+V KYFVS GFAFIHANS  DI+AV
Sbjct  121  HEGNEVTKYFVSSGFAFIHANSVTDIVAV  149



>ref|XP_010540791.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Tarenaya 
hassleriana]
Length=198

 Score =   228 bits (580),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR ++R+L R  +    R FS+D+PA  + DS F++AWKKV PN+DPP+TP ++M PRP
Sbjct  1    MFRQTARILARRTSAV--RSFSSDVPASSSVDSNFIDAWKKVAPNLDPPQTPLSFMKPRP  58

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATP+++P+KLTVNFVLPYSSEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPGV+SVH
Sbjct  59   ATPATLPTKLTVNFVLPYSSELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPGVLSVH  118

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            E NDV KYF+S GFAFIHANS ADIIAV
Sbjct  119  EDNDVKKYFLSSGFAFIHANSVADIIAV  146



>gb|KDP28899.1| hypothetical protein JCGZ_14670 [Jatropha curcas]
Length=254

 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R ++  L R       RPFSTDL A    DS F+EAWKKVIPN++PPKTP ++M PRP
Sbjct  55   MLRRATGFLARPILCGRARPFSTDLHAAQTTDSGFVEAWKKVIPNMEPPKTPLSFMQPRP  114

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSSIPSKLTVNFVLPY+SEL+ KE DMVIIPATTGQMGVLPGHV+TIAELKPGV+SVH
Sbjct  115  PTPSSIPSKLTVNFVLPYASELSNKEADMVIIPATTGQMGVLPGHVSTIAELKPGVLSVH  174

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGN+V KYFVS GFAFIHANSFADIIAV
Sbjct  175  EGNEVTKYFVSSGFAFIHANSFADIIAV  202



>ref|XP_004133965.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Cucumis 
sativus]
 ref|XP_004166612.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Cucumis 
sativus]
 gb|KGN56682.1| hypothetical protein Csa_3G128910 [Cucumis sativus]
Length=200

 Score =   227 bits (579),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR +S LL R       R FSTDLPA  +    F+ AWKKVIPN+DPPKTP ++M+PRP
Sbjct  1    MFRRASTLLARPFLSARTRSFSTDLPAAGSNQDAFVSAWKKVIPNIDPPKTPLSFMAPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATPSSIPSKLTVN VLPY+SEL+ KEVDMVIIPATTGQMGVLPGHV TIAELKPGV+SVH
Sbjct  61   ATPSSIPSKLTVNLVLPYASELSAKEVDMVIIPATTGQMGVLPGHVPTIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG+++ KYFVS GFAFIH NS+ADIIAV
Sbjct  121  EGSEIKKYFVSSGFAFIHGNSYADIIAV  148



>gb|ABK94340.1| unknown [Populus trichocarpa]
Length=207

 Score =   227 bits (579),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 123/155 (79%), Gaps = 7/155 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-------RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPS  264
            M R +SRLL R+     +       RP ST+LP  P  DS F+E+WKKV PN+DPPKTPS
Sbjct  1    MLRQASRLLTRSIATTQQPIRVMGARPMSTNLPDTPVQDSAFIESWKKVAPNIDPPKTPS  60

Query  265  AYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELK  444
            A+M PRP TPS+IPSK+TVNFVLPY+SEL  KEVDMVIIPATTGQMGVLPGHV TIAELK
Sbjct  61   AFMKPRPPTPSTIPSKITVNFVLPYASELTSKEVDMVIIPATTGQMGVLPGHVPTIAELK  120

Query  445  PGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            PGV+SVHEGNDV KYF+S GF F+HANS ADI+ V
Sbjct  121  PGVLSVHEGNDVKKYFLSSGFVFVHANSVADIVVV  155



>ref|XP_006281122.1| hypothetical protein CARUB_v10027152mg [Capsella rubella]
 gb|EOA14020.1| hypothetical protein CARUB_v10027152mg [Capsella rubella]
Length=203

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 128/153 (84%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMR-----WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            MF+ +SRLL R+  +        R FST++P+    DSTF+E+WKKV PN+DPP+TPSA+
Sbjct  1    MFKQASRLLSRSVAVASSKSATTRAFSTEVPS--TLDSTFVESWKKVAPNMDPPQTPSAF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRPATPSSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPATPSSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG D+ KYF+S GFA +HANS ADIIAV
Sbjct  119  IMSVHEGTDIKKYFLSSGFALLHANSVADIIAV  151



>ref|XP_008346511.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Malus 
domestica]
Length=200

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR +SRLLGR++     R   T++PA    DS F+EAWKKV P ++PP TPS YM PRP
Sbjct  1    MFRQASRLLGRSSRPPSVRAMCTEVPANSNKDSAFVEAWKKVSPTMEPPHTPSTYMEPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSS+PSKLTVNFVLPYSS+L+GKEVDMV++PATTGQMGVLPGHV TIAELKPGV+SVH
Sbjct  61   PTPSSLPSKLTVNFVLPYSSQLSGKEVDMVMVPATTGQMGVLPGHVPTIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG+DV KYFVS GFAFIHANS ADI+AV
Sbjct  121  EGSDVTKYFVSSGFAFIHANSVADIVAV  148



>emb|CDY33509.1| BnaA06g35640D [Brassica napus]
Length=203

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 129/153 (84%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGR---AATMR--WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M R +SRLL R   A T +    R FST++P+    DSTF+E+WKKV PN+DPP+TPS++
Sbjct  1    MLRQASRLLSRSVAAGTSKSATARGFSTEVPS--TIDSTFVESWKKVAPNMDPPQTPSSF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+T SSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTASSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG DVNKYFVS GFAF+HANS ADIIAV
Sbjct  119  IMSVHEGTDVNKYFVSSGFAFLHANSVADIIAV  151



>ref|XP_009101456.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Brassica 
rapa]
Length=203

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 129/153 (84%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGR---AATMR--WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M R +SRLL R   A T +    R FST++P+    DSTF+E+WKKV PN+DPP+TPS++
Sbjct  1    MLRQASRLLSRSVAAGTSKSATARGFSTEVPS--TIDSTFVESWKKVAPNMDPPQTPSSF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+T SSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTASSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG DVNKYFVS GFAF+HANS ADIIAV
Sbjct  119  IMSVHEGTDVNKYFVSSGFAFLHANSVADIIAV  151



>emb|CDX77730.1| BnaC07g19840D [Brassica napus]
Length=203

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRA-----ATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            MFR +SRLL R+     +     R FST++P+    DSTF+E+WKKV PN+DPP+TPS++
Sbjct  1    MFRQASRLLSRSVAAGSSKSATARAFSTEVPS--TIDSTFVESWKKVAPNMDPPQTPSSF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+T SSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTASSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG DV KYFVS GFAF+HANS ADIIAV
Sbjct  119  IMSVHEGTDVKKYFVSSGFAFLHANSVADIIAV  151



>ref|XP_009390524.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=205

 Score =   226 bits (575),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 125/153 (82%), Gaps = 5/153 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRP-----FSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M+RH+ RLL R      RR      FSTDLPA P+ D+ F+EAW+KV PN+DPPKTP A+
Sbjct  1    MYRHAPRLLTRVIGGGVRRSATARAFSTDLPAAPSEDAAFVEAWRKVAPNIDPPKTPLAF  60

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP TPSSIPSKLT+NFVLPY SE++ KEVDMVI+PATTGQMGVLPGHVATIAELKPG
Sbjct  61   MKPRPPTPSSIPSKLTINFVLPYQSEISNKEVDMVIVPATTGQMGVLPGHVATIAELKPG  120

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            ++SVHEG++V KYFVS GFAF+H NS  DI+AV
Sbjct  121  LLSVHEGSEVTKYFVSSGFAFVHGNSVTDIVAV  153



>ref|XP_006398397.1| hypothetical protein EUTSA_v10001028mg [Eutrema salsugineum]
 gb|ESQ39850.1| hypothetical protein EUTSA_v10001028mg [Eutrema salsugineum]
Length=203

 Score =   225 bits (574),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 126/153 (82%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRW-----RRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            MFR +SRLL R+           R FST+LP+    DSTF+E+WKKV PN+DPP+TPS+Y
Sbjct  1    MFRQTSRLLSRSIAAASSKSATTRAFSTELPS--TVDSTFIESWKKVAPNIDPPQTPSSY  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+  SSIP+KLTVNFVLPY+SELAGKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSIASSIPTKLTVNFVLPYTSELAGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG DV KYFVS GFAF+HANS ADIIAV
Sbjct  119  MMSVHEGTDVKKYFVSSGFAFLHANSVADIIAV  151



>ref|XP_010274560.1| PREDICTED: ATP synthase subunit delta', mitochondrial isoform 
X2 [Nelumbo nucifera]
Length=200

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR + RLL RA ++   R FSTDLPA P +DS+F+EAWKKVIPN+D PKTP ++M PRP
Sbjct  1    MFRQAPRLLARATSIMRARSFSTDLPAAPTSDSSFVEAWKKVIPNIDAPKTPLSFMQPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TP SIP KLTVNFVLPY SELA KEVDMVIIPATTGQMGVLPGHVATIAELKPG++SVH
Sbjct  61   PTPPSIPGKLTVNFVLPYQSELAAKEVDMVIIPATTGQMGVLPGHVATIAELKPGILSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV KYFVS GFAFIHANS AD++AV
Sbjct  121  EGNDVTKYFVSSGFAFIHANSIADVVAV  148



>ref|XP_010494912.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Camelina 
sativa]
Length=203

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGR---AATMR--WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            MF+ +SRLL R   AA+ +    R FS+++P+    DSTF+E+WKKV PN+DPP+TPSA+
Sbjct  1    MFKQASRLLSRSVAAASSKSVTTRAFSSEVPS--TIDSTFVESWKKVAPNMDPPQTPSAF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+TPSSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTPSSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG DV KYF+S GFA +HANS ADIIA+
Sbjct  119  IMSVHEGTDVKKYFLSSGFALLHANSVADIIAI  151



>emb|CDY03164.1| BnaC09g19920D [Brassica napus]
Length=203

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 126/153 (82%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-----RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M R +SRL+ R+ T         R FST+LP+    DSTF+E+WKKV PN+DPP+TPS++
Sbjct  1    MLRQASRLISRSVTAASSKSVTARAFSTELPS--TIDSTFVESWKKVAPNMDPPQTPSSF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+  SSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSIASSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG D+ KYFVS GFAF+HANS ADIIAV
Sbjct  119  IMSVHEGTDIKKYFVSSGFAFLHANSVADIIAV  151



>ref|XP_010441514.1| PREDICTED: ATP synthase subunit delta', mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010441515.1| PREDICTED: ATP synthase subunit delta', mitochondrial isoform 
X2 [Camelina sativa]
Length=203

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGR---AATMR--WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            MF+ +SRLL R   AA+ +    R FS+++P+    DSTF+E+WKKV PN+DPP+TPSA+
Sbjct  1    MFKQASRLLSRSVAAASSKSVTTRAFSSEVPS--TIDSTFVESWKKVAPNMDPPQTPSAF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+TPSSIP+KLTVNFVLPY+SEL GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTPSSIPTKLTVNFVLPYASELTGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG DV KYF+S GFA +HANS ADIIA+
Sbjct  119  IMSVHEGTDVKKYFLSSGFALLHANSVADIIAI  151



>emb|CDY43449.1| BnaAnng07210D [Brassica napus]
Length=203

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 127/153 (83%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-----RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M R +SRL+ R+AT         R FST+LP+    DSTF+E+WKKV PN+DPP+TPS++
Sbjct  1    MLRQASRLISRSATAASSKSVTARAFSTELPS--TIDSTFVESWKKVAPNMDPPQTPSSF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+T SSIP+KLTVNFVLPY+SEL+ KEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTASSIPTKLTVNFVLPYASELSWKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG D+ KYFVS GFAF+HANS ADIIAV
Sbjct  119  IMSVHEGTDIKKYFVSSGFAFLHANSVADIIAV  151



>ref|XP_010481382.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Camelina 
sativa]
Length=203

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGR---AATMR--WRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            MF+ +SRLL R   AA+ +    R FS+++P+    DSTF+E+WKKV PN+DPP+TPSA+
Sbjct  1    MFKQASRLLSRSIAAASSKSVTTRAFSSEVPS--TIDSTFVESWKKVAPNMDPPQTPSAF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+TPSSIP+KLTVNFVLPY+SEL+GKEVDMVIIPATTGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTPSSIPTKLTVNFVLPYASELSGKEVDMVIIPATTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG DV KYF+S GFA +HANS ADIIA+
Sbjct  119  IMSVHEGADVKKYFLSSGFALLHANSVADIIAI  151



>ref|XP_008232343.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Prunus 
mume]
Length=200

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R ++ LL R       RPFSTD+   P AD++F +AWKKVIP ++PP TP  +M PRP
Sbjct  1    MLRRATALLTRPVISLRARPFSTDVSETPVADTSFYDAWKKVIPTLEPPHTPLTFMKPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSSIP+KLTVNFVLPY+SELA KEVDMVIIPA+TG MGVLPGHVATIAELKPGV+SVH
Sbjct  61   PTPSSIPTKLTVNFVLPYNSELAAKEVDMVIIPASTGHMGVLPGHVATIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG DV KYFVS GFAFIHANS+ADIIAV
Sbjct  121  EGTDVTKYFVSSGFAFIHANSYADIIAV  148



>gb|KHG13715.1| ATP synthase subunit delta', mitochondrial [Gossypium arboreum]
Length=200

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R +  LL R       R FSTDLPA   AD+TF+EAW KV+PN+DPPKTP ++M PRP
Sbjct  1    MLRRALGLLPRPIAAARARSFSTDLPAAHTADATFMEAWNKVMPNMDPPKTPLSFMHPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSSIP KLTVNFVLPY+SEL+ KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+SVH
Sbjct  61   PTPSSIPPKLTVNFVLPYASELSTKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG++  KYFVS GF FIHANSFADIIAV
Sbjct  121  EGSETTKYFVSSGFVFIHANSFADIIAV  148



>gb|ACS83601.1| ATP synthase delta subunit 1 [Gossypium hirsutum]
Length=200

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R +  LL R       R FSTDLPA   AD+TF+EAW KV+PN DPPKTP ++M PRP
Sbjct  1    MLRRALGLLPRPIAAARARSFSTDLPAAHTADATFMEAWNKVMPNTDPPKTPLSFMHPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSSIP KLTVNFVLPY+SEL+ KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+SVH
Sbjct  61   PTPSSIPPKLTVNFVLPYASELSTKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG++  KYFVS GF FIHANSFADIIAV
Sbjct  121  EGSETTKYFVSSGFVFIHANSFADIIAV  148



>ref|XP_008786212.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Phoenix 
dactylifera]
Length=202

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 126/152 (83%), Gaps = 6/152 (4%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRP----FSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYM  273
            M+R +SRLL RA  +   RP    FSTD PA P  DS F+EAWKKV PN++PPKTP ++M
Sbjct  1    MYRQASRLLIRA--LGGGRPVGRAFSTDAPAVPVEDSAFVEAWKKVAPNLEPPKTPLSFM  58

Query  274  SPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGV  453
             PRP TPSSIPSKLTVNFVLPY SE++ KEVDM+I+PATTGQMGVLPGHVATIAELKPGV
Sbjct  59   KPRPPTPSSIPSKLTVNFVLPYQSEISNKEVDMIIVPATTGQMGVLPGHVATIAELKPGV  118

Query  454  MSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +SVH+GN+V KYFVS GFAFIHANS  D++AV
Sbjct  119  LSVHDGNEVTKYFVSSGFAFIHANSITDVVAV  150



>gb|KJB22816.1| hypothetical protein B456_004G068100 [Gossypium raimondii]
 gb|KJB22817.1| hypothetical protein B456_004G068100 [Gossypium raimondii]
Length=200

 Score =   223 bits (568),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R +  LL R       R FSTDLPA   AD+TF+EAW KV+PN+DPPKTP ++M PRP
Sbjct  1    MLRRALGLLPRPIAAARARSFSTDLPAAHTADATFMEAWNKVMPNMDPPKTPLSFMHPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSSIP KLTVNFVLPY+SEL+ KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+SVH
Sbjct  61   PTPSSIPPKLTVNFVLPYASELSTKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG++  KYFVS GF FIHANSFADIIAV
Sbjct  121  EGSETTKYFVSSGFVFIHANSFADIIAV  148



>ref|XP_007218442.1| hypothetical protein PRUPE_ppa011691mg [Prunus persica]
 gb|EMJ19641.1| hypothetical protein PRUPE_ppa011691mg [Prunus persica]
Length=200

 Score =   223 bits (567),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R ++ LL R       RPFSTD+   P AD++F +AWKKVIP ++PP TP  +M PRP
Sbjct  1    MLRRATALLTRPVISLRARPFSTDVSEIPVADTSFYDAWKKVIPTLEPPHTPLTFMKPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSSIP+KLTVNFVLPY+SELA KEVDMVIIPA+TG MGVLPGHVATIAELKPGV+SVH
Sbjct  61   PTPSSIPTKLTVNFVLPYNSELAAKEVDMVIIPASTGHMGVLPGHVATIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG DV KYFVS GFAFIHANS+ADIIAV
Sbjct  121  EGTDVTKYFVSSGFAFIHANSYADIIAV  148



>ref|XP_010056469.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Eucalyptus 
grandis]
 gb|KCW73234.1| hypothetical protein EUGRSUZ_E01702 [Eucalyptus grandis]
Length=212

 Score =   223 bits (567),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 128/166 (77%), Gaps = 24/166 (14%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRP------------------FSTDLPAEPAADSTFLEAWKKV  231
            MFRH+++       +  RRP                  FS D PA   AD+ F+EAWKKV
Sbjct  1    MFRHAAK------NLLLRRPVPTTSAAGAAAARAPSRTFSADAPAAQTADAGFVEAWKKV  54

Query  232  IPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVL  411
            +PN+DPPKTP ++M PRPATP+SIPSKLTVNFVLPY+SEL+ KEVDMVI+PATTG++GVL
Sbjct  55   VPNIDPPKTPLSFMEPRPATPASIPSKLTVNFVLPYASELSKKEVDMVIVPATTGELGVL  114

Query  412  PGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            PGHVATIAELKPGVMSVH+GN+V KYFVS GFAF+HANSFADIIAV
Sbjct  115  PGHVATIAELKPGVMSVHDGNEVTKYFVSSGFAFVHANSFADIIAV  160



>ref|XP_010933544.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Elaeis 
guineensis]
Length=202

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 125/152 (82%), Gaps = 6/152 (4%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRP----FSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYM  273
            M+R +SRLL RA  +   RP    FST+ PA P  DS F+EAWKKV PN+DPPKTP ++M
Sbjct  1    MYRQASRLLFRA--LGGGRPVGRAFSTNAPAVPVEDSAFVEAWKKVAPNLDPPKTPLSFM  58

Query  274  SPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGV  453
             PRP TPSSIPSKLTVNFVLPY SE++ KEVDMVI+PATTGQMGVLPGHVATIAELKPG+
Sbjct  59   KPRPPTPSSIPSKLTVNFVLPYQSEISNKEVDMVIVPATTGQMGVLPGHVATIAELKPGI  118

Query  454  MSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +SVH+GN+  KYFVS GFAFIHANS  DI+AV
Sbjct  119  LSVHDGNEATKYFVSSGFAFIHANSITDIVAV  150



>ref|XP_006375197.1| H+-transporting two-sector ATPase family protein [Populus trichocarpa]
 gb|ERP52994.1| H+-transporting two-sector ATPase family protein [Populus trichocarpa]
Length=198

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 4/149 (3%)
 Frame = +1

Query  106  MFRHSSR-LLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFR ++  +L R  T+R R  FST LPA    DSTF EAWKKV PN+DPPKTP ++M PR
Sbjct  1    MFRRATTGILAR--TIRARL-FSTGLPAAQTIDSTFAEAWKKVAPNLDPPKTPLSFMQPR  57

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TPS+IPSKLTVNFVLPY+SE++GKEVDMVIIPA+TGQMGVLPGHV+TI ELKPGV+SV
Sbjct  58   PPTPSAIPSKLTVNFVLPYASEISGKEVDMVIIPASTGQMGVLPGHVSTITELKPGVLSV  117

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEGN+V KYFVS GFAFIHANS ADI+AV
Sbjct  118  HEGNEVKKYFVSSGFAFIHANSIADIVAV  146



>ref|XP_009369681.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Pyrus 
x bretschneideri]
Length=200

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR +SRLLGR++     R   T++PA    DS F+EAWKKV    +PP TPS YM PRP
Sbjct  1    MFRQASRLLGRSSRPPRVRAMCTEVPANSNKDSAFVEAWKKVSSTTEPPHTPSTYMGPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPSS+PSKLTVNFVLPYSS+L+GKEVDMV++PATTGQMGVLPGHV TIAELKPGV+SVH
Sbjct  61   PTPSSLPSKLTVNFVLPYSSQLSGKEVDMVMVPATTGQMGVLPGHVPTIAELKPGVLSVH  120

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG+DV KYFVS GFAFIH NS ADI+AV
Sbjct  121  EGSDVTKYFVSSGFAFIHENSVADIVAV  148



>ref|XP_008229506.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Prunus 
mume]
Length=203

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPA-EPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFR +SRLLGR       R   T++PA  P ADS F+E+WKKVIP +DPPKTPS YM PR
Sbjct  3    MFRQASRLLGRPPCPSRIRALCTEVPAANPNADSAFIESWKKVIPIMDPPKTPSTYMEPR  62

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TPSS+PSKLT+NFVLPYSSEL+GKEVDMV++PATTGQMGVLPGHVATIAELKPG++SV
Sbjct  63   PPTPSSLPSKLTINFVLPYSSELSGKEVDMVMVPATTGQMGVLPGHVATIAELKPGILSV  122

Query  463  HEGNDVNKYFVSGGFAFIHANS  528
            HEG++V KYFVS GFAFIHANS
Sbjct  123  HEGSEVTKYFVSSGFAFIHANS  144



>ref|XP_002865149.1| ATP synthase delta [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41408.1| ATP synthase delta [Arabidopsis lyrata subsp. lyrata]
Length=203

 Score =   221 bits (562),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 126/153 (82%), Gaps = 7/153 (5%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRW-----RRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M + +SRLL R+           R FST+LP+    DSTF+EAWKKV PN++PP+TPSA+
Sbjct  1    MLKQASRLLSRSVAAASAKSATTRAFSTELPS--TLDSTFVEAWKKVAPNMEPPQTPSAF  58

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP+TPSSIP+KLTVNFVLPY+SEL GKEVDMVIIPA+TGQMGVLPGHV TIAELKPG
Sbjct  59   MKPRPSTPSSIPTKLTVNFVLPYTSELTGKEVDMVIIPASTGQMGVLPGHVPTIAELKPG  118

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +MSVHEG DV KYF+S GFAF+HANS ADIIAV
Sbjct  119  IMSVHEGTDVKKYFLSSGFAFLHANSVADIIAV  151



>ref|XP_011032752.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Populus 
euphratica]
Length=198

 Score =   220 bits (560),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 123/149 (83%), Gaps = 4/149 (3%)
 Frame = +1

Query  106  MFRHSSR-LLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFR ++  +L R    R    FST LPA    DSTF EAWKKV PN+DPPKTP ++M PR
Sbjct  1    MFRRATTGILARNIRARL---FSTGLPAAQTIDSTFAEAWKKVAPNLDPPKTPLSFMQPR  57

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TPS+IPSKLTVNFVLPY+SE++GKEVDMVIIPA+TGQMGVLPGHV+TI ELKPGV+SV
Sbjct  58   PPTPSAIPSKLTVNFVLPYASEISGKEVDMVIIPASTGQMGVLPGHVSTITELKPGVLSV  117

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEGN+V KYFVS GFAFIHANS ADI+AV
Sbjct  118  HEGNEVKKYFVSSGFAFIHANSMADIVAV  146



>gb|ACN26750.1| unknown [Zea mays]
 tpg|DAA40912.1| TPA: ATP synthase delta chain [Zea mays]
Length=203

 Score =   220 bits (560),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = +1

Query  106  MFRHSSR-LLGRA-ATMRWRRPFST-DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMS  276
            M RH++R L+ RA A    RR  +T ++PAE   DSTF+EAWKKV PN++PP TP + M 
Sbjct  1    MLRHAARRLVSRAVAPPTARRALATAEVPAEAVEDSTFVEAWKKVAPNIEPPATPLSLMQ  60

Query  277  PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVM  456
            PRP TP++IP+KLTVNFVLPY SE+A KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+
Sbjct  61   PRPPTPATIPTKLTVNFVLPYKSEIANKEVDMVIVPATTGQMGVLPGHVATIAELKPGVL  120

Query  457  SVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            SVHEGNDV+KYFVS GFAF+HANS ADI+AV
Sbjct  121  SVHEGNDVSKYFVSSGFAFVHANSIADIVAV  151



>ref|NP_001147558.1| ATP synthase delta chain [Zea mays]
 gb|ACG27922.1| ATP synthase delta chain [Zea mays]
Length=203

 Score =   220 bits (560),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = +1

Query  106  MFRHSSR-LLGRA-ATMRWRRPFST-DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMS  276
            M RH++R L+ RA A    RR  +T ++PAE   DSTF+EAWKKV PN++PP TP + M 
Sbjct  1    MLRHAARRLVSRAVAPPTARRALATAEVPAEAVEDSTFVEAWKKVAPNIEPPATPLSLMQ  60

Query  277  PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVM  456
            PRP TP++IP+KLTVNFVLPY SE+A KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+
Sbjct  61   PRPPTPATIPTKLTVNFVLPYKSEIANKEVDMVIVPATTGQMGVLPGHVATIAELKPGVL  120

Query  457  SVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            SVHEGNDV+KYFVS GFAF+HANS ADI+AV
Sbjct  121  SVHEGNDVSKYFVSSGFAFVHANSIADIVAV  151



>ref|XP_008788654.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Phoenix 
dactylifera]
Length=206

 Score =   220 bits (560),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 6/154 (4%)
 Frame = +1

Query  106  MFRHSSRLLGRA------ATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSA  267
            M+R +SR L R+       T    R FSTD+ A PA D+ F+EAWKKV PN++PPKTP A
Sbjct  1    MYRQASRFLIRSLGASRRRTAAAPRAFSTDVLAAPAEDAAFVEAWKKVAPNMEPPKTPLA  60

Query  268  YMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKP  447
            +M PRP TPSSIPSKLT+NFVLPY SE++ KEVDMVIIPATTGQMGVLPGHVATIAELKP
Sbjct  61   FMKPRPPTPSSIPSKLTLNFVLPYQSEISNKEVDMVIIPATTGQMGVLPGHVATIAELKP  120

Query  448  GVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            G+++VHEG++V KYFVS GFAFIHANSFADI+AV
Sbjct  121  GLLTVHEGSEVTKYFVSSGFAFIHANSFADIVAV  154



>ref|XP_004307265.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=204

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 128/156 (82%), Gaps = 12/156 (8%)
 Frame = +1

Query  106  MFRHSSRLLGR--AATMRWRRPFST------DLPAEPAADSTFLEAWKKVIPNVDPPKTP  261
            M R ++ LL R  ++++R  R FST      D PA PA    F EAWKKV+P+++PPKTP
Sbjct  1    MLRRATALLTRPASSSLRAARAFSTEVAEAGDAPANPA----FNEAWKKVVPHIEPPKTP  56

Query  262  SAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAEL  441
             ++M PRPA PSSIP+KLTVNFVLPY+SEL+ KEVDMVIIPA+TGQMGVLPGHVATIAEL
Sbjct  57   LSFMKPRPAVPSSIPTKLTVNFVLPYASELSAKEVDMVIIPASTGQMGVLPGHVATIAEL  116

Query  442  KPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            KPG++SVHEGNDV KYFVS GFAFIHANS+ADIIAV
Sbjct  117  KPGILSVHEGNDVTKYFVSSGFAFIHANSYADIIAV  152



>ref|XP_004516996.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Cicer 
arietinum]
Length=197

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 125/149 (84%), Gaps = 5/149 (3%)
 Frame = +1

Query  106  MFRH-SSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFR  +S  L RAA+ R    FSTD+ A PAADS+F+EAWKKV PN+DPPKTP  +M PR
Sbjct  1    MFRRATSTFLSRAASTRR---FSTDV-ATPAADSSFIEAWKKVSPNLDPPKTPIEFMKPR  56

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TPS++P+KLTVNFVLPY+S+LA KEVDMV IPATTGQMGVLPGHVATIAELKPGV+SV
Sbjct  57   PPTPSTLPTKLTVNFVLPYASQLAAKEVDMVNIPATTGQMGVLPGHVATIAELKPGVLSV  116

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEG++  KYFVS GFAFIHANS  DIIAV
Sbjct  117  HEGSETTKYFVSSGFAFIHANSVTDIIAV  145



>ref|XP_010919828.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Elaeis 
guineensis]
Length=205

 Score =   218 bits (555),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 123/153 (80%), Gaps = 5/153 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRA-----ATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M+R + RLL RA           R FST +P  P  DS F+EAWKKV PN++PPKTP ++
Sbjct  1    MYRQAPRLLIRALDGGRGGRLIGRAFSTGVPVAPVEDSAFVEAWKKVAPNLEPPKTPLSF  60

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP TPSSIPSKLTVNFVLPY SE++ KEVDMVI+PATTGQMGVLPGHVATIAELKPG
Sbjct  61   MKPRPPTPSSIPSKLTVNFVLPYQSEISNKEVDMVIVPATTGQMGVLPGHVATIAELKPG  120

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            ++SVH+GN+V KYFVS GFAFIHANS ADI+AV
Sbjct  121  LLSVHDGNEVTKYFVSSGFAFIHANSIADIVAV  153



>gb|AFK44473.1| unknown [Lotus japonicus]
Length=199

 Score =   218 bits (554),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = +1

Query  106  MFRH-SSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFR  +S L+ RAA    R  FSTD+ A  AA S F +AWKKV PNVDPPKTP  +M PR
Sbjct  1    MFRRATSSLVARAAANTRR--FSTDVGAPAAAGSNFEDAWKKVSPNVDPPKTPLEFMKPR  58

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TP+++P+KLTVNFVLPYSS+L+ KEVDMVI+PATTGQMGVLPGHVATIAELKPG++SV
Sbjct  59   PPTPNTLPTKLTVNFVLPYSSQLSSKEVDMVIVPATTGQMGVLPGHVATIAELKPGLLSV  118

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEGNDV KYFVS GFAF+HANS ADIIAV
Sbjct  119  HEGNDVTKYFVSSGFAFVHANSVADIIAV  147



>gb|KDP45971.1| hypothetical protein JCGZ_11874 [Jatropha curcas]
Length=184

 Score =   217 bits (552),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +1

Query  166  FSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSS  345
            FST++PA P  DSTF+E+WKK  PN++PPKTPSA+M PRP TPS+IPSKLTVNFVLPY+S
Sbjct  5    FSTEVPATPTVDSTFVESWKKAAPNMEPPKTPSAFMQPRPPTPSTIPSKLTVNFVLPYAS  64

Query  346  ELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHAN  525
            +L+ KEVDM+IIPATTGQMGVLPGHV TIAELKPGV+SVHEGND  KYF+S GFAFIHAN
Sbjct  65   QLSNKEVDMIIIPATTGQMGVLPGHVPTIAELKPGVLSVHEGNDTTKYFLSSGFAFIHAN  124

Query  526  SFADIIAV  549
            S ADIIA+
Sbjct  125  SVADIIAI  132



>ref|XP_008794858.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Phoenix 
dactylifera]
Length=205

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 123/153 (80%), Gaps = 5/153 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRA-----ATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            M+R + RLL RA           R FSTD+PA    DS F+EAWKKV PN++PPKTP ++
Sbjct  1    MYRQAPRLLIRALDGGRGGRLIGRAFSTDVPAASVEDSAFVEAWKKVAPNLEPPKTPLSF  60

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP TPSSIPSKLTVNFVLPY SE++ KEV+MVI+PATTGQMGVLPGHVATIAELKPG
Sbjct  61   MRPRPPTPSSIPSKLTVNFVLPYQSEISNKEVEMVIVPATTGQMGVLPGHVATIAELKPG  120

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            V+SVH+GN+V KY VS GFAFIHANS ADI+AV
Sbjct  121  VLSVHDGNEVTKYVVSSGFAFIHANSIADIVAV  153



>ref|XP_007134380.1| hypothetical protein PHAVU_010G042900g [Phaseolus vulgaris]
 gb|ESW06374.1| hypothetical protein PHAVU_010G042900g [Phaseolus vulgaris]
Length=197

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 122/148 (82%), Gaps = 4/148 (3%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            + R +S LL   +    RR  STD PA P  +S+F EAWKKV PN++PPKTP ++M  RP
Sbjct  2    LRRATSSLLSGVS----RRRLSTDAPATPVVNSSFAEAWKKVSPNLEPPKTPLSFMKARP  57

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
             TPS++PSKLTVNFVLPY+S+L+ KEVDMVI+PATTG+MGVLPGHVATIAELKPGV+SVH
Sbjct  58   PTPSALPSKLTVNFVLPYASQLSAKEVDMVIVPATTGEMGVLPGHVATIAELKPGVLSVH  117

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGNDV KYFVS GFAFIHANS ADIIAV
Sbjct  118  EGNDVTKYFVSSGFAFIHANSVADIIAV  145



>ref|NP_001130528.1| uncharacterized protein LOC100191627 [Zea mays]
 gb|ACF78778.1| unknown [Zea mays]
 gb|ACG48306.1| ATP synthase delta chain [Zea mays]
 tpg|DAA62801.1| TPA: ATP synthase delta chain [Zea mays]
Length=203

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 119/151 (79%), Gaps = 3/151 (2%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRP---FSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMS  276
            M RH++R L               + ++PAE A DSTF+EAWKKV PN++PP TP   M 
Sbjct  1    MLRHAARRLVSRTAAAPTARRALVTAEVPAEAAEDSTFVEAWKKVAPNIEPPTTPLFLMQ  60

Query  277  PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVM  456
            PRP TP++IP+KLTVNFVLPY SE+A KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+
Sbjct  61   PRPPTPATIPTKLTVNFVLPYKSEIANKEVDMVIVPATTGQMGVLPGHVATIAELKPGVL  120

Query  457  SVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            SVHEGNDV KYFVS GFAF+HANS ADI+AV
Sbjct  121  SVHEGNDVTKYFVSSGFAFVHANSIADIVAV  151



>ref|XP_006836816.1| hypothetical protein AMTR_s00099p00037820 [Amborella trichopoda]
 gb|ERM99669.1| hypothetical protein AMTR_s00099p00037820 [Amborella trichopoda]
Length=195

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELA  354
            D+PA P  DS+F++AW+K+ PN+DPPKTP A+M+PRP TPSSIPSKLTVNFVLPY SELA
Sbjct  19   DVPATPTQDSSFVQAWQKINPNLDPPKTPLAFMTPRPPTPSSIPSKLTVNFVLPYQSELA  78

Query  355  GKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFA  534
             KEVDMVIIPATTG MGVLPGHVATIAEL+PG++SVHEG+ V KYFVS GFAFIHANSFA
Sbjct  79   SKEVDMVIIPATTGHMGVLPGHVATIAELRPGILSVHEGSSVTKYFVSSGFAFIHANSFA  138

Query  535  DIIAV  549
            DI+AV
Sbjct  139  DIVAV  143



>ref|XP_010274559.1| PREDICTED: ATP synthase subunit delta', mitochondrial isoform 
X1 [Nelumbo nucifera]
Length=218

 Score =   211 bits (538),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 127/166 (77%), Gaps = 18/166 (11%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            MFR + RLL RA ++   R FSTDLPA P +DS+F+EAWKKVIPN+D PKTP ++M PRP
Sbjct  1    MFRQAPRLLARATSIMRARSFSTDLPAAPTSDSSFVEAWKKVIPNIDAPKTPLSFMQPRP  60

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKE------------------VDMVIIPATTGQMGVL  411
             TP SIP KLTVNFVLPY SELA KE                  VDMVIIPATTGQMGVL
Sbjct  61   PTPPSIPGKLTVNFVLPYQSELAAKEGRLVQILGLPNWRSLVHWVDMVIIPATTGQMGVL  120

Query  412  PGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            PGHVATIAELKPG++SVHEGNDV KYFVS GFAFIHANS AD++AV
Sbjct  121  PGHVATIAELKPGILSVHEGNDVTKYFVSSGFAFIHANSIADVVAV  166



>ref|XP_002460732.1| hypothetical protein SORBIDRAFT_02g033950 [Sorghum bicolor]
 gb|EER97253.1| hypothetical protein SORBIDRAFT_02g033950 [Sorghum bicolor]
Length=203

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +1

Query  106  MFRHSSRLL---GRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMS  276
            M RH++R L     AA    R   + ++PAE   DSTF+EAW+KV PN++PP TP + M 
Sbjct  1    MLRHAARRLVSRTAAAAPARRALATAEVPAEAGEDSTFVEAWRKVAPNLEPPTTPLSLMK  60

Query  277  PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVM  456
            PRP TP++IP+KLTVNFVLPY SE+A KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+
Sbjct  61   PRPPTPATIPTKLTVNFVLPYKSEIANKEVDMVIVPATTGQMGVLPGHVATIAELKPGVL  120

Query  457  SVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            SVHEGNDV KYFVS GFAF+HANS ADI+AV
Sbjct  121  SVHEGNDVTKYFVSSGFAFVHANSIADIVAV  151



>ref|XP_004957771.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Setaria 
italica]
Length=203

 Score =   210 bits (534),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 123/151 (81%), Gaps = 3/151 (2%)
 Frame = +1

Query  106  MFRHSSR-LLGRAATM-RWRRPFSTDLPAEPAA-DSTFLEAWKKVIPNVDPPKTPSAYMS  276
            M RH++R L+ RAA     RR  +T      AA DSTF+EAWKKV PN++PP TP + M 
Sbjct  1    MLRHAARRLVSRAAVAPTARRALATAEVPAAAAEDSTFVEAWKKVAPNIEPPSTPMSLMQ  60

Query  277  PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVM  456
            PRP TP++IP+KLTVNFVLPY SE+A KEVDMVI+PATTGQMGVLPGHVATIAELKPGV+
Sbjct  61   PRPPTPATIPTKLTVNFVLPYKSEIANKEVDMVIVPATTGQMGVLPGHVATIAELKPGVL  120

Query  457  SVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            SVHEGNDV KYFVS GFAF+HANS ADI+AV
Sbjct  121  SVHEGNDVTKYFVSSGFAFVHANSIADIVAV  151



>ref|XP_010677211.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=200

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 118/149 (79%), Gaps = 2/149 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPA-EPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFR +S  L R+   R+    + ++PA E    S F E WKK+IPN+DPPKTPS+YM PR
Sbjct  1    MFRQASAHLLRSGKSRFLST-AAEVPATENVGVSAFSEKWKKMIPNIDPPKTPSSYMKPR  59

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P TPS+IPSKL +N  LPYSS L+ KEVDM+I+PATTGQMGVLPGHVATIAELKPG+MSV
Sbjct  60   PPTPSTIPSKLKINVALPYSSMLSSKEVDMIIVPATTGQMGVLPGHVATIAELKPGIMSV  119

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HEGNDV KYF+S GFAFIH NS ADI+A+
Sbjct  120  HEGNDVTKYFISSGFAFIHQNSVADIVAI  148



>ref|XP_003626769.1| ATP synthase delta subunit [Medicago truncatula]
 gb|AET01245.1| F0F1-type ATP synthase, epsilon subunit [Medicago truncatula]
Length=197

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 119/149 (80%), Gaps = 5/149 (3%)
 Frame = +1

Query  106  MFRH-SSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFR  +S L  RA   R    FSTD+ A P  DS+F+EAW KV PN+DPPKTP A++  R
Sbjct  1    MFRRATSSLFSRAVATRR---FSTDV-ATPVTDSSFVEAWNKVSPNLDPPKTPVAFIKSR  56

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P  PS++P+KLTVNFVLPY+S+L+ KEVD+VIIPATTGQMG+LPGHV+TIAELKPGVM V
Sbjct  57   PPIPSTLPTKLTVNFVLPYASQLSAKEVDLVIIPATTGQMGILPGHVSTIAELKPGVMIV  116

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             EGND  KYFVS GFAF+HANS ADIIAV
Sbjct  117  QEGNDSTKYFVSSGFAFVHANSVADIIAV  145



>ref|NP_001059694.1| Os07g0495200 [Oryza sativa Japonica Group]
 dbj|BAC21366.1| putative ATP synthase delta' chain, mitochondrial precursor [Oryza 
sativa Japonica Group]
 dbj|BAD30401.1| putative ATP synthase delta' chain, mitochondrial precursor [Oryza 
sativa Japonica Group]
 dbj|BAF21608.1| Os07g0495200 [Oryza sativa Japonica Group]
 gb|EAZ03944.1| hypothetical protein OsI_26080 [Oryza sativa Indica Group]
 dbj|BAG92249.1| unnamed protein product [Oryza sativa Japonica Group]
Length=205

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  STDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSE  348
            + ++PAE A DS F EAWKKV PN++ P TP + M PRP TP++IPSKLTVNFVLPY SE
Sbjct  27   TAEVPAEAATDSAFAEAWKKVAPNIEAPATPMSLMQPRPPTPAAIPSKLTVNFVLPYKSE  86

Query  349  LAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANS  528
            +A KEVDMVI+PATTGQMGVLPGHV+TIAELKPGV+SVHEGND+ KYFVS GFAF+HANS
Sbjct  87   IANKEVDMVIVPATTGQMGVLPGHVSTIAELKPGVLSVHEGNDITKYFVSSGFAFVHANS  146

Query  529  FADIIAV  549
             ADI+AV
Sbjct  147  IADIVAV  153



>emb|CDP09388.1| unnamed protein product [Coffea canephora]
Length=198

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 122/149 (82%), Gaps = 4/149 (3%)
 Frame = +1

Query  106  MFRH-SSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            M RH ++RLL R+   R   PFST++ A  AAD  F++AW+  IPN++PPKTP ++M PR
Sbjct  1    MLRHFTTRLLSRSIKFR---PFSTNVAAASAADDAFVKAWRSTIPNLEPPKTPLSFMQPR  57

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P  PS++PSKLTVN VLPYSSE + KEVDMVIIPAT GQMG+LPGHV+TIAELKPG++SV
Sbjct  58   PPAPSTLPSKLTVNLVLPYSSEFSNKEVDMVIIPATNGQMGILPGHVSTIAELKPGLLSV  117

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            HE N V KYFVSGGFAFIHANSFADIIAV
Sbjct  118  HEENGVKKYFVSGGFAFIHANSFADIIAV  146



>sp|Q41000.1|ATP4_PEA RecName: Full=ATP synthase subunit delta', mitochondrial; AltName: 
Full=F-ATPase delta' subunit; Flags: Precursor [Pisum 
sativum]
 gb|AAA33646.1| F1-ATPase delta-prime subunit [Pisum sativum]
Length=197

 Score =   205 bits (522),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 119/149 (80%), Gaps = 5/149 (3%)
 Frame = +1

Query  106  MFRH-SSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            MFR  +S  L RA+  R    FSTD+ A PA +S+F+EAW+KV PN+DPPKTP  ++  R
Sbjct  1    MFRRATSTFLSRASATRR---FSTDV-ATPATNSSFVEAWRKVSPNIDPPKTPLEFLKTR  56

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV  462
            P  PS+IP+KLTVNFVLPYSS+LA KEVD VIIPATTG+MGVLPGHVATIAELKPGV++V
Sbjct  57   PPVPSTIPTKLTVNFVLPYSSQLAAKEVDSVIIPATTGEMGVLPGHVATIAELKPGVLTV  116

Query  463  HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             EG D  KYFVS GF FIHANS ADIIAV
Sbjct  117  QEGTDTTKYFVSSGFRFIHANSVADIIAV  145



>ref|XP_004301716.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Fragaria 
vesca subsp. vesca]
Length=200

 Score =   205 bits (521),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +1

Query  163  PFSTDLPAEPA-ADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPY  339
            PF T++PA  A  +    EAWKKV+PN+DPP+TPS YM PRP  PSS+PSK+TVNFVLPY
Sbjct  19   PFCTEVPAPIAPTNPALAEAWKKVMPNMDPPRTPSTYMEPRPPVPSSLPSKMTVNFVLPY  78

Query  340  SSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIH  519
            SSEL+GKEVDMV+IP TTGQMGVLPGHVATIAELKPGV+SV++G+DV KYF+S GFAFIH
Sbjct  79   SSELSGKEVDMVMIPTTTGQMGVLPGHVATIAELKPGVLSVYDGSDVKKYFISSGFAFIH  138

Query  520  ANSFADIIAV  549
            ANS ADIIAV
Sbjct  139  ANSVADIIAV  148



>gb|ABK22219.1| unknown [Picea sitchensis]
 gb|ACN40558.1| unknown [Picea sitchensis]
Length=213

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 116/146 (79%), Gaps = 2/146 (1%)
 Frame = +1

Query  118  SSRLLGRAATMRWRRPFSTDLPAEP--AADSTFLEAWKKVIPNVDPPKTPSAYMSPRPAT  291
            SS  +G +  +  RR F+ + PA    AA   F+ AWKKV PN++PPKTP  +M PRP  
Sbjct  16   SSVRVGGSGAVAGRRGFADNTPATATDAAHQDFITAWKKVAPNMEPPKTPLTFMKPRPVV  75

Query  292  PSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEG  471
            P SIP+KLT+NFVLPY  EL+ KEVDMVI+PATTGQMG+LPGHVATIAELKPG++SVHEG
Sbjct  76   PGSIPTKLTINFVLPYQVELSSKEVDMVIVPATTGQMGILPGHVATIAELKPGLLSVHEG  135

Query  472  NDVNKYFVSGGFAFIHANSFADIIAV  549
            +DVNKYFVS GFAFIHANS+ DIIAV
Sbjct  136  SDVNKYFVSSGFAFIHANSYTDIIAV  161



>gb|ABK22036.1| unknown [Picea sitchensis]
 gb|ACN40471.1| unknown [Picea sitchensis]
Length=213

 Score =   203 bits (517),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +1

Query  157  RRPFSTDLPAEP--AADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFV  330
            RR F+ + PA    AA   F+ AWKKV PN++PPKTP  +M PRPA P SIP+KLT+NFV
Sbjct  29   RRGFADNTPATATDAAHQDFITAWKKVAPNMEPPKTPLTFMKPRPAVPGSIPTKLTINFV  88

Query  331  LPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFA  510
            LPY  EL+ KEVDMVI+PATTGQMG+LPGHVATIAELKPG++SVHEG+DVNKYFVS GFA
Sbjct  89   LPYQVELSSKEVDMVIVPATTGQMGILPGHVATIAELKPGLLSVHEGSDVNKYFVSSGFA  148

Query  511  FIHANSFADIIAV  549
            FIHANS+ DIIAV
Sbjct  149  FIHANSYTDIIAV  161



>ref|XP_003563079.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Brachypodium 
distachyon]
Length=206

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  157  RRPFST-DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVL  333
            RR  +T ++PAE   D  FLEAWKKV   ++PP+TP A M PRP TP+SIPSKLTVNFVL
Sbjct  23   RRALATAEVPAEAGEDPAFLEAWKKVTTIIEPPQTPLAAMKPRPPTPASIPSKLTVNFVL  82

Query  334  PYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAF  513
            PY SE+  KEVDM+++PATTG MG+LPGHV+TIAELKPGV+SVHEGNDV KYFVS GFAF
Sbjct  83   PYKSEIDNKEVDMIMVPATTGLMGILPGHVSTIAELKPGVLSVHEGNDVTKYFVSSGFAF  142

Query  514  IHANSFADIIAV  549
            +HANS  D++AV
Sbjct  143  VHANSITDVVAV  154



>ref|XP_006658574.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Oryza 
brachyantha]
Length=170

 Score =   191 bits (486),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  214  EAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATT  393
            EAWKKV PN++ P TP + M PRP TP++IPSKLT+NFVLPY SE+A KEVDMVI+PATT
Sbjct  7    EAWKKVAPNIEAPATPLSLMQPRPPTPAAIPSKLTINFVLPYKSEIANKEVDMVIVPATT  66

Query  394  GQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            GQMGVLPGHV+TIAELKPGV+SVHEGND+ KYFVS GFAF+HANS ADI+AV
Sbjct  67   GQMGVLPGHVSTIAELKPGVLSVHEGNDITKYFVSSGFAFVHANSIADIVAV  118



>ref|XP_008365889.1| PREDICTED: LOW QUALITY PROTEIN: ATP synthase subunit delta', 
mitochondrial-like [Malus domestica]
Length=197

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 110/148 (74%), Gaps = 3/148 (2%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M R ++ LL R+A     RPFST++ A   AD T    WKKV+P+++PPKTP  +M PR 
Sbjct  1    MLRRATTLLTRSAIPXKARPFSTNVSATAPADFT---XWKKVVPHIEPPKTPLTFMKPRH  57

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            ATP  IP+K TVNFVLPY+SEL  KEVDMVII   TG M VLPGHVAT AELKPG +SVH
Sbjct  58   ATPLLIPTKFTVNFVLPYASELXAKEVDMVIIRTGTGHMDVLPGHVATFAELKPGXISVH  117

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG DV KYFVS GFAFIHANS ADIIAV
Sbjct  118  EGTDVKKYFVSSGFAFIHANSIADIIAV  145



>ref|XP_011085472.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Sesamum 
indicum]
Length=198

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 10/152 (7%)
 Frame = +1

Query  106  MFRHSS-RLLGRAATMRWRRPFST-DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSP  279
            MFR  + RLL         RPFS+ ++P EP AD  F+ AW++++PN+DPP+TP A+M P
Sbjct  1    MFRRVAVRLLSHL------RPFSSSEVPTEPVADDLFMAAWRRIVPNLDPPRTPLAFMRP  54

Query  280  RPATPS--SIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGV  453
            RP+T S  S PSKLT+N V  YSS L+ K+VDMVI+PATTGQMG+LPGHVA+I+ELK G+
Sbjct  55   RPSTASAASTPSKLTINLVSHYSSALSNKQVDMVIVPATTGQMGILPGHVASISELKAGL  114

Query  454  MSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +S+HEG++V KYF+S GF F+H+NS  DIIA+
Sbjct  115  LSIHEGDEVTKYFISSGFVFVHSNSVTDIIAI  146



>ref|XP_001780880.1| predicted protein [Physcomitrella patens]
 gb|EDQ54286.1| predicted protein, partial [Physcomitrella patens]
Length=164

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +1

Query  208  FLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPA  387
            F E WKK+ PN D P  PS YM+ RP+ PS++P+KLTVNFVLP+  E+  KEVDMVI+PA
Sbjct  1    FKEDWKKIAPNYDLPHFPSEYMNARPSVPSTLPAKLTVNFVLPHQFEMQAKEVDMVIVPA  60

Query  388  TTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            T+GQMGVLPGHV TIAELKPG+MSVHEG+DV +YFVS GFAF+HANS ADI+A+
Sbjct  61   TSGQMGVLPGHVPTIAELKPGLMSVHEGSDVKQYFVSSGFAFVHANSVADIVAI  114



>gb|EMT19627.1| ATP synthase subunit delta', mitochondrial [Aegilops tauschii]
Length=223

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 107/169 (63%), Gaps = 38/169 (22%)
 Frame = +1

Query  157  RRPFST-DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVL  333
            RR  +T   PAE   D  FLEAWKKV   ++PP+TP + M PRP TP+SIPSKLTVNFVL
Sbjct  3    RRALATAQAPAEAGEDPAFLEAWKKVTTIIEPPQTPMSAMKPRPPTPASIPSKLTVNFVL  62

Query  334  PYSSELAGKE-------------------------------------VDMVIIPATTGQM  402
            PY SE+  KE                                     VDMV++PATTG M
Sbjct  63   PYKSEITNKEFCSLREIVGLYQLISCLCGGCLDWRPRLPSQNIGVDQVDMVMVPATTGLM  122

Query  403  GVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            G+LPGHV+TIAELKPGVMSVHEGNDV KYFVS GFAFIHANS  D++AV
Sbjct  123  GILPGHVSTIAELKPGVMSVHEGNDVTKYFVSSGFAFIHANSITDVVAV  171



>ref|XP_001752929.1| predicted protein [Physcomitrella patens]
 gb|EDQ82433.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  160  RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPY  339
            R F+   PAE     +F + WKKV PN D P  PS YMS RP   +++P+KLTVNFVLP+
Sbjct  23   RSFADAAPAEAIVPESFKQDWKKVAPNYDLPHFPSEYMSARPPVATTLPTKLTVNFVLPH  82

Query  340  SSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIH  519
              E+  KEVDMVI+PAT+GQMGVLPGHV TIAELKPG+MSVHEG DV +YFVS GFAF+H
Sbjct  83   QFEMQAKEVDMVIVPATSGQMGVLPGHVPTIAELKPGLMSVHEGADVKQYFVSSGFAFVH  142

Query  520  ANSFADIIAV  549
            ANS ADI+A+
Sbjct  143  ANSVADIVAI  152



>ref|XP_001752624.1| predicted protein [Physcomitrella patens]
 gb|EDQ82495.1| predicted protein [Physcomitrella patens]
Length=190

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +1

Query  202  STFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVII  381
             TF + WKKV PN D P  PS YM+ RP+ P+++P+KLTVNFVLP+  E+  KEVDMVI+
Sbjct  21   ETFKQDWKKVAPNYDLPHFPSEYMAARPSVPTTLPTKLTVNFVLPHEFEMQAKEVDMVIV  80

Query  382  PATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            PAT+GQMGVLPGHV TIAE+KPG+MSVHEG DV  YFVS GFAF+HANS ADI+A+
Sbjct  81   PATSGQMGVLPGHVPTIAEMKPGIMSVHEGTDVKNYFVSSGFAFVHANSVADIVAI  136



>gb|KHN01619.1| ATP synthase subunit delta', mitochondrial [Glycine soja]
Length=145

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPG  450
            M PRP TPS++PSKLTVNFVLPY+S+LA KEVDMVI+PATTGQMGVLPGHVATIAELKPG
Sbjct  1    MKPRPPTPSTLPSKLTVNFVLPYASQLAAKEVDMVIVPATTGQMGVLPGHVATIAELKPG  60

Query  451  VMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            V+SVHEGNDV KYFVS GFAFIHANS ADIIAV
Sbjct  61   VLSVHEGNDVTKYFVSSGFAFIHANSVADIIAV  93



>ref|XP_010691993.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=197

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 109/148 (74%), Gaps = 3/148 (2%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRP  285
            M   +SR+ G A   R+   F+T  PAE  A+  F EAWKKV+P+++PPKTP +++   P
Sbjct  1    MLPRASRIAGAAVFRRFSTGFTTA-PAE--AEEMFKEAWKKVVPHINPPKTPLSFIQHPP  57

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
              P+SIP+KL +N  LPYSS L+ K+VDMVI+PATTG+MG+ PGH A + ELKPG++S+ 
Sbjct  58   PIPTSIPAKLILNLYLPYSSHLSNKQVDMVIMPATTGEMGIRPGHTAIMTELKPGILSLL  117

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EGN+  KYFVSGGFAFIH NS ADII +
Sbjct  118  EGNETTKYFVSGGFAFIHPNSVADIITL  145



>ref|XP_002964565.1| hypothetical protein SELMODRAFT_166842 [Selaginella moellendorffii]
 ref|XP_002988832.1| hypothetical protein SELMODRAFT_184168 [Selaginella moellendorffii]
 gb|EFJ10094.1| hypothetical protein SELMODRAFT_184168 [Selaginella moellendorffii]
 gb|EFJ34898.1| hypothetical protein SELMODRAFT_166842 [Selaginella moellendorffii]
Length=215

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +1

Query  175  DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELA  354
            D P   A ++ F E W KV PN+D PKTP   M+ RP  P +IP KLTVNFVLP    + 
Sbjct  37   DTPTNKAVEA-FKEMWSKVAPNLDFPKTPHESMASRPPVPPAIPEKLTVNFVLPSEVAMN  95

Query  355  GKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVN-KYFVSGGFAFIHANSF  531
             ++VDMVI+PAT+G MGVLPGHV TIAELKPGV+SVH+G  V  +YF+S GFAF+HANS 
Sbjct  96   AEKVDMVILPATSGLMGVLPGHVPTIAELKPGVLSVHDGGQVKTQYFLSSGFAFVHANSV  155

Query  532  ADIIAV  549
             DI+ V
Sbjct  156  TDIVVV  161



>gb|EYU40328.1| hypothetical protein MIMGU_mgv1a019389mg, partial [Erythranthe 
guttata]
Length=135

 Score =   144 bits (362),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = +1

Query  229  VIPNVDPPKTPSAYMSPRPATPSS--IPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQM  402
            ++PN+DPP TP  +  PRP+  S+  IP KLT+  V PYSS+ + K+VDMV +P+TTGQ 
Sbjct  1    LVPNLDPPNTPLTFFQPRPSAASAEPIPPKLTIKLVSPYSSQFSNKQVDMVTVPSTTGQT  60

Query  403  GVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            G+LPGH+A+I+ELKP ++S+HEGN+V  YF+S GFAF+H+NS AD+IAV
Sbjct  61   GILPGHLASISELKPSLVSIHEGNEVTNYFISTGFAFVHSNSIADVIAV  109



>ref|XP_003056730.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
 gb|EEH58375.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
Length=213

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 99/158 (63%), Gaps = 11/158 (7%)
 Frame = +1

Query  109  FRHSSRLLG--RAATMRWRRPFSTDLP------AEPAADSTFLEAW--KKVIPNVDPPKT  258
             R + R LG   + T    R F+T  P      A+  +  +F++A+   K IP +D P T
Sbjct  3    LRQAMRRLGALSSQTSTAARAFTTSAPRLEATEAQKESIKSFMDAFDQNKPIPTMDLPST  62

Query  259  PSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAE  438
            PS +MSP    P++ P K+T+NF +P+  +    EVD V+IPAT+G  GVLPGHV T+A+
Sbjct  63   PSNFMSPEREVPATPPEKMTLNFYMPHEIQFKDAEVDQVMIPATSGDFGVLPGHVPTVAQ  122

Query  439  LKPGVMSVH-EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            L+PGV+SV    ++  KYFVS GFAF+HANS  DI+AV
Sbjct  123  LRPGVVSVQLNSSETQKYFVSSGFAFVHANSVTDIMAV  160



>ref|XP_011397664.1| ATP synthase subunit delta', mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24776.1| ATP synthase subunit delta', mitochondrial [Auxenochlorella protothecoides]
Length=209

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 94/154 (61%), Gaps = 6/154 (4%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFS---TDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMS  276
            M RH++R + RAA +R     +    +L A   +   FL  +      ++ P+ PS ++ 
Sbjct  1    MLRHAARGVCRAAGLRSVSSSTAAFQELNASEQSKKEFLSKFAAFQGTMNEPEFPSNFVK  60

Query  277  P-RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGV  453
            P      +S+P KL  NF +P ++   G  VD+V++PATTG  GV+PGHV T+AEL+PGV
Sbjct  61   PVEKVENASVPDKLKFNFYIPSAAINQGSSVDLVLLPATTGDFGVMPGHVPTVAELRPGV  120

Query  454  MSVHE--GNDVNKYFVSGGFAFIHANSFADIIAV  549
            +SVH     DV KYFVSGGFAFIHA+S  D+ AV
Sbjct  121  VSVHNELDKDVTKYFVSGGFAFIHADSTTDVCAV  154



>ref|XP_002506165.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO67423.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=214

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 99/160 (62%), Gaps = 15/160 (9%)
 Frame = +1

Query  109  FRHSSRLLG----------RA-ATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPN-VDPP  252
             R ++R LG          RA A    R   ST+   E   +  FL+ +K+  P+ +DPP
Sbjct  3    LRQAARRLGALAGSSPQVTRAFAVGSQRATMSTEAQRESVKE--FLDKFKQHAPSTMDPP  60

Query  253  KTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
              PS ++ P    P++ P+KLT+NF +P+  E  G EVD + +PA TG MGVLPGHV T+
Sbjct  61   SFPSDFLPPAREVPATPPAKLTLNFYMPHEIEYEGAEVDSIQLPAVTGDMGVLPGHVPTV  120

Query  433  AELKPGVMSVH-EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            A+L+PGV++V+ +  +  KYFVS GFAF+HANS  D++AV
Sbjct  121  AQLRPGVVAVNMDDKETKKYFVSSGFAFVHANSVTDVMAV  160



>ref|XP_008382231.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Malus 
domestica]
Length=112

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  370  MVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            MVIIPATTG MGVLPGHVATIAELKPGVMSVHEGNDV KYFVS GFAFIHANS ADIIAV
Sbjct  1    MVIIPATTGHMGVLPGHVATIAELKPGVMSVHEGNDVTKYFVSSGFAFIHANSIADIIAV  60



>tpg|DAA40913.1| TPA: hypothetical protein ZEAMMB73_724426 [Zea mays]
Length=112

 Score =   116 bits (291),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  370  MVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            MVI+PATTGQMGVLPGHVATIAELKPGV+SVHEGNDV+KYFVS GFAF+HANS ADI+AV
Sbjct  1    MVIVPATTGQMGVLPGHVATIAELKPGVLSVHEGNDVSKYFVSSGFAFVHANSIADIVAV  60



>gb|EAZ39886.1| hypothetical protein OsJ_24324 [Oryza sativa Japonica Group]
Length=202

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  VDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADII  543
            VDMVI+PATTGQMGVLPGHV+TIAELKPGV+SVHEGND+ KYFVS GFAF+HANS ADI+
Sbjct  89   VDMVIVPATTGQMGVLPGHVSTIAELKPGVLSVHEGNDITKYFVSSGFAFVHANSIADIV  148

Query  544  AV  549
            AV
Sbjct  149  AV  150



>ref|XP_006385594.1| hypothetical protein POPTR_0003s08430g [Populus trichocarpa]
 gb|ERP63391.1| hypothetical protein POPTR_0003s08430g [Populus trichocarpa]
Length=137

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 7/93 (8%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-------RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPS  264
            M R +SRLL R+     +       RP ST+LP  P  DS F+E+WKKV PN+DPPKTPS
Sbjct  1    MLRQASRLLTRSIATTQQPIRVMGARPMSTNLPDTPVQDSAFIESWKKVAPNIDPPKTPS  60

Query  265  AYMSPRPATPSSIPSKLTVNFVLPYSSELAGKE  363
            A+M PRP TPS+IPSK+TVNFVLPY+SEL  KE
Sbjct  61   AFMKPRPPTPSTIPSKITVNFVLPYASELTSKE  93



>ref|XP_008373716.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Malus 
domestica]
Length=126

 Score =   115 bits (287),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  VDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADII  543
            VDMV++PATTGQMGVLPGHV TIAELKPGV+SVHEG+DV KYFVS GFAFIHANS ADI+
Sbjct  13   VDMVMVPATTGQMGVLPGHVPTIAELKPGVLSVHEGSDVTKYFVSSGFAFIHANSVADIV  72

Query  544  AV  549
            AV
Sbjct  73   AV  74



>ref|XP_010058557.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Eucalyptus 
grandis]
Length=160

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  361  EVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADI  540
            +VD+VI+PAT GQ+GVLPGHVATIAELKPG+MSVH+GN V KYFVS GFAF+HANSFADI
Sbjct  49   DVDVVIVPATRGQLGVLPGHVATIAELKPGIMSVHDGNGVTKYFVSSGFAFVHANSFADI  108

Query  541  IAV  549
            IAV
Sbjct  109  IAV  111



>emb|CEF98937.1| ATPase, F1 complex, delta/epsilon subunit [Ostreococcus tauri]
Length=205

 Score =   117 bits (292),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 94/153 (61%), Gaps = 8/153 (5%)
 Frame = +1

Query  103  AMFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWK--KVIPNVDPPKTPSAYMS  276
            AM R + R++G+ A++  R   +       A+  TF++ ++  K  P ++ P T S + S
Sbjct  4    AMMRLARRVVGKNASVPVRGASTQSR----ASIETFMKNFEQHKTSPTMEHPATSSTFAS  59

Query  277  -PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGV  453
             P        P K+ +NF LP+ +     EVDMV++PATTG  GVLPGHV T+++L+PGV
Sbjct  60   TPVTEDVKGTPEKMKLNFYLPHDAPFDKTEVDMVLVPATTGDFGVLPGHVPTVSQLRPGV  119

Query  454  MSVH-EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +SVH    DV +YFVSGGF F+HA+S  DI AV
Sbjct  120  VSVHVSDKDVQRYFVSGGFCFVHADSTTDICAV  152



>gb|KCW73220.1| hypothetical protein EUGRSUZ_E01680 [Eucalyptus grandis]
Length=112

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  VDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADII  543
            VD+VI+PAT GQ+GVLPGHVATIAELKPG+MSVH+GN V KYFVS GFAF+HANSFADII
Sbjct  2    VDVVIVPATRGQLGVLPGHVATIAELKPGIMSVHDGNGVTKYFVSSGFAFVHANSFADII  61

Query  544  AV  549
            AV
Sbjct  62   AV  63



>gb|KCW73233.1| hypothetical protein EUGRSUZ_E01700 [Eucalyptus grandis]
Length=112

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  VDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADII  543
            VDMVI+PAT GQ+GVLPGHVATIAELKPG+MSVH+GN V KYFVS GFAF+HANSFAD+I
Sbjct  2    VDMVIVPATRGQLGVLPGHVATIAELKPGIMSVHDGNGVTKYFVSSGFAFVHANSFADLI  61

Query  544  AV  549
            AV
Sbjct  62   AV  63



>ref|XP_001419486.1| F-ATPase family transporter: protons (mitochondrial) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO97779.1| F-ATPase family transporter: protons (mitochondrial) [Ostreococcus 
lucimarinus CCE9901]
Length=170

 Score =   113 bits (282),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 2/110 (2%)
 Frame = +1

Query  226  KVIPNVDPPKTPSAYMS-PRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQM  402
            K  P +D P TP+ + S P   +      KL +NF LP+      +EVDMV++PATTG  
Sbjct  8    KTSPTMDRPSTPTTFASAPVEESAKGTADKLKLNFYLPHEVAHDEEEVDMVLVPATTGDF  67

Query  403  GVLPGHVATIAELKPGVMSVH-EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            G+LPGHV T+++L+PGV+SVH    DV KYFVS GFAF+HA+S ADI A+
Sbjct  68   GILPGHVPTVSQLRPGVVSVHLNDKDVKKYFVSSGFAFVHADSTADICAI  117



>gb|ABK94500.1| unknown [Populus trichocarpa]
Length=112

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  370  MVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            MVIIPA+TGQMGVLPGHV+ I ELKPGV+SVHEGN+V KYFVS GFAFIHANS ADI+AV
Sbjct  1    MVIIPASTGQMGVLPGHVSAITELKPGVLSVHEGNEVKKYFVSSGFAFIHANSIADIVAV  60



>gb|EMS66972.1| ATP synthase subunit delta', mitochondrial [Triticum urartu]
Length=275

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  VDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADII  543
            VDMV++PATTG MG+LPGHV+TIAELKPGVMSVHEGNDV KYFVS GFAFIHANS AD++
Sbjct  162  VDMVMVPATTGLMGILPGHVSTIAELKPGVMSVHEGNDVTKYFVSSGFAFIHANSIADVV  221

Query  544  AV  549
            AV
Sbjct  222  AV  223


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  271  MSPRPATPSSIPSKLTVNFVLPYSSELAGKEV  366
            M PRP TP+SIPSKLTVNFVLPY SE+  KEV
Sbjct  4    MKPRPPTPASIPSKLTVNFVLPYKSEITDKEV  35



>ref|XP_005643910.1| hypothetical protein COCSUDRAFT_48924 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19366.1| hypothetical protein COCSUDRAFT_48924 [Coccomyxa subellipsoidea 
C-169]
Length=206

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 92/156 (59%), Gaps = 13/156 (8%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVD----PPKTPSAYM  273
            MFR  ++ L   A    RR  ST        D    E  KK  P+V     PP  PS ++
Sbjct  1    MFRQVAQRLACTA----RRGLSTSAVCREG-DKGPAEFLKKFSPHVSSTLSPPSFPSEFL  55

Query  274  --SPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKP  447
              +      +++P KLT+NF LP+ + +   +VD+V++PA TG  GV+PGHV T+A+L+P
Sbjct  56   PKAKEAEEGAAVPEKLTLNFFLPHETTVKDSKVDLVLLPALTGDFGVMPGHVPTVAQLRP  115

Query  448  GVMSVHEGND--VNKYFVSGGFAFIHANSFADIIAV  549
            GV++VH+  D  + KYFVS GFAF+HA+S  D+ AV
Sbjct  116  GVVTVHKTLDKEIEKYFVSSGFAFVHADSSTDVCAV  151



>gb|KJB14864.1| hypothetical protein B456_002G150400 [Gossypium raimondii]
Length=176

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWR-RPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            M R +S LL R   +  R R FSTDLPA P AD+TF EA  KVIPN++PPKTP ++M P 
Sbjct  1    MLRPASMLLARRPILAARARSFSTDLPAAPFADATFTEACSKVIPNMEPPKTPLSFMQPH  60

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEV  366
            P TPSSIPSKLTV+FVLPY+SELA  EV
Sbjct  61   PPTPSSIPSKLTVHFVLPYASELATIEV  88



>gb|KJB15688.1| hypothetical protein B456_002G190900 [Gossypium raimondii]
Length=103

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +1

Query  106  MFRHSSRLLGRAATMRWRRP-FSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPR  282
            M R +S LL     +  R P FSTDLPA P+AD+TF EAW KVIPN+DPPKTP + M PR
Sbjct  1    MLRRASMLLACRPILAARAPPFSTDLPAAPSADATFTEAWTKVIPNMDPPKTPLSVMQPR  60

Query  283  PATPSSIPSKLTVNFVLPYSSELAGKEV  366
            P T  SIPSKLTVNFVL Y++EL  KEV
Sbjct  61   PPTSFSIPSKLTVNFVLLYAAELTTKEV  88



>ref|XP_003081047.1| putative ATP synthase delta chain, mitochondrial prec (ISS) [Ostreococcus 
tauri]
Length=210

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 91/161 (57%), Gaps = 18/161 (11%)
 Frame = +1

Query  109  FRHSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWK--KVIPNVDPPKTPSAYMS-P  279
             R + R++G+ A++    P         A+  TF++ ++  K  P ++ P T S + S P
Sbjct  1    MRLARRVVGKNASV----PVRGASTQSRASIETFMKNFEQHKTSPTMEHPATSSTFASTP  56

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKE----------VDMVIIPATTGQMGVLPGHVAT  429
                    P K+ +NF LP+ +     E          VDMV++PATTG  GVLPGHV T
Sbjct  57   VTEDVKGTPEKMKLNFYLPHDAPFDKTERLTRYDVDAQVDMVLVPATTGDFGVLPGHVPT  116

Query  430  IAELKPGVMSVH-EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            +++L+PGV+SVH    DV +YFVSGGF F+HA+S  DI AV
Sbjct  117  VSQLRPGVVSVHVSDKDVQRYFVSGGFCFVHADSTTDICAV  157



>gb|KDD77022.1| hypothetical protein H632_c38p3 [Helicosporidium sp. ATCC 50920]
Length=188

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = +1

Query  253  KTPSAYMSPR--PATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVA  426
            + PS Y+ P   P   ++IP KLT NF +PY +    ++VDMV++PATTG  G +PGHV 
Sbjct  31   EYPSNYVRPAAVPEAGAAIPEKLTFNFFVPYKTVFDAEKVDMVLVPATTGDFGAMPGHVP  90

Query  427  TIAELKPGVMSVHEGND--VNKYFVSGGFAFIHANSFADIIAV  549
            T+A+L+PGV++VH   D  V K+FV GGFAF+H +S  ++ AV
Sbjct  91   TVAQLRPGVVTVHRELDKSVEKFFVPGGFAFVHGDSVTEVCAV  133



>gb|KDO85422.1| hypothetical protein CISIN_1g041201mg [Citrus sinensis]
Length=94

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  361  EVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADI  540
            E+D +IIP+TTG M VLPGH + IA LK GV+SVHEGN+V KYF+S GFA IH NS+A+I
Sbjct  2    EIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEI  61

Query  541  IAV  549
            IAV
Sbjct  62   IAV  64



>gb|EEE67209.1| hypothetical protein OsJ_24326 [Oryza sativa Japonica Group]
Length=97

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  151  RWRRPFST-DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNF  327
            R  R  ST ++PAE A DS F EAWKKV PN++ P TP + M PRP TP++IPSKLTVNF
Sbjct  22   RSSRVLSTAEVPAEAATDSAFAEAWKKVAPNIEAPATPMSLMQPRPPTPAAIPSKLTVNF  81

Query  328  VLPYSSELAGKEVDM  372
            VLPY SE+A KE   
Sbjct  82   VLPYKSEIANKECQC  96



>gb|EAZ03945.1| hypothetical protein OsI_26081 [Oryza sativa Indica Group]
Length=718

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +1

Query  151  RWRRPFST-DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNF  327
            R  R  ST ++PAE A DS F EAWKKV PN++ P TP + M PRP T ++IPSKLTVNF
Sbjct  22   RSSRVLSTAEVPAEAATDSAFAEAWKKVAPNIETPATPMSLMQPRPPTLAAIPSKLTVNF  81

Query  328  VLPYSSELAGKEVD  369
            VLPY SE+A KE D
Sbjct  82   VLPYKSEIANKEAD  95



>dbj|BAC21368.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30403.1| unknown protein [Oryza sativa Japonica Group]
Length=108

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +1

Query  151  RWRRPFST-DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNF  327
            R  R  ST ++PAE A DS F EAWKKV PN++ P TP + M PRP TP++IPSKLTVNF
Sbjct  22   RSSRVLSTAEVPAEAATDSAFAEAWKKVAPNIEAPATPMSLMQPRPPTPAAIPSKLTVNF  81

Query  328  VLPYSSELAGKEV  366
            VLPY SE+A KEV
Sbjct  82   VLPYKSEIANKEV  94



>ref|XP_005837911.1| hypothetical protein GUITHDRAFT_151115 [Guillardia theta CCMP2712]
 gb|EKX50931.1| hypothetical protein GUITHDRAFT_151115 [Guillardia theta CCMP2712]
Length=171

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +1

Query  301  IPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH-EGND  477
            IP+KLT N + P+ +     EVD VI+P   G  GVLPGHV TIAEL+PG++ V     D
Sbjct  34   IPTKLTFNLLAPHKAIFNKAEVDQVIVPGADGMFGVLPGHVPTIAELRPGMVEVTVASGD  93

Query  478  VNKYFVSGGFAFIHANSFADIIAV  549
            V KYF+S GFAF+HANS  D+  V
Sbjct  94   VKKYFLSSGFAFVHANSTLDVCGV  117



>ref|NP_001059696.2| Os07g0495400 [Oryza sativa Japonica Group]
 dbj|BAF21610.2| Os07g0495400 [Oryza sativa Japonica Group]
Length=96

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +1

Query  151  RWRRPFST-DLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNF  327
            R  R  ST ++PAE A DS F EAWKKV PN++ P TP + M PRP TP++IPSKLTVNF
Sbjct  22   RSSRVLSTAEVPAEAATDSAFAEAWKKVAPNIEAPATPMSLMQPRPPTPAAIPSKLTVNF  81

Query  328  VLPYSSELAGKE  363
            VLPY SE+A KE
Sbjct  82   VLPYKSEIANKE  93



>ref|XP_009824242.1| hypothetical protein H257_02353 [Aphanomyces astaci]
 gb|ETV85770.1| hypothetical protein H257_02353 [Aphanomyces astaci]
Length=165

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = +1

Query  295  SSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGN  474
            S++ +K+T+N   P+ +   G +VD+V +P   G+ GV  GH   I++LKPGV++VHE  
Sbjct  25   SAVATKVTLNLSTPHQAFYKGVQVDLVQVPGLVGEYGVTAGHTPIISQLKPGVIAVHEER  84

Query  475  D--VNKYFVSGGFAFIHANSFADIIAV  549
            D  V K+F +GGFAF HA+S  DI AV
Sbjct  85   DKVVKKFFTAGGFAFTHADSTTDIAAV  111



>ref|XP_002947644.1| hypothetical protein VOLCADRAFT_109632 [Volvox carteri f. nagariensis]
 gb|EFJ51177.1| hypothetical protein VOLCADRAFT_109632 [Volvox carteri f. nagariensis]
Length=202

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  190  PAADSTFLEAWKKVIPN-VDPPKTPSAY--MSPRPATPSSIPSKLTVNFVLPYSSELAGK  360
            PA    F EAW K  P+ +  P+ PS +  +S  P T   +     VNF  P+S    G 
Sbjct  30   PAGPKEFAEAWNKKAPSTLAVPELPSNFTNVSTEPQTQGDL---FPVNFYTPHSVLSDGA  86

Query  361  EVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADI  540
            + D V +P   G  G+   HV  IA+L+PG++ +  G D  K+F+SGGFAF+H N  ADI
Sbjct  87   KKDGVTLPGIDGYFGIKANHVPIIAQLRPGIVELSSGPDTEKFFISGGFAFVHPNGVADI  146

Query  541  IAV  549
             A+
Sbjct  147  CAL  149



>gb|KIZ01401.1| F-type H+-transporting ATPase subunit delta [Monoraphidium neglectum]
Length=154

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = +1

Query  250  PKTPSAYMSPRPATPSSIP-SKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVA  426
            P+ PS+++    A  S+    +  VNF  P      GK +D V++P   G  GV   HV 
Sbjct  4    PQFPSSFLGAEAARDSAAEGEQFPVNFYTPDGVVAEGK-IDQVVLPGVEGVFGVKANHVP  62

Query  427  TIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             IA+LKPG++ +H+G +V K+FVSGGFA +H NS  DI AV
Sbjct  63   IIAQLKPGLVELHDGTEVQKFFVSGGFALVHPNSVTDICAV  103



>ref|XP_002904018.1| ATP synthase subunit delta', putative [Phytophthora infestans 
T30-4]
 gb|EEY54196.1| ATP synthase subunit delta', putative [Phytophthora infestans 
T30-4]
Length=169

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH--EGNDVN  483
            K+T+N   PY +   G EVD+V IP   G+ GV  GH   +A+LKPGV+ VH     DV 
Sbjct  33   KVTLNLTTPYQAFYKGAEVDLVQIPGVIGEYGVTAGHTPVLAQLKPGVIQVHVEREKDVQ  92

Query  484  KYFVSGGFAFIHANSFADIIAV  549
             +F +GGFA  HANS  DI  V
Sbjct  93   SFFTAGGFALTHANSVTDIACV  114



>gb|ADE92943.1| mitochondrial ATP synthase subunit delta [Polytomella sp. Pringsheim 
198.80]
 tpg|DAA33940.1| TPA_inf: mitochondrial ATP synthase subunit delta [Polytomella 
parva]
Length=199

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 3/116 (3%)
 Frame = +1

Query  208  FLEAWKKVIPN-VDPPKTPSAYMSPRPATPSSIPSK-LTVNFVLPYSSELAGKEVDMVII  381
            F E W K  P+ +  P+ PS Y + +      +      VNF  P+S  L+  + D V++
Sbjct  33   FTEVWNKKAPSTLIVPEFPSNYTAVKAVGEGQVHGDAFPVNFYTPHSI-LSQAQKDTVVL  91

Query  382  PATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            P   G  GV   HV TIA+LKPGV+ +H G +  K+FVSGGFAF+H N   DI  +
Sbjct  92   PGVDGYFGVKASHVPTIAQLKPGVVELHSGAESEKFFVSGGFAFVHPNGVTDICVL  147



>ref|XP_005704291.1| F-type H+-transporting ATPase subunit delta [Galdieria sulphuraria]
 gb|EME27771.1| F-type H+-transporting ATPase subunit delta [Galdieria sulphuraria]
Length=163

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKY  489
            KL ++F  P S+      VDMV+ PA TG MGVLP HV T+A+LKPGV++V E    +KY
Sbjct  33   KLKLSFATPTSALRKDASVDMVVFPAATGMMGVLPQHVPTVAQLKPGVVTVIEEGKEDKY  92

Query  490  FVSGGFAFIHANSFADIIAV  549
            FVS GFAF+  +   DI+AV
Sbjct  93   FVSSGFAFVTQDR-TDILAV  111



>ref|XP_008807294.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase inhibitor 1-like 
[Phoenix dactylifera]
Length=379

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +1

Query  364  VDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            VDMVIIPATTGQMGVLPGHVATIAELKPG+++VHEG++V KYF
Sbjct  12   VDMVIIPATTGQMGVLPGHVATIAELKPGLLAVHEGSEVTKYF  54



>ref|XP_008915127.1| hypothetical protein PPTG_18704 [Phytophthora parasitica INRA-310]
 gb|ETI31034.1| hypothetical protein F443_21952 [Phytophthora parasitica P1569]
 gb|ETK71416.1| hypothetical protein L915_21347 [Phytophthora parasitica]
 gb|ETL24855.1| hypothetical protein L916_21218 [Phytophthora parasitica]
 gb|ETL78072.1| hypothetical protein L917_21072 [Phytophthora parasitica]
 gb|ETM31336.1| hypothetical protein L914_21086 [Phytophthora parasitica]
 gb|ETM99631.1| hypothetical protein PPTG_18704 [Phytophthora parasitica INRA-310]
 gb|ETO59737.1| hypothetical protein F444_21971 [Phytophthora parasitica P1976]
 gb|ETP00830.1| hypothetical protein F441_21837 [Phytophthora parasitica CJ01A1]
 gb|ETP28976.1| hypothetical protein F442_21815 [Phytophthora parasitica P10297]
Length=169

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH--EGNDVN  483
            K+T+N   PY +   G EVD+V IP   G+ GV  GH   +++LKPGV+ VH     DV+
Sbjct  33   KVTLNLTTPYQAFYKGAEVDLVQIPGVIGEYGVTAGHTPVLSQLKPGVIKVHVEREKDVH  92

Query  484  KYFVSGGFAFIHANSFADIIAV  549
             +F +GGFA  HANS  DI  V
Sbjct  93   SFFTAGGFALTHANSVTDIACV  114



>gb|KCW73219.1| hypothetical protein EUGRSUZ_E016791, partial [Eucalyptus grandis]
Length=98

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 13/62 (21%)
 Frame = +1

Query  364  VDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADII  543
            VD+VI+PATTGQ+GVLPGHV             H+ N V KYFVS GFAF+HANSFAD+I
Sbjct  1    VDVVIVPATTGQLGVLPGHV-------------HDVNGVTKYFVSSGFAFVHANSFADLI  47

Query  544  AV  549
            AV
Sbjct  48   AV  49



>ref|XP_008864102.1| hypothetical protein H310_02387, partial [Aphanomyces invadans]
 gb|ETW08009.1| hypothetical protein H310_02387, partial [Aphanomyces invadans]
Length=185

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = +1

Query  307  SKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGND--V  480
            +K+T+N   P+ +   G +VD+V +P   G+ G+  GH   I++LKPGV++VHE  +  V
Sbjct  49   TKVTLNLSTPHQAFYKGVQVDLVQVPGMIGEYGITAGHTPIISQLKPGVIAVHEEREKVV  108

Query  481  NKYFVSGGFAFIHANSFADIIAV  549
             K+F +GGFAF HANS  DI AV
Sbjct  109  KKFFTAGGFAFTHANSTTDIAAV  131



>emb|CCI41129.1| unnamed protein product [Albugo candida]
Length=170

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +1

Query  274  SPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGV  453
            +   +T +S P K+T+N   PY       +VD++ IP   G+ GV  GH   I+++KPG+
Sbjct  22   AAEASTTTSTPQKVTLNLSTPYQCIFKETKVDLIQIPGAVGEYGVTAGHTPIISQMKPGL  81

Query  454  MSVH--EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            + VH     DV  +F +GGFAF HA+S  DI  V
Sbjct  82   IKVHLEREKDVQTFFTAGGFAFTHADSVTDIACV  115



>emb|CCF54673.1| probable ATP synthase delta chain precursor, mitochondrial [Ustilago 
hordei]
Length=169

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 60/104 (58%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  AWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTG  396
            A++  +     P +P A +  R     ++  KL ++F+LP+ +     EV  V I ++TG
Sbjct  6    AFRSALRATKAPISPLAQIGARRGYAEAVSDKLKLSFILPHEAIYNSTEVTQVNIASSTG  65

Query  397  QMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANS  528
             MG+L  HV  + EL+PGV+ V E +   K+FVSGGFA +H N+
Sbjct  66   DMGILASHVPAVEELRPGVLEVVESSGTKKWFVSGGFATVHPNN  109



>ref|XP_001698736.1| mitochondrial F1F0 ATP synthase, delta subunit [Chlamydomonas 
reinhardtii]
 gb|EDO99236.1| mitochondrial F1F0 ATP synthase, delta subunit [Chlamydomonas 
reinhardtii]
Length=202

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 64/123 (52%), Gaps = 2/123 (2%)
 Frame = +1

Query  184  AEPAADSTFLEAWKKVIP-NVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGK  360
            A PA    F EAW K  P  +  P+ PS + +   A   +      VNF  P S    G 
Sbjct  28   AVPAGPKEFTEAWNKKAPSQLLVPELPSNFTNVS-ADNQTQGDLFPVNFYTPSSVLADGV  86

Query  361  EVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADI  540
            + D V +P   G  GV   HV  IA+L+PG++ +  G D  K+F++GGFAF+H N  ADI
Sbjct  87   KKDGVTLPGIDGYFGVKANHVPVIAQLRPGIVELSSGADTEKFFIAGGFAFVHPNGVADI  146

Query  541  IAV  549
             A+
Sbjct  147  CAL  149



>ref|XP_009537353.1| hypothetical protein PHYSODRAFT_288955 [Phytophthora sojae]
 gb|EGZ07787.1| hypothetical protein PHYSODRAFT_288955 [Phytophthora sojae]
Length=169

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH--EGNDVN  483
            K+T+N   PY +     EVD+V IP   G+ GV  GH   +A+LKPGV+ VH     DV 
Sbjct  33   KVTLNLTTPYQAFYKNAEVDLVQIPGVIGEYGVTAGHTPVLAQLKPGVIKVHVEREKDVQ  92

Query  484  KYFVSGGFAFIHANSFADIIAV  549
             +F +GGFA  HANS  DI  V
Sbjct  93   SFFTAGGFALTHANSVTDIACV  114



>dbj|GAC72673.1| mitochondrial F1F0-ATP synthase, subunit delta/ATP16 [Pseudozyma 
antarctica T-34]
 dbj|GAK63002.1| delta subunit of the central stalk of mitochondrial F1F0 ATP 
synthase, ATP16 [Pseudozyma antarctica]
Length=168

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  256  TPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIA  435
            +P A +  R     ++  KL ++F+LP+ +     EV  V I A+TG MG+L  HV ++ 
Sbjct  18   SPLAQLGARRGYAEAVSDKLKLSFILPHEAIYNSTEVTQVNIAASTGDMGILASHVPSVE  77

Query  436  ELKPGVMSVHEGNDVNKYFVSGGFAFIHANS  528
            EL+PGV+ V E +   K+FVSGGFA +H N+
Sbjct  78   ELRPGVLEVVESSGTKKWFVSGGFATVHPNN  108



>emb|CBJ32297.1| conserved unknown protein [Ectocarpus siliculosus]
Length=169

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +1

Query  265  AYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELK  444
            A  + R  + +  P+ + +NF LP+ +    K+VD VIIP + G+ GV  GH   +AELK
Sbjct  16   ALRTARCFSTAEAPAVMKLNFCLPHETIYKDKDVDQVIIPGSAGEYGVTAGHSPIVAELK  75

Query  445  PGVMS-VHE-GNDVNKYFVSGGFAFIHANSFADIIAV  549
            PGV+  VHE G +   +FVS GFA  H  S  DI A+
Sbjct  76   PGVVQVVHEAGQEPENFFVSAGFALTHPTSVTDITAI  112



>gb|KIP11597.1| hypothetical protein PHLGIDRAFT_63599 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=163

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  KTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
            +TP A+ + R     ++  K+ ++ VLP+ +  +  +V  V +PA TG MG+L  HV +I
Sbjct  13   RTPRAFATARRGYAEAVSDKIKLSLVLPHQAIFSSADVVQVNLPAATGDMGILANHVPSI  72

Query  433  AELKPGVMSVHE-GNDVNKYFVSGGFAFIHANS  528
              ++PGV+ V E GN   K+FVSGGFA +H N+
Sbjct  73   EAVRPGVVEVIEAGNSSKKFFVSGGFATVHPNN  105



>gb|KDO33613.1| ATP synthase F1 [Saprolegnia parasitica CBS 223.65]
Length=163

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +1

Query  307  SKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGND--V  480
            +K+T+N   P+ S     EVD+V IP   G+ G+   H   I++LKPGV+ VHE  D  V
Sbjct  28   TKVTLNLNTPHQSFYKKAEVDLVQIPGLVGEYGITARHTPIISQLKPGVIVVHEERDKVV  87

Query  481  NKYFVSGGFAFIHANSFADIIAV  549
             K+F +GGFAF HA+S  DI  V
Sbjct  88   KKFFTAGGFAFTHADSVTDIACV  110



>emb|CCA27041.1| ATP synthase subunit delta' putative [Albugo laibachii Nc14]
Length=170

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +1

Query  274  SPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGV  453
            +   +T +    K+T+N   PY       +VD++ IP   G+ GV  GH   I+++KPGV
Sbjct  22   ATEASTTAFTTQKITLNLSTPYQCFFKETQVDLIQIPGAVGEYGVTAGHTPIISQMKPGV  81

Query  454  MSVH--EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            + VH     DV  +F +GGFAF HA+S  DI  V
Sbjct  82   IKVHVEREKDVQTFFTAGGFAFTHADSVTDIACV  115



>ref|XP_008615983.1| hypothetical protein SDRG_11712 [Saprolegnia diclina VS20]
 gb|EQC30657.1| hypothetical protein SDRG_11712 [Saprolegnia diclina VS20]
Length=163

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +1

Query  307  SKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGND--V  480
            +K+T+N   P+ S     EVD+V IP   G+ G+   H   I++LKPGV+ VHE  D  V
Sbjct  28   TKVTLNLNTPHQSFYKKAEVDLVQIPGLVGEYGITARHTPIISQLKPGVIIVHEERDKVV  87

Query  481  NKYFVSGGFAFIHANSFADIIAV  549
             K+F +GGFAF HA+S  DI  V
Sbjct  88   KKFFTAGGFAFTHADSVTDIACV  110



>dbj|GAM20322.1| hypothetical protein SAMD00019534_034970 [Acytostelium subglobosum 
LB1]
Length=169

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 61/102 (60%), Gaps = 3/102 (3%)
 Frame = +1

Query  253  KTPSAYMSPRP--ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVA  426
            KT S+ +  R   AT ++    LT +F++P+      K V M+ +P   G  GVL  H+ 
Sbjct  14   KTNSSSVVGRRSFATETANEELLTFSFMVPHQILFKEKRVQMLTLPGARGVFGVLKNHIP  73

Query  427  TIAELKPGVMSV-HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             IAELKPGV+ V HE  D+ KYF+SGGFAFI+ ++   I AV
Sbjct  74   KIAELKPGVVQVHHESGDIEKYFISGGFAFINPDASCYINAV  115



>emb|CDI52039.1| probable ATP synthase delta chain precursor, mitochondrial [Melanopsichium 
pennsylvanicum 4]
Length=168

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  256  TPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIA  435
            +P + +  R     ++  KL ++F+LP+ +     EV  V I ++TG MG+L  HV ++ 
Sbjct  18   SPLSQLGARRGYAEAVSDKLKLSFILPHEAIYNSSEVTQVNIASSTGDMGILASHVPSVE  77

Query  436  ELKPGVMSVHEGNDVNKYFVSGGFAFIHANS  528
            EL+PGV+ V E +   K+FVSGGFA +H N+
Sbjct  78   ELRPGVLEVVESSGAKKWFVSGGFATVHPNN  108



>ref|XP_005537275.1| mitochondrial F-type ATPase F1 subunit delta, precursor [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM81239.1| mitochondrial F-type ATPase F1 subunit delta, precursor [Cyanidioschyzon 
merolae strain 10D]
Length=185

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 74/135 (55%), Gaps = 16/135 (12%)
 Frame = +1

Query  151  RWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPS-KLTVNF  327
            +W RP          A  T L  W++         T  A +S   ++PSS  + ++T+NF
Sbjct  3    KWLRP----------ALRTTLRLWRR---QWSAEATSGASVSTGASSPSSEEAGRVTLNF  49

Query  328  VLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS-VHEGNDVNKYFVSGG  504
              P+      ++V  VI+PA +G MG+LP HV T+A+++PGV++ + +G    +YFVS G
Sbjct  50   FCPHQVIAKNRQVVSVIVPAASGLMGILPNHVPTVAQMRPGVVTIIGDGGAEERYFVSSG  109

Query  505  FAFIHANSFADIIAV  549
            F F+H +   DI AV
Sbjct  110  FTFVHPDR-TDICAV  123



>ref|XP_007510691.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18224.1| predicted protein [Bathycoccus prasinos]
Length=181

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 69/143 (48%), Gaps = 15/143 (10%)
 Frame = +1

Query  115  HSSRLLGRAATMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNV-DPPKTPSAYMSPRPAT  291
            H +R++  ++   +    ST    E      F E + K  P++ DPP TPS YM      
Sbjct  44   HQNRMISTSSRSNYAGGESTQTSVE-----KFQELFDKYRPSMMDPPGTPSTYMPAEDVA  98

Query  292  PSSI---------PSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELK  444
             S           P  + +NF LP+ +  A  EV+MV++PA TG  G+LPGHV  +A+L+
Sbjct  99   KSGEEEVKNAGPPPETVKLNFRLPHEAVFADAEVNMVLVPAETGDFGILPGHVPVVAKLR  158

Query  445  PGVMSVHEGNDVNKYFVSGGFAF  513
            PGV+SV     V        F F
Sbjct  159  PGVVSVENKESVTSRVRRQEFLF  181



>ref|XP_011387060.1| putative ATP synthase delta chain precursor [Ustilago maydis 
521]
 gb|KIS71195.1| putative ATP synthase delta chain precursor [Ustilago maydis 
521]
Length=168

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  253  KTPSAY--MSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVA  426
            K PSA   +  R     ++  KL ++F+LP+ +     EV  V I ++TG MG+L  HV 
Sbjct  15   KAPSALSQLGARRGYAEAVSDKLKLSFILPHEAIYNSTEVTQVNIASSTGDMGILASHVP  74

Query  427  TIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANS  528
             + EL+PGV+ V E +   K+FVSGGFA +H N+
Sbjct  75   AVEELRPGVLEVVESSGSKKWFVSGGFATVHPNN  108



>gb|ESA20032.1| hypothetical protein GLOINDRAFT_131507 [Rhizophagus irregularis 
DAOM 181602]
Length=169

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query  292  PSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEG  471
            P+ +  +L ++F LP+ +  A  EV  V I +T G MG+L  HV +I +LKPG++ + E 
Sbjct  31   PAGLSDRLRLSFALPHQTIYANAEVQQVNIASTAGDMGILANHVPSIEQLKPGIVEILEN  90

Query  472  -NDVNKYFVSGGFAFIHANSFADIIAV  549
               + +YF SGGFA I+ NS  DI A+
Sbjct  91   PTTIKRYFASGGFAMINPNSSLDINAI  117



>gb|EXX55065.1| F1F0 ATP synthase subunit delta [Rhizophagus irregularis DAOM 
197198w]
Length=176

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query  292  PSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEG  471
            P+ +  +L ++F LP+ +  A  EV  V I +T G MG+L  HV +I +LKPG++ + E 
Sbjct  38   PAGLSDRLRLSFALPHQTIYANAEVQQVNIASTAGDMGILANHVPSIEQLKPGIVEILEN  97

Query  472  -NDVNKYFVSGGFAFIHANSFADIIAV  549
               + +YF SGGFA I+ NS  DI A+
Sbjct  98   PTTIKRYFASGGFAMINPNSSLDINAI  124



>gb|EST06298.1| mitochondrial F1F0-ATP synthase, subunit delta/ATP16 [Pseudozyma 
brasiliensis GHG001]
Length=168

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  PSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAE  438
            P + +  R     ++  KL ++F+LP+ +     EV  V I ++TG MG+L  HV  + E
Sbjct  19   PLSQIGARRGYAEAVSDKLKLSFILPHEAIYNSSEVTQVNIASSTGDMGILASHVPAVEE  78

Query  439  LKPGVMSVHEGNDVNKYFVSGGFAFIHANS  528
            L+PGV+ V E +   K+FVSGGFA +H N+
Sbjct  79   LRPGVLEVVESSGTKKWFVSGGFATVHPNN  108



>gb|EFA75061.1| ATP synthase F1 delta [Polysphondylium pallidum PN500]
Length=176

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV-HEGNDVNKY  489
            L+ +F++P+      K+V M+ +P   G  GVL  H+  IAELKPGV+ V HE  DV+KY
Sbjct  43   LSFSFMVPHQILFKNKKVQMLTLPGARGVFGVLKNHIPKIAELKPGVVQVHHESGDVDKY  102

Query  490  FVSGGFAFIHANSFADIIAV  549
            F+SGGFAFI+ ++   I AV
Sbjct  103  FISGGFAFINPDASCYINAV  122



>emb|CBQ70506.1| probable ATP synthase delta chain precursor, mitochondrial [Sporisorium 
reilianum SRZ2]
Length=168

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  253  KTPS--AYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVA  426
            KTPS  + +  R     ++  KL ++F+LP+ +     EV  V I + +G MG+L  HV 
Sbjct  15   KTPSPLSQLGARRGYAEAVSDKLKLSFILPHQAIYDSTEVTQVNIASASGDMGILASHVP  74

Query  427  TIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANS  528
             + EL+PGV+ V E +   K+FVSGGFA +H N+
Sbjct  75   AVEELRPGVLEVVESSGTKKWFVSGGFATVHPNN  108



>gb|KHG28342.1| hypothetical protein F383_12537 [Gossypium arboreum]
Length=66

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 41/60 (68%), Gaps = 5/60 (8%)
 Frame = +1

Query  370  MVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            MVI+PATTG MGVLP HV TIAELKP V+SVHE  DV KY +S        N  ADII V
Sbjct  1    MVIVPATTGHMGVLPRHVPTIAELKPDVLSVHEVKDVTKYLLSSA-----TNYVADIITV  55



>gb|EFX00562.1| ATP synthase delta mitochondrial [Grosmannia clavigera kw1407]
Length=164

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++P K+ ++  LP+ S    ++V  V IPA +G MGVL  HV +I +LKPGV+ 
Sbjct  24   RRTYADAVPDKINLSLSLPHQSIYKSQDVVQVNIPAESGDMGVLANHVPSIEQLKPGVLE  83

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            + E +   +YF+SGGFA +  NS   I AV
Sbjct  84   IIEESGSKQYFLSGGFAVVQPNSHLSINAV  113



>emb|CDX73450.1| BnaC08g25530D [Brassica napus]
Length=81

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 51/81 (63%), Gaps = 10/81 (12%)
 Frame = +1

Query  106  MFRHSSRLL--GRAATMRWRR---PFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSAY  270
            MFR +SRLL  G     R RR   PF            TF+E+WKKV PN+DPP+TPS++
Sbjct  1    MFRQASRLLYDGSPPDPRNRRRLVPFQRKF-----RRRTFVESWKKVAPNIDPPQTPSSF  55

Query  271  MSPRPATPSSIPSKLTVNFVL  333
            M P P+T SSIP+K TVNFV 
Sbjct  56   MKPHPSTASSIPTKRTVNFVF  76



>emb|CEP63956.1| LALA0S09e06282g1_1 [Lachancea lanzarotensis]
Length=158

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  AG +V  V +PA +GQ+G+L  HV T+ +L PGV+ V EG    KYF
Sbjct  30   LKLQFALPHETLFAGSKVTQVNLPAQSGQVGILANHVPTVEQLSPGVVEVFEGGSSKKYF  89

Query  493  VSGGFAFIH  519
            VSGGFA + 
Sbjct  90   VSGGFATVQ  98



>ref|NP_984853.1| AEL008Wp [Ashbya gossypii ATCC 10895]
 sp|Q757N0.1|ATPD_ASHGO RecName: Full=ATP synthase subunit delta, mitochondrial; AltName: 
Full=F-ATPase delta subunit; Flags: Precursor [Ashbya gossypii 
ATCC 10895]
 gb|AAS52677.1| AEL008Wp [Ashbya gossypii ATCC 10895]
 gb|AEY96982.1| FAEL008Wp [Ashbya gossypii FDAG1]
Length=158

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = +1

Query  265  AYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELK  444
            A ++ R     +    L +NF LP+ +  AG  V  V +P  TGQ+G+L  HV  + +L 
Sbjct  14   ANVAARRTYAEAAADALKLNFALPHETLFAGTAVKQVNLPVKTGQIGILANHVPIVEQLV  73

Query  445  PGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            PGV+ V EG++  K+FVSGGFA +  +S   I +V
Sbjct  74   PGVVEVLEGSESKKFFVSGGFATVQPDSTLSITSV  108



>gb|AGO12349.1| AaceriAEL008Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=158

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L +NF LP+ +  AG  V  V +P  TGQ+G+L  HV  + +L PGV+ V EG++  K+F
Sbjct  30   LKLNFALPHETLFAGTAVKQVNLPVKTGQIGILANHVPIVEQLVPGVVEVLEGSESKKFF  89

Query  493  VSGGFAFIHANSFADIIAV  549
            VSGGFA +  +S   I +V
Sbjct  90   VSGGFATVQPDSTLSITSV  108



>emb|CAM82775.1| putative ATP synthase [Nidula niveotomentosa]
Length=179

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  SSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGN  474
            + +  KL ++FVLP+ +    ++V  V IPA +G MG+L  HV +I  L+PGV+ V EG+
Sbjct  43   AEVNDKLRLSFVLPHKAIYNSQDVVQVNIPAESGDMGILSNHVPSIEPLRPGVVEVLEGS  102

Query  475  DVNKYFVSGGFAFIHANSFADIIAV  549
               K+FVSGGFA +H N+   I  V
Sbjct  103  GTQKFFVSGGFATVHPNNKVTINVV  127



>ref|XP_011076550.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Sesamum indicum]
Length=790

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  193  AADSTFLEAWKKVIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDM  372
            A D    +AWKK IPN+DPP+ PSAYM   P T S+I SKLTVN VLPY S L+ KEV M
Sbjct  2    AGDFKLNDAWKKFIPNMDPPEIPSAYMPSCPPTQSTILSKLTVNLVLPYHSVLSAKEVLM  61



>ref|XP_007409227.1| hypothetical protein MELLADRAFT_35471 [Melampsora larici-populina 
98AG31]
 gb|EGG07320.1| hypothetical protein MELLADRAFT_35471 [Melampsora larici-populina 
98AG31]
Length=139

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +1

Query  268  YMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKP  447
            Y +  PAT S+   KL ++ VLP+ +  +   V  V I A +G MGVL  HVA+I  LKP
Sbjct  2    YATEAPAT-SAADGKLQLSLVLPHETIFSSSGVTQVNIAAESGDMGVLANHVASIESLKP  60

Query  448  GVMSVHEGN-DVNKYFVSGGFAFIHANSFADIIAV  549
            GV+ V E   D  K+FVSGGFA +H N+   I AV
Sbjct  61   GVVEVIENQGDSKKWFVSGGFANVHPNNSLTINAV  95



>ref|XP_445369.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG58275.1| unnamed protein product [Candida glabrata]
Length=154

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  298  SIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGND  477
            S  S L + F LP+ +   G+EV  V +PA +G +G+L  HV T+ +L PGV+ V + N+
Sbjct  21   SAASGLKLRFALPHETLFNGEEVVQVNLPAKSGSIGILANHVPTVEQLTPGVVEVVKANE  80

Query  478  VNKYFVSGGFAFIHANSFADIIAV  549
              KYFVSGGFA +  +S   + AV
Sbjct  81   TKKYFVSGGFAAVQPDSTLCVTAV  104



>pdb|2HLD|H Chain H, Crystal Structure Of Yeast Mitochondrial F1-Atpase
 pdb|2HLD|Q Chain Q, Crystal Structure Of Yeast Mitochondrial F1-Atpase
 pdb|2HLD|Z Chain Z, Crystal Structure Of Yeast Mitochondrial F1-Atpase
 pdb|3FKS|H Chain H, Yeast F1 Atpase In The Absence Of Bound Nucleotides
 pdb|3FKS|Q Chain Q, Yeast F1 Atpase In The Absence Of Bound Nucleotides
 pdb|3FKS|Z Chain Z, Yeast F1 Atpase In The Absence Of Bound Nucleotides
 pdb|2WPD|H Chain H, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|3OEE|H Chain H, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s
 pdb|3OEE|Q Chain Q, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s
 pdb|3OEE|Z Chain Z, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s
 pdb|3OEH|H Chain H, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f
 pdb|3OEH|Q Chain Q, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f
 pdb|3OEH|Z Chain Z, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f
 pdb|3OFN|H Chain H, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i
 pdb|3OFN|Q Chain Q, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i
 pdb|3ZRY|H Chain H, Rotor Architecture In The F(1)-C(10)-Ring Complex Of 
The Yeast F-Atp Synthase
 pdb|3ZIA|H Chain H, The Structure Of F1-atpase From Saccharomyces Cerevisiae 
Inhibited By Its Regulatory Protein If1
 pdb|3ZIA|R Chain R, The Structure Of F1-atpase From Saccharomyces Cerevisiae 
Inhibited By Its Regulatory Protein If1
Length=138

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = +1

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            A  ++  S L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V 
Sbjct  1    AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVM  60

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
            EG++  K+F+SGGFA +  +S   + A+
Sbjct  61   EGSNSKKFFISGGFATVQPDSQLCVTAI  88



>ref|XP_005790233.1| ATP synthase delta chain, mitochondrial [Emiliania huxleyi CCMP1516]
 gb|EOD37804.1| ATP synthase delta chain, mitochondrial [Emiliania huxleyi CCMP1516]
Length=290

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = +1

Query  361  EVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHE--GNDVNKYFVSGGFAFIHANS  528
            +V+MVI+P   GQ GV+P HV TIAELKPGV+SV E  G  + KYFVSGGFA I  +S
Sbjct  94   QVEMVILPGVDGQFGVMPNHVPTIAELKPGVVSVQEAAGGPLTKYFVSGGFASIGEDS  151



>pdb|4B2Q|H Chain H, Model Of The Yeast F1fo-atp Synthase Dimer Based On 
Subtomogram Average
 pdb|4B2Q|HH Chain h, Model Of The Yeast F1fo-atp Synthase Dimer Based On 
Subtomogram Average
Length=132

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +1

Query  307  SKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNK  486
            S L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG++  K
Sbjct  2    SGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKK  61

Query  487  YFVSGGFAFIHANSFADIIAV  549
            +F+SGGFA +  +S   + A+
Sbjct  62   FFISGGFATVQPDSQLCVTAI  82



>pdb|3OE7|H Chain H, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Gamma-I270t
 pdb|3OE7|Q Chain Q, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Gamma-I270t
 pdb|3OE7|Z Chain Z, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Gamma-I270t
Length=137

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +1

Query  307  SKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNK  486
            S L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG++  K
Sbjct  7    SGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKK  66

Query  487  YFVSGGFAFIHANSFADIIAV  549
            +F+SGGFA +  +S   + A+
Sbjct  67   FFISGGFATVQPDSQLCVTAI  87



>gb|EHN03237.1| Atp16p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=161

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG++  K+F
Sbjct  33   LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVIEVMEGSNTKKFF  92

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  +S   + A+
Sbjct  93   ISGGFATVQPDSQLCVTAI  111



>gb|EJT43511.1| ATP16-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=162

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG++  K+F
Sbjct  34   LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVIEVMEGSNTKKFF  93

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  +S   + A+
Sbjct  94   ISGGFATVQPDSQLCVTAI  112



>ref|XP_003327514.1| ATP synthase F1, epsilon subunit [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP83095.1| ATP synthase F1, epsilon subunit [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=176

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 58/112 (52%), Gaps = 12/112 (11%)
 Frame = +1

Query  250  PKTPSAYMSPRPATP-----------SSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTG  396
            P+   ++  PR   P           S    KL ++ VLP+ +      V  V I A +G
Sbjct  15   PRAAQSFRLPRNTLPAQTYATEAAPGSGSDGKLQLSLVLPHETIYQSSGVTQVNIAAESG  74

Query  397  QMGVLPGHVATIAELKPGVMSVHEGN-DVNKYFVSGGFAFIHANSFADIIAV  549
             MGVL  HVA+I  LKPGV+ V EG  D  K+FVSGGFA +H N+   I AV
Sbjct  75   DMGVLANHVASIESLKPGVVEVIEGQGDSKKWFVSGGFANVHPNNLLTINAV  126



>ref|XP_001269823.1| ATP synthase delta chain, mitochondrial precursor, putative [Aspergillus 
clavatus NRRL 1]
 gb|EAW08397.1| ATP synthase delta chain, mitochondrial precursor, putative [Aspergillus 
clavatus NRRL 1]
Length=165

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +1

Query  259  PSAYMSP--RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
            PSA+ +P  R     ++P KL ++  LP+ +      V  V IPA +G+MGVL  HV +I
Sbjct  15   PSAFRAPFQRRGYAEAVPDKLKLSLALPHQTIFKSTGVVQVNIPAESGEMGVLANHVPSI  74

Query  433  AELKPGVMS-VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             +LKPG++  V EG    K+F+SGGFA +  +S   I AV
Sbjct  75   EQLKPGLVEIVEEGGANKKFFLSGGFAVVQPDSTLSINAV  114



>gb|EGA75634.1| Atp16p [Saccharomyces cerevisiae AWRI796]
Length=149

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG++  K+F
Sbjct  32   LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFF  91

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  +S   + A+
Sbjct  92   ISGGFATVQPDSQLCVTAI  110



>emb|CDH49933.1| atp synthase delta mitochondrial [Lichtheimia corymbifera JMRC:FSU:9682]
Length=161

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = +1

Query  250  PKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVAT  429
            P     Y S  PA   +    L + FVLP+ +     +V  V + AT+G MG+L  HV T
Sbjct  13   PALARGYASEAPAAADN----LRLTFVLPHKALYKATDVQQVNLAATSGDMGILANHVPT  68

Query  430  IAELKPGVMSVHEGNDV-NKYFVSGGFAFIHANSFADIIAV  549
            I +L PGV+ V E  DV  K+FVSGGFA I+ +S  +I AV
Sbjct  69   IEQLNPGVVEVVESGDVTKKFFVSGGFAIINPDSTLNINAV  109



>ref|XP_003681204.1| hypothetical protein TDEL_0D04090 [Torulaspora delbrueckii]
 emb|CCE91993.1| hypothetical protein TDEL_0D04090 [Torulaspora delbrueckii]
Length=159

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  AG +V  V +PA +G++G+L  HV T+ +L PGV+ V EG    K+F
Sbjct  31   LQLQFALPHETVFAGSKVTQVNLPAQSGRIGILANHVPTVEQLTPGVIEVFEGTQSKKFF  90

Query  493  VSGGFAFIHANSFADIIAV  549
            VSGGFA +  +S   I +V
Sbjct  91   VSGGFAAMQPDSTLCITSV  109



>ref|XP_007910854.1| putative atp synthase delta mitochondrial precursor protein [Togninia 
minima UCRPA7]
 gb|EOO04463.1| putative atp synthase delta mitochondrial precursor protein [Togninia 
minima UCRPA7]
Length=164

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = +1

Query  259  PSAYMSP--RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
            P+A  +P  R     ++  K+ ++  LP+ S    ++V  V IPA +G+MGVL  HV +I
Sbjct  15   PAAIRAPLQRRGYAEAVSDKIKLSLTLPHQSIYKSQDVVQVNIPAESGEMGVLANHVPSI  74

Query  433  AELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             +LKPG++ V E +   ++F+SGGFA +  NS   I AV
Sbjct  75   EQLKPGLIEVVEESGSKQFFLSGGFAIVQPNSVMSINAV  113



>gb|EGA83722.1| Atp16p [Saccharomyces cerevisiae Lalvin QA23]
 gb|EGA87599.1| Atp16p [Saccharomyces cerevisiae VL3]
Length=130

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG++  K+F
Sbjct  32   LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFF  91

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  +S   + A+
Sbjct  92   ISGGFATVQPDSQLCVTAI  110



>ref|NP_010280.1| F1F0 ATP synthase subunit delta [Saccharomyces cerevisiae S288c]
 sp|Q12165.1|ATPD_YEAST RecName: Full=ATP synthase subunit delta, mitochondrial; AltName: 
Full=F-ATPase delta subunit; Flags: Precursor [Saccharomyces 
cerevisiae S288c]
 pdb|2XOK|H Chain H, Refined Structure Of Yeast F1c10 Atpase Complex To 3 
A Resolution
 emb|CAA79912.1| ATP synthase delta subunit [Saccharomyces cerevisiae]
 emb|CAA88057.1| ATP synthase delta subunit [Saccharomyces cerevisiae]
 emb|CAA88355.1| ATP synthase delta subunit (Z21857) [Saccharomyces cerevisiae]
 emb|CAA98560.1| ATP16 [Saccharomyces cerevisiae]
 gb|AAS56481.1| YDL004W [Saccharomyces cerevisiae]
 gb|EDN60342.1| F1F0 ATP synthase delta subunit [Saccharomyces cerevisiae YJM789]
 gb|EDV08291.1| ATP synthase delta subunit [Saccharomyces cerevisiae RM11-1a]
 gb|EEU04333.1| Atp16p [Saccharomyces cerevisiae JAY291]
 emb|CAY78505.1| Atp16p [Saccharomyces cerevisiae EC1118]
 tpg|DAA11844.1| TPA: F1F0 ATP synthase subunit delta [Saccharomyces cerevisiae 
S288c]
 gb|EHN08008.1| Atp16p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EIW11202.1| Atp16p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG87060.1| Atp16p [Saccharomyces cerevisiae R008]
 gb|EWG91764.1| Atp16p [Saccharomyces cerevisiae P301]
 gb|EWG96985.1| Atp16p [Saccharomyces cerevisiae R103]
 gb|AHY74997.1| Atp16p [Saccharomyces cerevisiae YJM993]
 gb|AJP37735.1| Atp16p [Saccharomyces cerevisiae YJM1078]
Length=160

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG++  K+F
Sbjct  32   LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFF  91

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  +S   + A+
Sbjct  92   ISGGFATVQPDSQLCVTAI  110



>emb|CDS06037.1| hypothetical protein LRAMOSA08565 [Absidia idahoensis var. thermophila]
Length=161

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = +1

Query  250  PKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVAT  429
            P     Y S  PA   +    L + FVLP+ +     +V  V + AT+G MG+L  HV T
Sbjct  13   PALARGYASEAPAAADN----LRLTFVLPHKALYKATDVQQVNLAATSGDMGILANHVPT  68

Query  430  IAELKPGVMSVHEGNDV-NKYFVSGGFAFIHANSFADIIAV  549
            I +L PGV+ V E  DV  K+FVSGGFA I+ +S  +I AV
Sbjct  69   IEQLNPGVVEVVESGDVTKKFFVSGGFATINPDSTLNINAV  109



>gb|EJK46633.1| hypothetical protein THAOC_34688, partial [Thalassiosira oceanica]
Length=222

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 65/138 (47%), Gaps = 9/138 (7%)
 Frame = +1

Query  145  TMRWRRPFSTDLPAEPAADSTFLEAWKKVIPNVDPPKTPSA---YMSPRPATPSSIPSKL  315
            T   R  FS   PAE A  S  L      +  +  P   SA   + SP PA+       +
Sbjct  33   TAHLRVTFSNCNPAETARASPLLVGRMNSLRRIATPAAKSAVRRFSSPAPAS-----GLM  87

Query  316  TVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV-HEGNDVNKYF  492
             +NF LP  +     EV  V++P   G+  V   HV  +AELK G+++V H G +  KYF
Sbjct  88   KLNFNLPQQTLFDSTEVSSVVVPGAMGEYEVTADHVPIVAELKAGMLTVKHGGGEEEKYF  147

Query  493  VSGGFAFIHANSFADIIA  546
            V GGF+  H  S  DI+ 
Sbjct  148  VPGGFSLTHEGSTTDIVC  165



>dbj|GAA22236.1| K7_Atp16p [Saccharomyces cerevisiae Kyokai no. 7]
Length=160

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG +  K+F
Sbjct  32   LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGTNSKKFF  91

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  +S   + A+
Sbjct  92   ISGGFATVQPDSQLCVTAI  110



>gb|EGA62700.1| Atp16p [Saccharomyces cerevisiae FostersO]
Length=130

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG +  K+F
Sbjct  32   LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGTNSKKFF  91

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  +S   + A+
Sbjct  92   ISGGFATVQPDSQLCVTAI  110



>ref|XP_007878120.1| hypothetical protein PFL1_02417 [Pseudozyma flocculosa PF-1]
 gb|EPQ30301.1| hypothetical protein PFL1_02417 [Pseudozyma flocculosa PF-1]
Length=175

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++  KL ++F+LP+ +     EV  V I + +G MG+L  HV ++ EL+PG++ 
Sbjct  32   RRGYAEAVSDKLKLSFILPHEAIYDSSEVTQVNIASASGDMGILAAHVPSVEELRPGLLE  91

Query  460  VHEGNDVNKYFVSGGFAFIHANS  528
            V E +   K+FVSGGFA +H N+
Sbjct  92   VVESSGTKKWFVSGGFATVHPNN  114



>gb|EGA59490.1| Atp16p [Saccharomyces cerevisiae FostersB]
Length=160

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PGV+ V EG +  K+F
Sbjct  32   LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGXNSKKFF  91

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  +S   + A+
Sbjct  92   ISGGFATVQPDSQLCVTAI  110



>ref|XP_002494558.1| ZYRO0A04312p [Zygosaccharomyces rouxii]
 emb|CAR25625.1| ZYRO0A04312p [Zygosaccharomyces rouxii]
Length=159

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  AG +V  V +PA +G +G+L  HV T+ +L PGV+ + EG +  KYF
Sbjct  31   LKLKFALPHETLFAGTKVTQVNLPAKSGGVGILANHVPTVEQLSPGVVEIFEGANTKKYF  90

Query  493  VSGGFAFIHANSFADIIAV  549
            VSGGFA +  +S   + +V
Sbjct  91   VSGGFASVQPDSTLCVTSV  109



>gb|KDN41412.1| putative ATP synthase delta chain precursor, mitochondrial [Tilletiaria 
anomala UBC 951]
Length=176

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 57/97 (59%), Gaps = 0/97 (0%)
 Frame = +1

Query  259  PSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAE  438
            PS++   R     ++  KL ++F+LP+S+  + +EV  V     +G MG+L  HV ++  
Sbjct  27   PSSFAVARRGYAEAVSDKLQLSFILPHSAIYSNQEVTQVNACTASGDMGILSAHVPSVES  86

Query  439  LKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            LKPG++ V E +   K+FVSGGF  +H N+   + A+
Sbjct  87   LKPGLLEVIESSGSKKFFVSGGFLVMHPNNKLTVNAI  123



>ref|XP_455744.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 sp|P78700.2|ATPD_KLULA RecName: Full=ATP synthase subunit delta, mitochondrial; AltName: 
Full=F-ATPase delta subunit; Flags: Precursor [Kluyveromyces 
lactis NRRL Y-1140]
 emb|CAG98452.1| KLLA0F14773p [Kluyveromyces lactis]
Length=159

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G  V  V +PA +GQ+G+L  HV T+ +L PGV+ V EG+   K+F
Sbjct  31   LKLQFALPHQTLFSGTPVTQVNLPAKSGQIGILANHVPTVEQLVPGVVEVLEGSSSKKFF  90

Query  493  VSGGFAFIHANSFADIIAV  549
            VSGGFA +  +S   I +V
Sbjct  91   VSGGFATVQPDSTLAITSV  109



>ref|XP_007875374.1| hypothetical protein PNEG_03299 [Pneumocystis murina B123]
 gb|EMR08471.1| hypothetical protein PNEG_03299 [Pneumocystis murina B123]
Length=164

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++  KL + F+LP+S     ++V  V IPAT+G MG+L  HV TI +L PGV+ 
Sbjct  23   RRYAKEALTDKLRLTFLLPHSILYKAQDVFQVNIPATSGSMGILALHVPTIEQLHPGVVE  82

Query  460  VHEGNDV-NKYFVSGGFA  510
            V E N V NK+FVSGGFA
Sbjct  83   VIEENGVSNKFFVSGGFA  100



>ref|XP_011102894.1| atp16p [Saccharomyces arboricola H-6]
 gb|EJS44314.1| atp16p [Saccharomyces arboricola H-6]
Length=160

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G EV  V +PA +G++GVL  HV T+ +L PG++ V EG+   K+F
Sbjct  32   LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGIVEVIEGSKSKKFF  91

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  +S   + A+
Sbjct  92   ISGGFATVQPDSQLCVTAI  110



>gb|KDR75146.1| hypothetical protein GALMADRAFT_249073 [Galerina marginata CBS 
339.88]
Length=161

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  IPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDV  480
            I  KL ++  LP+ +    ++V  V IPA +G MG+L  HV +I  L+PGV+ V E N  
Sbjct  27   ISEKLNLSLTLPHKTIFNSQDVVQVNIPAESGDMGILSNHVPSIESLRPGVVEVIESNGT  86

Query  481  NKYFVSGGFAFIHANS  528
             K+FVS GFA +H N+
Sbjct  87   QKFFVSSGFATVHPNN  102



>ref|XP_002555757.1| KLTH0G16632p [Lachancea thermotolerans]
 emb|CAR25320.1| KLTH0G16632p [Lachancea thermotolerans CBS 6340]
Length=214

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  AG +V  V +PA +GQ+G+L  HV T+ +L  GV+ V EG+   K+F
Sbjct  86   LKLQFALPHQTLFAGSKVTQVNLPAQSGQVGILANHVPTVEQLSAGVVEVFEGSSSKKFF  145

Query  493  VSGGFAFIHANSFADIIAV  549
            VSGGFA +  +S   I +V
Sbjct  146  VSGGFATVQPDSTLSINSV  164



>gb|KIM31462.1| hypothetical protein M408DRAFT_259983 [Serendipita vermifera 
MAFF 305830]
Length=163

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  295  SSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHE-G  471
            +++  KL ++ V+P+ + +AGKEV  V IPA TG MG+L  H   I EL+PGV+ V    
Sbjct  27   TAVNEKLKLSLVVPHQTLVAGKEVAQVNIPAATGDMGILSKHEPIIEELRPGVLEVKMLD  86

Query  472  NDVNKYFVSGGFAFIH  519
             +  K+F+SGGFA +H
Sbjct  87   GESKKWFISGGFATMH  102



>gb|KFH49026.1| ATP synthase subunit delta-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=164

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++P K+ ++  LP+ +   G +V  V IPA TG+MGVL  HV +I +LKPG++ 
Sbjct  24   RRTYAEAVPDKIKLSLTLPHQAIYRGHDVVQVNIPAETGEMGVLANHVPSIEQLKPGLVE  83

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIA  546
            V E     ++F+SGGFA I  +S   I A
Sbjct  84   VVEEGGAKQFFLSGGFATIQPDSTMSINA  112



>dbj|BAO39482.1| ATP synthase subunit delta [Kluyveromyces marxianus DMKU3-1042]
 dbj|BAP70980.1| ATP synthase subunit delta [Kluyveromyces marxianus]
Length=157

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  +G  V  V +PA +GQ+G+L  HV T+ +L PGV+ V EG+   K+F
Sbjct  29   LKLQFALPHQTLYSGSPVTQVNLPAKSGQIGILANHVPTVEQLVPGVVEVLEGSGSKKFF  88

Query  493  VSGGFAFIHANSFADIIAV  549
            VSGGFA +  +S   I +V
Sbjct  89   VSGGFATVQPDSTLSITSV  107



>ref|XP_004354697.1| ATP synthase F1 delta [Dictyostelium fasciculatum]
 gb|EGG16313.1| ATP synthase F1 delta [Dictyostelium fasciculatum]
Length=177

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV-HEGNDVNKY  489
            LT +F++P+      K+V M+ +P     MGVL  HV  IAELKPGV+++ H+ N    Y
Sbjct  37   LTFSFMVPHQVIFKDKKVQMITLPGAKSVMGVLKHHVPNIAELKPGVVAIQHDANTTENY  96

Query  490  FVSGGFAFIH  519
            F+SGGFAFI+
Sbjct  97   FISGGFAFIN  106



>tpe|CBF89828.1| TPA: ATP synthase delta chain, mitochondrial precursor, putative 
(AFU_orthologue; AFUA_1G03100) [Aspergillus nidulans FGSC 
A4]
Length=166

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +1

Query  259  PSAYMSP--RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
            P+A+  P  R     ++  K+ ++ VLP+ +     +V  V IPA +G+MGVL  HV +I
Sbjct  16   PAAFRVPLQRRGYAEAVNDKIKLSLVLPHQTIFRSTDVVQVNIPAESGEMGVLANHVPSI  75

Query  433  AELKPGVMS-VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             +LKPG++  V EG    K+F+SGGFA +  +S   I AV
Sbjct  76   EQLKPGLVEIVEEGGASKKFFLSGGFAVVQPDSQLSINAV  115



>emb|CDO96086.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=159

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ S  A   V  V +PA +GQ+G+L  HV T+ +L PGV+ + EG+   K+F
Sbjct  31   LKLQFALPHQSLYASTPVTQVNLPAKSGQIGILANHVPTVEQLVPGVIEILEGSSSKKFF  90

Query  493  VSGGFAFIHANSFADIIAV  549
            VSGGFA +  +S   I +V
Sbjct  91   VSGGFATVQPDSTLAITSV  109



>ref|XP_006965242.1| ATP synthase delta chain [Trichoderma reesei QM6a]
 gb|EGR48728.1| ATP synthase delta chain [Trichoderma reesei QM6a]
 gb|ETS01437.1| epsilon subunit of F1F0-ATP synthase N-terminal domain-containing 
protein, partial [Trichoderma reesei RUT C-30]
Length=156

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++P K+ ++  LP+ S    ++V  V IPA +G+MGVL  HV +I +LKPG++ 
Sbjct  24   RRGYAEAVPDKIKLSLALPHQSIYKSQDVVQVNIPAESGEMGVLANHVPSIEQLKPGLVE  83

Query  460  VHEGND-VNKYFVSGGFAFIHANSFADI  540
            V E N    ++F+SGGFA +  NS   I
Sbjct  84   VVEENGPAKQFFLSGGFATVQPNSVLSI  111



>ref|XP_002372941.1| ATP synthase delta chain, mitochondrial precursor, putative [Aspergillus 
flavus NRRL3357]
 ref|XP_003189206.1| ATP synthase subunit delta [Aspergillus oryzae RIB40]
 gb|EED57329.1| ATP synthase delta chain, mitochondrial precursor, putative [Aspergillus 
flavus NRRL3357]
Length=165

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = +1

Query  259  PSAYMSP--RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
            PSA+ +P  R     ++  K+ ++  LP+ +      V  V IPA +G+MGVL  HV +I
Sbjct  15   PSAFRAPLQRRGYAEAVNDKIKLSLALPHQTIFKSTGVVQVNIPAESGEMGVLANHVPSI  74

Query  433  AELKPGVMS-VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             +LKPG++  V EG    K+F+SGGFA +  +S   I AV
Sbjct  75   EQLKPGLVEVVEEGGATKKFFLSGGFAVVQPDSQLSINAV  114



>emb|CCT66321.1| probable ATP synthase delta chain precursor, mitochondrial [Fusarium 
fujikuroi IMI 58289]
 gb|EWG44396.1| ATP synthase subunit delta, mitochondrial [Fusarium verticillioides 
7600]
 gb|EWY97815.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
FOSC 3-a]
 gb|EWZ43894.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
Fo47]
 gb|EWZ99237.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
f. sp. lycopersici MN25]
 gb|EXA49167.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
f. sp. pisi HDV247]
 gb|EXK41254.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
f. sp. melonis 26406]
 gb|EXK88670.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
f. sp. raphani 54005]
 gb|EXL61224.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
f. sp. radicis-lycopersici 26381]
 gb|EXL83002.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
f. sp. conglutinans race 2 54008]
 gb|EXM03847.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
f. sp. cubense tropical race 4 54006]
 gb|EXM37390.1| ATP synthase subunit delta, mitochondrial [Fusarium oxysporum 
f. sp. vasinfectum 25433]
Length=165

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = +1

Query  259  PSAYMSP--RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
            PSA   P  R     ++P K+ ++  LP+ S    ++V  V IPA +G+MGVL  HV +I
Sbjct  15   PSAIRVPLQRRTYAEAVPDKIKLSLALPHQSIYKSQDVVQVNIPAESGEMGVLANHVPSI  74

Query  433  AELKPGVMS-VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             +LKPG++  V E     ++F+SGGFA +  NS   I AV
Sbjct  75   EQLKPGLVEVVEESAGSKQFFLSGGFATVQPNSVLSINAV  114



>ref|XP_001731452.1| hypothetical protein MGL_1635 [Malassezia globosa CBS 7966]
 gb|EDP44238.1| hypothetical protein MGL_1635 [Malassezia globosa CBS 7966]
Length=169

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++  KL ++FVLP+S+    +EV  V +PA +G +G+L  HV T+ +++PGV+ 
Sbjct  26   RRGYAEAVSDKLKLSFVLPHSALYNAQEVTQVNVPAISGDLGILSAHVPTVEQIRPGVLE  85

Query  460  VHEGNDVN-KYFVSGGFAFIH  519
            V E +  + K+FVS GFA IH
Sbjct  86   VIESSGTSKKFFVSSGFATIH  106



>ref|XP_001830304.1| ATP-synthase delta-subunit [Coprinopsis cinerea okayama7#130]
 gb|EAU91451.1| ATP-synthase delta-subunit [Coprinopsis cinerea okayama7#130]
Length=161

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  295  SSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGN  474
            + +  KL ++ VLP+ +    ++V  V IPA +G MG+L  HV +I  L+PGV+ V E +
Sbjct  25   ADVSDKLKLSLVLPHKAIFTSQDVVQVNIPAESGDMGILANHVPSIESLRPGVVEVMESS  84

Query  475  DVNKYFVSGGFAFIHANS  528
               K+FVS GFA +H N+
Sbjct  85   GTQKFFVSSGFATVHPNN  102



>ref|XP_007266650.1| epsilon subunit of F1F0-ATP synthase N-terminal domain-containing 
protein [Fomitiporia mediterranea MF3/22]
 gb|EJD02939.1| epsilon subunit of F1F0-ATP synthase N-terminal domain-containing 
protein [Fomitiporia mediterranea MF3/22]
Length=164

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHE-GNDVNK  486
            K+ ++ VLP+ +  A  +V  V I A TG MG+L  HV +I  L+PGV+ V E GN+  K
Sbjct  32   KIKLSLVLPHQTLFASTDVVQVNIAAATGDMGILANHVPSIEPLRPGVVEVIESGNNSQK  91

Query  487  YFVSGGFAFIHANSFADIIAV  549
            +FVSGGFA +H N+   I AV
Sbjct  92   WFVSGGFANVHPNNKLTINAV  112



>gb|EMD90059.1| hypothetical protein COCHEDRAFT_1225615 [Bipolaris maydis C5]
 gb|ENI09727.1| hypothetical protein COCC4DRAFT_157985 [Bipolaris maydis ATCC 
48331]
Length=165

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNK-  486
            K+ ++  LP+ S    ++V  V +PA TG+MGVL  HVA+I +LKPG++ + E    NK 
Sbjct  34   KIKLSLALPHQSIYKSQDVVQVNLPAETGEMGVLANHVASIEQLKPGLVEIIEEQGGNKQ  93

Query  487  YFVSGGFAFIHANSFADIIAV  549
            +F+SGGFA +  NS   I AV
Sbjct  94   FFLSGGFAVVQPNSVLSINAV  114



>ref|XP_007795292.1| putative atp synthase delta mitochondrial protein [Eutypa lata 
UCREL1]
 gb|EMR65612.1| putative atp synthase delta mitochondrial protein [Eutypa lata 
UCREL1]
Length=166

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +1

Query  259  PSAYMSP--RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
            P+A   P  R     + P K+ ++  LP+ S    ++V  V +PA +G+MGVL  HV +I
Sbjct  16   PTALRVPLQRRTYADAAPDKIKLSLSLPHQSIFKSQDVVQVNLPAESGEMGVLANHVPSI  75

Query  433  AELKPGVMSVHEGNDVNK-YFVSGGFAFIHANSFADIIAV  549
             +LKPG++ V E N  +K +F+SGGFA +  NS   I AV
Sbjct  76   EQLKPGLIEVVEENGGSKQFFLSGGFATVQPNSVLSINAV  115



>emb|CDH10324.1| probable ATP synthase subunit delta,mitochondrial [Zygosaccharomyces 
bailii ISA1307]
Length=159

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  AG +V  V +PA +G++GVL  HV T+ +L PGV+ + EG    K+F
Sbjct  31   LKLQFALPHETLYAGAKVTQVNLPAQSGELGVLANHVPTVEQLAPGVVEIFEGGATKKFF  90

Query  493  VSGGFAFIHANS  528
            VSGG A +  +S
Sbjct  91   VSGGLASVQPDS  102



>ref|XP_777009.1| hypothetical protein CNBB5350 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL22362.1| hypothetical protein CNBB5350 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=168

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = +1

Query  247  PPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVA  426
            P +  +  ++ R    ++   KL ++ VLP+ S  +   V  V IPA TG MG+L  HV 
Sbjct  14   PRQASALRIARRGYAEAATDGKLQLSLVLPHQSLYSSSGVIQVNIPAATGDMGILANHVP  73

Query  427  TIAELKPGVMSVHE--GNDVNKYFVSGGFAFIHANSFADIIAV  549
            ++  L+PGV+ V E  G    K+FVS GFA +H N+   I AV
Sbjct  74   SVEALRPGVIEVIEENGQQGKKWFVSAGFATVHGNNALTINAV  116



>ref|XP_007685583.1| hypothetical protein COCMIDRAFT_34625 [Bipolaris oryzae ATCC 
44560]
 ref|XP_007698310.1| hypothetical protein COCSADRAFT_35437 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD65379.1| hypothetical protein COCSADRAFT_35437 [Bipolaris sorokiniana 
ND90Pr]
 gb|EUC47888.1| hypothetical protein COCMIDRAFT_34625 [Bipolaris oryzae ATCC 
44560]
Length=165

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNK-  486
            K+ ++  LP+ S    ++V  V +PA TG+MGVL  HVA+I +LKPG++ + E    NK 
Sbjct  34   KIKLSLALPHQSIYKSQDVVQVNLPAETGEMGVLANHVASIEQLKPGLVEIIEEQGGNKQ  93

Query  487  YFVSGGFAFIHANSFADIIAV  549
            +F+SGGFA +  NS   I AV
Sbjct  94   FFLSGGFAVVQPNSVLSINAV  114



>gb|EHK41394.1| F1F0 ATP synthase delta chain mitochondrial precursor [Trichoderma 
atroviride IMI 206040]
Length=165

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++P K+ ++  LP+ S    ++V  V IPA +G MGVL  HV +I +LKPG++ 
Sbjct  24   RRGYAEAVPDKIKLSLALPHQSIYKSQDVVQVNIPAESGDMGVLANHVPSIEQLKPGLVE  83

Query  460  -VHEGNDVNKYFVSGGFAFIHANSFADI  540
             V E     ++FVSGGFA +  NS   I
Sbjct  84   VVEESGAAKQFFVSGGFASVQPNSILSI  111



>emb|CDF89093.1| ZYBA0S03-08988g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH16177.1| probable ATP synthase subunit delta,mitochondrial [Zygosaccharomyces 
bailii ISA1307]
Length=159

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            L + F LP+ +  AG +V  V +PA +G++GVL  HV T+ +L PGV+ + EG    K+F
Sbjct  31   LKLQFALPHDTLYAGTKVTQVNLPAQSGELGVLANHVPTVEQLAPGVVEIFEGGATKKFF  90

Query  493  VSGGFAFIHANS  528
            VSGG A +  +S
Sbjct  91   VSGGLASVQPDS  102



>ref|XP_007712519.1| hypothetical protein COCCADRAFT_5247 [Bipolaris zeicola 26-R-13]
 gb|EUC33131.1| hypothetical protein COCCADRAFT_5247 [Bipolaris zeicola 26-R-13]
 gb|EUN31626.1| hypothetical protein COCVIDRAFT_33913 [Bipolaris victoriae FI3]
Length=165

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNK-  486
            K+ ++  LP+ S    ++V  V +PA TG+MGVL  HVA+I +LKPG++ + E    NK 
Sbjct  34   KIKLSLALPHQSIYKSQDVVQVNLPAETGEMGVLANHVASIEQLKPGLVEIIEEQGGNKQ  93

Query  487  YFVSGGFAFIHANSFADIIAV  549
            +F+SGGFA +  NS   I AV
Sbjct  94   FFLSGGFAVVQPNSVLSINAV  114



>ref|XP_003678096.1| hypothetical protein NCAS_0I00830 [Naumovozyma castellii CBS 
4309]
 emb|CCC71751.1| hypothetical protein NCAS_0I00830 [Naumovozyma castellii CBS 
4309]
Length=168

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 55/88 (63%), Gaps = 3/88 (3%)
 Frame = +1

Query  295  SSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH---  465
            S+I + L + F LP+ +   G EV  V +PA +G++G+L  H+ T+ +L+PG++ +    
Sbjct  31   STIGNALRLQFALPHETLYEGAEVKQVNLPAKSGRIGILANHIPTVEQLEPGIVEIFTNA  90

Query  466  EGNDVNKYFVSGGFAFIHANSFADIIAV  549
              N+V K+F+SGGFA +  +S   + AV
Sbjct  91   NNNEVKKFFISGGFATMQPDSTLCVTAV  118



>gb|KII92771.1| hypothetical protein PLICRDRAFT_155575 [Plicaturopsis crispa 
FD-325 SS-3]
Length=163

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 1/99 (1%)
 Frame = +1

Query  253  KTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
            + PS +   R     ++  K+ ++FVLP+ S     +V  V I A TG MG+L  HV +I
Sbjct  13   RAPSTFSLGRRGYAEAV-DKIKLSFVLPHQSLFNSTDVVQVNIAAATGDMGILANHVPSI  71

Query  433  AELKPGVMSVHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
              L+PGV+ V E     K+FVSGGFA +H N+   I A+
Sbjct  72   EPLRPGVVEVVESGGSKKWFVSGGFATVHPNNKLTINAI  110



>gb|KJA27879.1| hypothetical protein HYPSUDRAFT_35053 [Hypholoma sublateritium 
FD-334 SS-4]
Length=161

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  IPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDV  480
            +  KL+++  LP+ S    K+V  V IPA +G MG+L  HV +I  L+PGV+ V E +  
Sbjct  27   VSDKLSLSLTLPHKSFFNSKDVVQVNIPAESGDMGILSSHVPSIEALRPGVVEVIETSGS  86

Query  481  NKYFVSGGFAFIHANS  528
             K+FVS GFA IH N+
Sbjct  87   QKFFVSSGFATIHPNN  102



>emb|CEG73298.1| Putative ATP synthase F1, epsilon subunit [Rhizopus microsporus]
 emb|CEI88941.1| Putative ATP synthase F1, epsilon subunit [Rhizopus microsporus]
Length=163

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 60/104 (58%), Gaps = 5/104 (5%)
 Frame = +1

Query  241  VDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGH  420
            + P +    Y S  PA+  +    L + FV+P+ +   G  V  V + AT+G MG+L  H
Sbjct  12   IKPARLARFYASEAPASTEA----LRLTFVVPHKAIYKGTTVQQVNLAATSGDMGILANH  67

Query  421  VATIAELKPGVMSVHEGNDV-NKYFVSGGFAFIHANSFADIIAV  549
            V +I +L PGV+ + E  ++  K+FVSGGFA I+ +S  +I AV
Sbjct  68   VPSIEQLNPGVVEIIESAEITKKFFVSGGFATINPDSSLNINAV  111



>gb|ESW97704.1| F0F1-type ATP synthase, epsilon subunit (mitochondrial delta 
subunit) [Ogataea parapolymorpha DL-1]
Length=161

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +1

Query  304  PSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDV-  480
            P  L V+ V P+ +    KEV  V +PA++G+MGVL  HV T+ EL PGV+ V E +   
Sbjct  29   PDVLKVSLVSPHQAIFTNKEVSQVNLPASSGEMGVLANHVPTVEELAPGVVEVIESSGTS  88

Query  481  NKYFVSGGFAFI  516
            +KYFVSGGFA I
Sbjct  89   SKYFVSGGFASI  100



>emb|CEJ05096.1| Putative ATP synthase F1, epsilon subunit [Rhizopus microsporus]
Length=163

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 60/104 (58%), Gaps = 5/104 (5%)
 Frame = +1

Query  241  VDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGH  420
            + P +    Y S  PA+  +    L + FV+P+ +   G  V  V + AT+G MG+L  H
Sbjct  12   IKPARLARFYASEAPASTEA----LRLTFVVPHKAIYKGAAVQQVNLAATSGDMGILANH  67

Query  421  VATIAELKPGVMSVHEGNDV-NKYFVSGGFAFIHANSFADIIAV  549
            V +I +L PGV+ + E  ++  K+FVSGGFA I+ +S  +I AV
Sbjct  68   VPSIEQLNPGVVEIIESAEITKKFFVSGGFATINPDSSLNINAV  111



>gb|ERS97170.1| ATP synthase subunit delta, mitochondrial [Sporothrix schenckii 
ATCC 58251]
Length=171

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +1

Query  229  VIPNVDPPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGV  408
            ++P V   +   A   P  A+PS+I   L+    LP+ +    ++V  V IPA +G+MGV
Sbjct  17   MVPRVAFQRRTYADAVPDKASPSAIKLSLS----LPHQTIYKSQDVVQVNIPAESGEMGV  72

Query  409  LPGHVATIAELKPGVMSVHEGNDVNK-YFVSGGFAFIHANSFADIIAV  549
            L  HV +I +LKPG++ V E +  NK +F+SGGFA +  NS   I AV
Sbjct  73   LANHVPSIEQLKPGLIEVVEESGGNKQFFLSGGFAIVQPNSVLSINAV  120



>gb|EIF48104.1| atp synthase delta mitochondrial precursor [Brettanomyces bruxellensis 
AWRI1499]
Length=166

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +1

Query  307  SKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEG-NDVN  483
            +KL ++  LP+ + L  K+V  V IPA TG MG+L  HV  I +L+PG++ + +     +
Sbjct  34   NKLRLSIALPHQTVLKDKDVFQVNIPAATGDMGILANHVPVIEQLRPGIVEIFDSPXHSD  93

Query  484  KYFVSGGFAFIHANSFADIIAV  549
            K+F+SGGFA +  NS  DI++V
Sbjct  94   KFFISGGFASVMPNSKMDILSV  115



>ref|XP_001907803.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP68476.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP31948.1| Putative mitochondrial ATP synthase delta chain precursor [Podospora 
anserina S mat+]
Length=164

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++  K+ ++  LP+ +    ++V  V IPA +G+MGVL  HV +I +LKPGV+ 
Sbjct  24   RRGYAEAVSDKIKLSLSLPHQAVYKSQDVVQVNIPAESGEMGVLANHVPSIEQLKPGVVE  83

Query  460  VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            + E +   ++F+SGGFA +  NS   I AV
Sbjct  84   IIEESGNKQFFLSGGFAVVQPNSVLSINAV  113



>gb|EJU04325.1| ATP-synthase delta-subunit [Dacryopinax sp. DJM-731 SS1]
Length=163

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEG-NDVNK  486
            K+ ++ VLPYS+  + +EV  V +PA TG MGVL  HVATI  L+PGV+ V E      K
Sbjct  32   KIKLSLVLPYSTIFSSEEVTQVNLPAVTGDMGVLANHVATIEPLRPGVLEVIESVGQSKK  91

Query  487  YFVSGGFAFIH  519
            +FVS G A +H
Sbjct  92   WFVSSGLATVH  102



>gb|KEZ42619.1| hypothetical protein SAPIO_CDS5862 [Scedosporium apiospermum]
Length=160

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNKYF  492
            + ++F LP+ S    +EV  V IPA +G+MGVL  HV  I +LK GV+ V E +   ++F
Sbjct  31   IKLSFSLPHQSLYKSQEVVQVNIPAESGEMGVLANHVPVIEQLKAGVVEVVEESGSKQFF  90

Query  493  VSGGFAFIHANSFADIIAV  549
            +SGGFA +  NS   I AV
Sbjct  91   LSGGFAVVQPNSVLSINAV  109



>gb|AFR93033.2| F-type H -transporting ATPase subunit delta [Cryptococcus neoformans 
var. grubii H99]
Length=168

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = +1

Query  247  PPKTPSAYMSPRPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVA  426
            P +  +  ++ R    ++   KL ++ VLP+ S  +   V  V IPA TG MG+L  HV 
Sbjct  14   PRQASALRVARRGYAEAATDGKLQLSLVLPHQSLYSSSGVIQVNIPAATGDMGILANHVP  73

Query  427  TIAELKPGVMSVHE--GNDVNKYFVSGGFAFIHANSFADIIAV  549
            ++  L+PGV+ V E  G    K+FVS GFA +H N+   I AV
Sbjct  74   SVEALRPGVIEVIEENGQQGKKWFVSAGFATVHGNNALTINAV  116



>ref|XP_007328284.1| ATP16 delta subunit of the central stalk of mitochondrial F1F0 
ATP synthase [Agaricus bisporus var. burnettii JB137-S8]
 gb|EKM80632.1| ATP16 delta subunit of the central stalk of mitochondrial F1F0 
ATP synthase [Agaricus bisporus var. burnettii JB137-S8]
Length=162

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  295  SSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGN  474
            + I  KL ++  LP+ +  + ++V  V IPA +G MG+L  HV +I  L+PGV+ V E +
Sbjct  26   AEISDKLKLSLALPHKAIFSSQDVVQVNIPAESGDMGILSSHVPSIEPLRPGVVEVVEDS  85

Query  475  DVNKYFVSGGFAFIHANS  528
               K+FVSGGFA +H N+
Sbjct  86   GSQKWFVSGGFATVHPNN  103



>emb|CDR43691.1| CYFA0S12e03290g1_1 [Cyberlindnera fabianii]
Length=160

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query  313  LTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVNK-Y  489
            L ++ VLP+ +  AGKEV  V +P   G+ G+L  HV  I +L+PGV+ + E +   K Y
Sbjct  31   LKLSLVLPHETIFAGKEVTQVNVPGVNGEFGILANHVPIIEQLRPGVIQITETSGTTKDY  90

Query  490  FVSGGFAFIHANSFADIIAV  549
            FVSGGFA +   S   I A+
Sbjct  91   FVSGGFATVQPGSVLSITAI  110



>ref|XP_006460755.1| ATP16 delta subunit of the central stalk of mitochondrial F1F0 
ATP synthase [Agaricus bisporus var. bisporus H97]
 sp|Q92196.1|ATPD_AGABI RecName: Full=ATP synthase subunit delta, mitochondrial; AltName: 
Full=F-ATPase delta subunit; Flags: Precursor [Agaricus 
bisporus]
 emb|CAB04785.1| ATP-synthase delta-subunit [Agaricus bisporus]
 gb|EKV47101.1| ATP16 delta subunit of the central stalk of mitochondrial F1F0 
ATP synthase [Agaricus bisporus var. bisporus H97]
Length=162

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  295  SSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGN  474
            + I  KL ++  LP+ +  + ++V  V IPA +G MG+L  HV +I  L+PGV+ V E +
Sbjct  26   AEISDKLKLSLALPHKAIFSSQDVVQVNIPAESGDMGILSSHVPSIEPLRPGVVEVVEDS  85

Query  475  DVNKYFVSGGFAFIHANS  528
               K+FVSGGFA +H N+
Sbjct  86   GSQKWFVSGGFATVHPNN  103



>ref|XP_008076037.1| Epsilon subunit of F1F0-ATP synthase N-terminal [Glarea lozoyensis 
ATCC 20868]
 gb|EPE36722.1| Epsilon subunit of F1F0-ATP synthase N-terminal [Glarea lozoyensis 
ATCC 20868]
Length=165

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = +1

Query  259  PSAYMSP--RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATI  432
            P+A  +P  R     ++  K+ ++  LP+ S    ++V  V IPA +G+MGVL  HV +I
Sbjct  15   PAAIRAPLQRRGYAEAVSDKIKLSLALPHQSVYKSQDVVQVNIPAESGEMGVLANHVPSI  74

Query  433  AELKPGVMSV-HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
             +LKPG++ V  E     ++F+SGGFA +  NS   I AV
Sbjct  75   EQLKPGLVEVIEESGGSKQFFLSGGFAIVQPNSELSINAV  114



>ref|XP_007830565.1| ATP synthase subunit delta [Pestalotiopsis fici W106-1]
 gb|ETS85768.1| ATP synthase subunit delta [Pestalotiopsis fici W106-1]
Length=167

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +1

Query  304  PSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSV-HEGNDV  480
            P K+ ++  LP+ S    ++V  V IPA +G+MGVL  HV +I +LKPG++ V  +G   
Sbjct  32   PDKIKLSLALPHQSIYKSQDVVQVNIPAESGEMGVLANHVPSIEQLKPGLIEVIEDGGSS  91

Query  481  NKYFVSGGFAFIHANSFADIIAV  549
             ++F+SGGFA +  NS   I A+
Sbjct  92   KQFFLSGGFAVVQPNSAMSINAI  114



>ref|XP_002624591.1| ATP synthase F1 epsilon subunit [Blastomyces dermatitidis SLH14081]
 gb|EEQ78417.1| ATP synthase F1 epsilon subunit [Blastomyces dermatitidis SLH14081]
 gb|EEQ86397.1| ATP synthase F1 epsilon subunit [Blastomyces dermatitidis ER-3]
 gb|EGE84714.1| ATP synthase F1 epsilon subunit [Blastomyces dermatitidis ATCC 
18188]
 gb|EQL30695.1| ATP synthase subunit delta, mitochondrial [Blastomyces dermatitidis 
ATCC 26199]
Length=165

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 59/101 (58%), Gaps = 3/101 (3%)
 Frame = +1

Query  256  TPSAYMSP--RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVAT  429
            +PSA+ +P  R     ++  K+ ++ VLP+ S     +V  V IPA +G MGVL  HV +
Sbjct  14   SPSAFRAPLQRRGYADAVADKIKLSLVLPHESIYKSTDVVQVNIPAESGVMGVLANHVPS  73

Query  430  IAELKPGVMS-VHEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            I +LKPG++  + E     ++F+SGGFA +  +S   I AV
Sbjct  74   IEQLKPGLVEIIEESGGTKQFFLSGGFAIVQPDSQLSINAV  114



>ref|XP_003052364.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU46651.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=165

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++P K+ ++  LP+ +    ++V  V IPA +G+MGVL  HV +I +LKPG++ 
Sbjct  24   RRTYAEAVPDKIKLSLALPHQAIYKSQDVVQVNIPAESGEMGVLANHVPSIEQLKPGLVE  83

Query  460  V-HEGNDVNKYFVSGGFAFIHANSFADIIAV  549
            V  E     ++F+SGGFA +  NS   I AV
Sbjct  84   VIEESGGAKQFFLSGGFATVQPNSILSINAV  114



>ref|XP_009268989.1| hypothetical protein J056_001086 [Wallemia ichthyophaga EXF-994]
 gb|EOR00200.1| hypothetical protein J056_001086 [Wallemia ichthyophaga EXF-994]
Length=159

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = +1

Query  286  ATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVH  465
            A+ +    KL + F LP+ +    KEV  V +PA TG+MG+L  HV ++  LK GV+ V 
Sbjct  21   ASEAGAADKLRLQFALPHQTIFQDKEVLQVSVPAQTGEMGILSHHVPSVEALKAGVVEVI  80

Query  466  E-GNDVNKYFVSGGFAFIHANSFADIIAV  549
            E      KYF+S GFA +H N+   I AV
Sbjct  81   ESAGQSTKYFISSGFASVHPNNTLTINAV  109



>gb|EMS24053.1| ATP-synthase delta chain [Rhodosporidium toruloides NP11]
 emb|CDR41383.1| RHTO0S06e01354g1_1 [Rhodosporidium toruloides]
Length=168

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  295  SSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGN  474
            +S   KL ++ VLP+ +    ++V  V + A +G +GVL  HV TI  L+PGV+ V E  
Sbjct  32   ASQSDKLRLSLVLPHETIYQSQDVVQVNLSAESGDLGVLANHVPTIEALRPGVLEVVESG  91

Query  475  DVNKYFVSGGFAFIHANSFADIIAV  549
            +  K+FVSGGFA +H N+   + AV
Sbjct  92   ESKKWFVSGGFANVHPNNTMTVNAV  116



>dbj|GAA94604.1| hypothetical protein E5Q_01256 [Mixia osmundae IAM 14324]
Length=210

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = +1

Query  310  KLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHE--GNDVN  483
            KL ++ VLP+      +EV  V + A +G MG+L  HV +I  LKPGV+ V E  G +  
Sbjct  42   KLRLSLVLPHEVIFESQEVLQVNLAAQSGDMGILANHVPSIESLKPGVVEVIEQNGQEAK  101

Query  484  KYFVSGGFAFIHANSFADIIAV  549
            K+FVSGGFA IH ++   I AV
Sbjct  102  KWFVSGGFANIHPSNLLTINAV  123



>ref|XP_007281769.1| ATP synthase delta mitochondrial [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA29205.1| ATP synthase delta mitochondrial [Colletotrichum gloeosporioides 
Nara gc5]
Length=165

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +1

Query  280  RPATPSSIPSKLTVNFVLPYSSELAGKEVDMVIIPATTGQMGVLPGHVATIAELKPGVMS  459
            R     ++P K+ ++  LP+ S  + K+V  V IPA +G+MGVL  HV +I +LKPG++ 
Sbjct  24   RRTYADAVPDKIKLSLSLPHQSIYSSKDVVQVNIPADSGEMGVLANHVPSIEQLKPGLVE  83

Query  460  -VHEGNDVNKYFVSGGFAFIHANSFADIIA  546
             V E     ++F+SGGFA +  NS   I A
Sbjct  84   VVEESGPSKQFFLSGGFAVVQPNSVLSINA  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720