BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J07

Length=427
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366817.1|  PREDICTED: photosystem I reaction center sub...    195   2e-59   Solanum tuberosum [potatoes]
ref|XP_006366818.1|  PREDICTED: photosystem I reaction center sub...    193   8e-59   Solanum tuberosum [potatoes]
ref|XP_004242465.1|  PREDICTED: photosystem I reaction center sub...    192   2e-58   Solanum lycopersicum
ref|XP_009588187.1|  PREDICTED: photosystem I reaction center sub...    191   3e-58   Nicotiana tomentosiformis
ref|XP_004242464.1|  PREDICTED: photosystem I reaction center sub...    191   3e-58   Solanum lycopersicum
gb|AAO85557.1|  photosystem I subunit XI                                190   1e-57   Nicotiana attenuata
gb|AFW90576.1|  photosystem I subunit XI Mrna                           190   1e-57   Solanum tuberosum [potatoes]
ref|XP_009771265.1|  PREDICTED: photosystem I reaction center sub...    189   2e-57   Nicotiana sylvestris
ref|XP_002527284.1|  Photosystem I reaction center subunit XI, ch...    189   4e-57   Ricinus communis
ref|XP_009588188.1|  PREDICTED: photosystem I reaction center sub...    185   9e-56   Nicotiana tomentosiformis
ref|XP_010111072.1|  Photosystem I reaction center subunit XI           183   7e-55   Morus notabilis
ref|XP_010268316.1|  PREDICTED: photosystem I reaction center sub...    182   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_007049544.1|  Photosystem I reaction center subunit XI           181   3e-54   Theobroma cacao [chocolate]
gb|EYU46071.1|  hypothetical protein MIMGU_mgv1a013446mg                181   4e-54   Erythranthe guttata [common monkey flower]
gb|KHG07601.1|  Photosystem I reaction center subunit XI, chlorop...    178   4e-53   Gossypium arboreum [tree cotton]
ref|XP_010532930.1|  PREDICTED: photosystem I reaction center sub...    178   5e-53   Tarenaya hassleriana [spider flower]
ref|XP_006368099.1|  PREDICTED: photosystem I reaction center sub...    176   8e-53   
gb|KDP45210.1|  hypothetical protein JCGZ_15075                         177   1e-52   Jatropha curcas
ref|XP_006414990.1|  hypothetical protein EUTSA_v10026195mg             175   8e-52   Eutrema salsugineum [saltwater cress]
emb|CDY34527.1|  BnaA08g04820D                                          175   1e-51   Brassica napus [oilseed rape]
ref|XP_011009621.1|  PREDICTED: photosystem I reaction center sub...    174   2e-51   Populus euphratica
ref|XP_002303024.2|  Photosystem I reaction center subunit XI fam...    174   2e-51   
ref|XP_002320562.1|  Photosystem I reaction center subunit XI fam...    173   3e-51   Populus trichocarpa [western balsam poplar]
emb|CDY70523.1|  BnaC04g55930D                                          173   4e-51   Brassica napus [oilseed rape]
ref|XP_006447949.1|  hypothetical protein CICLE_v10016637mg             173   5e-51   Citrus clementina [clementine]
ref|XP_009139665.1|  PREDICTED: photosystem I reaction center sub...    173   5e-51   Brassica rapa
gb|KDO43506.1|  hypothetical protein CISIN_1g027843mg                   173   5e-51   Citrus sinensis [apfelsine]
ref|XP_011080550.1|  PREDICTED: photosystem I reaction center sub...    172   7e-51   Sesamum indicum [beniseed]
ref|XP_010440626.1|  PREDICTED: photosystem I reaction center sub...    172   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010435345.1|  PREDICTED: photosystem I reaction center sub...    172   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010039031.1|  PREDICTED: LOW QUALITY PROTEIN: photosystem ...    169   2e-50   
ref|XP_011015312.1|  PREDICTED: photosystem I reaction center sub...    171   2e-50   Populus euphratica
ref|XP_010913060.1|  PREDICTED: photosystem I reaction center sub...    170   6e-50   Elaeis guineensis
gb|KJB08749.1|  hypothetical protein B456_001G101200                    170   6e-50   Gossypium raimondii
ref|XP_010037093.1|  PREDICTED: photosystem I reaction center sub...    170   6e-50   Eucalyptus grandis [rose gum]
ref|XP_008813507.1|  PREDICTED: photosystem I reaction center sub...    170   9e-50   Phoenix dactylifera
gb|KJB84065.1|  hypothetical protein B456_N002100                       169   1e-49   Gossypium raimondii
emb|CDP03987.1|  unnamed protein product                                169   2e-49   Coffea canephora [robusta coffee]
ref|XP_008218442.1|  PREDICTED: photosystem I reaction center sub...    170   3e-49   Prunus mume [ume]
ref|XP_006282464.1|  hypothetical protein CARUB_v10005700mg             168   3e-49   Capsella rubella
ref|XP_007205874.1|  hypothetical protein PRUPE_ppa011229mg             167   2e-48   Prunus persica
ref|NP_001236868.1|  uncharacterized protein LOC100527240               166   2e-48   Glycine max [soybeans]
ref|NP_193016.1|  photosystem I subunit L                               166   4e-48   Arabidopsis thaliana [mouse-ear cress]
gb|ACG24344.1|  photosystem I reaction center subunit XI                165   5e-48   Zea mays [maize]
gb|KCW48725.1|  hypothetical protein EUGRSUZ_K023622                    162   6e-48   Eucalyptus grandis [rose gum]
gb|AGV54333.1|  photosystem I reaction center subunit XI                165   7e-48   Phaseolus vulgaris [French bean]
ref|XP_002863290.1|  predicted protein                                  165   8e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_007139728.1|  hypothetical protein PHAVU_008G054400g             166   8e-48   Phaseolus vulgaris [French bean]
gb|KFK25351.1|  hypothetical protein AALP_AA8G101400                    164   2e-47   Arabis alpina [alpine rockcress]
ref|NP_001236277.1|  uncharacterized protein LOC100500317               163   2e-47   Glycine max [soybeans]
ref|XP_007029381.1|  Photosystem I reaction center subunit XI           163   4e-47   Theobroma cacao [chocolate]
sp|Q41385.1|PSAL_SPIOL  RecName: Full=Photosystem I reaction cent...    163   4e-47   Spinacia oleracea
ref|XP_004492835.1|  PREDICTED: photosystem I reaction center sub...    162   5e-47   
ref|XP_009405532.1|  PREDICTED: photosystem I reaction center sub...    162   8e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302156.1|  PREDICTED: photosystem I reaction center sub...    162   1e-46   Fragaria vesca subsp. vesca
emb|CAB53034.1|  photosystem I subunit XI precursor                     162   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|ACS68717.1|  photosystem I subunit XI                                158   1e-46   Sonneratia alba
ref|XP_009338009.1|  PREDICTED: photosystem I reaction center sub...    160   5e-46   Pyrus x bretschneideri [bai li]
ref|XP_003624162.1|  Photosystem I reaction center subunit XI           159   1e-45   Medicago truncatula
ref|XP_008370824.1|  PREDICTED: photosystem I reaction center sub...    159   2e-45   
ref|XP_010673930.1|  PREDICTED: photosystem I reaction center sub...    158   4e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008388809.1|  PREDICTED: photosystem I reaction center sub...    156   1e-44   
gb|ABG21996.1|  Photosystem I reaction center subunit XI, chlorop...    156   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010095590.1|  Photosystem I reaction center subunit XI           156   1e-44   Morus notabilis
ref|XP_002278780.1|  PREDICTED: photosystem I reaction center sub...    156   2e-44   Vitis vinifera
ref|NP_001066659.1|  Os12g0420400                                       154   9e-44   
ref|XP_009415117.1|  PREDICTED: photosystem I reaction center sub...    152   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001267647.1|  photosystem I reaction center subunit XI, ch...    150   3e-42   Cucumis sativus [cucumbers]
sp|Q39654.1|PSAL_CUCSA  RecName: Full=Photosystem I reaction cent...    150   3e-42   Cucumis sativus [cucumbers]
gb|EPS59631.1|  hypothetical protein M569_15172                         150   4e-42   Genlisea aurea
ref|XP_008655244.1|  PREDICTED: uncharacterized protein LOC100383...    150   5e-42   
gb|ACG28265.1|  photosystem I reaction center subunit XI                149   5e-42   Zea mays [maize]
ref|XP_008441854.1|  PREDICTED: photosystem I reaction center sub...    149   8e-42   Cucumis melo [Oriental melon]
gb|AFW80143.1|  hypothetical protein ZEAMMB73_091068                    150   9e-42   
ref|XP_002457272.1|  hypothetical protein SORBIDRAFT_03g004560          147   4e-41   
gb|ACG28232.1|  photosystem I reaction center subunit XI                146   1e-40   Zea mays [maize]
ref|XP_004962578.1|  PREDICTED: photosystem I reaction center sub...    145   2e-40   Setaria italica
ref|XP_009785828.1|  PREDICTED: photosystem I reaction center sub...    145   3e-40   Nicotiana sylvestris
sp|P23993.1|PSAL_HORVU  RecName: Full=Photosystem I reaction cent...    142   3e-39   Hordeum vulgare [barley]
gb|EMT01873.1|  Photosystem I reaction center subunit XI, chlorop...    140   2e-38   
ref|XP_006664004.1|  PREDICTED: photosystem I reaction center sub...    140   2e-38   Oryza brachyantha
ref|XP_003576628.1|  PREDICTED: photosystem I reaction center sub...    139   5e-38   Brachypodium distachyon [annual false brome]
gb|ABK55685.1|  PsaL                                                    135   5e-37   Cucumis sativus [cucumbers]
gb|EMS46316.1|  Photosystem I reaction center subunit XI, chlorop...    140   8e-37   Triticum urartu
gb|ABK20972.1|  unknown                                                 136   2e-36   Picea sitchensis
gb|ACG28145.1|  photosystem I reaction center subunit XI                134   5e-36   Zea mays [maize]
ref|NP_001148071.1|  photosystem I reaction center subunit XI           134   5e-36   
ref|XP_006840921.1|  hypothetical protein AMTR_s00087p00141000          133   1e-35   Amborella trichopoda
ref|WP_026060795.1|  hypothetical protein                               122   1e-32   
pdb|4RKU|L  Chain L, Crystal Structure Of Plant Photosystem I At ...    124   1e-32   Pisum sativum [garden pea]
gb|KCW48728.1|  hypothetical protein EUGRSUZ_K023621                    124   2e-32   Eucalyptus grandis [rose gum]
pdb|2O01|L  Chain L, The Structure Of A Plant Photosystem I Super...    123   3e-32   Arabidopsis thaliana [mouse-ear cress]
pdb|3LW5|L  Chain L, Improved Model Of Plant Photosystem I              122   4e-32   unidentified
gb|ADI88463.1|  PSAL protein                                            121   1e-31   Silene vulgaris [maiden's-tears]
gb|ADI88316.1|  PSAL protein                                            121   1e-31   Silene latifolia
ref|XP_004155128.1|  PREDICTED: photosystem I reaction center sub...    121   2e-31   
gb|ADI87881.1|  PSAL protein                                            120   2e-31   Silene dioica [morning campion]
gb|ADI87877.1|  PSAL protein                                            120   2e-31   Silene dioica [morning campion]
gb|AIS72753.1|  psal protein                                            119   3e-31   Rhizophora apiculata
ref|XP_001760296.1|  predicted protein                                  121   6e-31   
gb|EAY82914.1|  hypothetical protein OsI_38129                          119   1e-30   Oryza sativa Indica Group [Indian rice]
tpg|DAA53271.1|  TPA: hypothetical protein ZEAMMB73_645930              116   2e-30   
ref|XP_001754840.1|  predicted protein                                  118   6e-30   
ref|NP_001169222.1|  uncharacterized protein LOC100383080               116   1e-29   
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    123   3e-29   
ref|XP_001762315.1|  predicted protein                                  114   1e-28   
gb|ACN37088.1|  unknown                                                 107   1e-25   Zea mays [maize]
ref|XP_003060103.1|  photosystem I subunit XI, chloroplast precursor    104   1e-24   Micromonas pusilla CCMP1545
ref|XP_002948330.1|  hypothetical protein VOLCADRAFT_80111              102   4e-24   Volvox carteri f. nagariensis
ref|XP_001691084.1|  photosystem I reaction center subunit XI           101   2e-23   Chlamydomonas reinhardtii
ref|XP_002504254.1|  photosystem I subunit XI, chloroplast precursor    100   3e-23   Micromonas commoda
ref|XP_005844020.1|  hypothetical protein CHLNCDRAFT_32796              100   3e-23   Chlorella variabilis
ref|XP_005650700.1|  PsaL-domain-containing protein                   98.2    3e-22   Coccomyxa subellipsoidea C-169
gb|KIY98480.1|  Photosystem I reaction center subunit XI              97.4    5e-22   Monoraphidium neglectum
ref|XP_001416150.1|  photosystem I subunit XI precursor               97.1    9e-22   Ostreococcus lucimarinus CCE9901
ref|XP_003074802.1|  PsaL photosystem I subunit XI precursor (IC)     96.7    1e-21   
emb|CEG00928.1|  Photosystem I PsaL, reaction centre subunit XI       96.7    1e-21   Ostreococcus tauri
gb|KIY94971.1|  Photosystem I reaction center subunit XI              93.6    4e-21   Monoraphidium neglectum
ref|WP_039311754.1|  hypothetical protein                             89.7    1e-19   
ref|XP_011398968.1|  Photosystem I reaction center subunit XI, ch...  87.8    2e-18   Auxenochlorella protothecoides
ref|WP_015193668.1|  Photosystem I reaction center subunit XI         80.1    8e-16   Stanieria cyanosphaera
ref|WP_035156342.1|  Photosystem I reaction center subunit XI         79.3    2e-15   Calothrix sp. 336/3
gb|KEI67674.1|  PsaL                                                  79.3    2e-15   Planktothrix agardhii NIVA-CYA 126/8
gb|AFZ03678.1|  Photosystem I reaction center subunit XI              78.2    3e-15   Calothrix sp. PCC 6303
gb|AJH65986.1|  photosystem I reaction center subunit XI              78.2    4e-15   Vertebrata lanosa
ref|WP_041740877.1|  Photosystem I reaction center subunit XI         77.8    5e-15   
ref|YP_007878290.1|  photosystem I subunit XI                         77.4    6e-15   Calliarthron tuberculosum
ref|WP_026787895.1|  MULTISPECIES: Photosystem I reaction center ...  77.8    6e-15   Planktothrix
ref|WP_008233423.1|  photosystem I subunit XI (PsaL)                  77.8    6e-15   Richelia intracellularis
ref|YP_001293537.1|  photosystem I subunit XI                         77.0    9e-15   Rhodomonas salina
ref|WP_024124204.1|  photosystem I reaction center subunit XI PsaL    77.0    1e-14   Thermosynechococcus sp. NK55a
ref|WP_006194866.1|  photosystem I reaction center protein subuni...  77.0    1e-14   Nodularia spumigena
ref|YP_007627448.1|  photosystem I subunit XI                         76.6    1e-14   Chondrus crispus [carageen]
ref|XP_011024730.1|  PREDICTED: photosystem I reaction center sub...  76.3    2e-14   Populus euphratica
ref|WP_009555355.1|  Photosystem I reaction centre subunit XI         76.3    2e-14   Oscillatoriales cyanobacterium JSC-12
gb|AIR75599.1|  photosystem I protein subunit XI                      75.9    2e-14   Cyclotella sp. WC03_2
gb|AIR75458.1|  photosystem I protein subunit XI                      75.9    2e-14   Cyclotella sp. L04_2
ref|YP_009093201.1|  photosystem I protein subunit XI                 75.9    2e-14   Roundia cardiophora
ref|YP_874557.1|  photosystem I protein L                             75.9    2e-14   Thalassiosira pseudonana
ref|WP_015185145.1|  Photosystem I reaction centre subunit XI         76.3    2e-14   Microcoleus sp. PCC 7113
ref|YP_009059176.1|  photosystem I reaction center subunit XI         75.9    2e-14   Eunotia naegelii
ref|WP_015212807.1|  Photosystem I reaction center subunit XI         76.3    2e-14   Anabaena cylindrica
ref|WP_036534591.1|  Photosystem I reaction center subunit XI         76.3    3e-14   Neosynechococcus sphagnicola
ref|YP_004072550.1|  photosystem I reaction center subunit XI         75.9    3e-14   Thalassiosira oceanica CCMP1005
ref|WP_011058236.1|  photosystem I reaction center protein subuni...  75.9    3e-14   Thermosynechococcus
ref|WP_013193113.1|  photosystem I reaction centre subunit XI PsaL    75.9    3e-14   Trichormus azollae
ref|NP_045050.1|  photosystem I subunit XI                            75.5    3e-14   Cyanidium caldarium
pdb|1JB0|L  Chain L, Crystal Structure Of Photosystem I: A Photos...  75.9    3e-14   Synechococcus elongatus
ref|NP_050726.1|  photosystem I subunit XI                            75.5    3e-14   Guillardia theta
ref|WP_037217173.1|  Photosystem I reaction center subunit XI         75.9    3e-14   
ref|YP_009093474.1|  photosystem I protein subunit XI                 75.5    4e-14   Conticribra weissflogii
ref|WP_015112406.1|  Photosystem I reaction center subunit XI         75.5    4e-14   Nostoc sp. PCC 7107
ref|WP_009341978.1|  Photosystem I reaction centre, subunit XI PsaL   75.5    4e-14   Aphanizomenonaceae
ref|WP_018399449.1|  hypothetical protein                             75.5    4e-14   filamentous cyanobacterium ESFC-1
ref|YP_009029425.1|  photosystem I reaction center subunit XI         75.1    4e-14   Lithodesmium undulatum
ref|WP_028089973.1|  Photosystem I reaction center subunit XI         75.1    5e-14   
ref|YP_008144917.1|  photosystem I reaction center subunit XI         75.1    5e-14   Grateloupia taiwanensis
ref|WP_015127201.1|  Photosystem I reaction center subunit XI         75.5    5e-14   Calothrix sp. PCC 7507
ref|WP_028083754.1|  Photosystem I reaction center subunit XI         75.1    6e-14   Dolichospermum circinale
ref|YP_009093314.1|  photosystem I protein subunit XI                 74.7    6e-14   Cerataulina daemon
ref|NP_043675.1|  photosystem I subunit XI                            74.7    6e-14   Trieres chinensis
ref|YP_009029163.1|  photosystem I reaction center subunit XI         74.7    6e-14   Didymosphenia geminata
ref|WP_006276003.1|  Photosystem I reaction centre, subunit XI PsaL   75.1    6e-14   Cylindrospermopsis
ref|WP_002747669.1|  photosystem I reaction center subunit XI         74.7    7e-14   Microcystis aeruginosa
ref|NP_849135.1|  photosystem I subunit XI                            74.3    7e-14   Cyanidioschyzon merolae strain 10D
ref|YP_874366.1|  photosystem I protein L                             74.3    8e-14   Phaeodactylum tricornutum
ref|YP_009028732.1|  photosystem I reaction center subunit XI         74.3    8e-14   Asterionellopsis glacialis
ref|YP_009028637.1|  photosystem I reaction center subunit XI         74.3    8e-14   Asterionella formosa
ref|YP_002327559.1|  PSI reaction center subunit XI                   74.3    8e-14   Vaucheria litorea
gb|AAW79347.1|  chloroplast photosystem I subunit XI                  74.3    8e-14   Isochrysis galbana
sp|Q5ENP6.2|PSAL_ISOGA  RecName: Full=Photosystem I reaction cent...  74.3    9e-14   Isochrysis galbana
ref|YP_009093008.1|  photosystem I protein subunit XI                 74.3    9e-14   Rhizosolenia imbricata
ref|WP_015143921.1|  Photosystem I reaction centre subunit XI         74.3    9e-14   Pleurocapsales
gb|ADJ57433.1|  photosystem I subunit XI                              74.3    1e-13   uncultured prymnesiophyte C19847
ref|YP_009029047.1|  photosystem I reaction center subunit XI         74.3    1e-13   Cylindrotheca closterium
ref|WP_015137729.1|  Photosystem I reaction centre subunit XI         74.3    1e-13   Nostoc sp. PCC 7524
gb|AJO68493.1|  photosystem I subunit XI                              73.9    1e-13   Gracilariopsis lemaneiformis
ref|WP_006633219.1|  photosystem I reaction centre subunit XI PsaL    74.3    1e-13   Microcoleus vaginatus
ref|YP_005089645.1|  psaL gene product                                73.9    1e-13   Ulnaria acus
ref|YP_009029354.1|  photosystem I reaction center subunit XI         73.9    1e-13   Leptocylindrus danicus
ref|WP_006623822.1|  MULTISPECIES: photosystem I reaction centre ...  74.3    1e-13   Arthrospira
ref|WP_016949894.1|  Photosystem I reaction center subunit XI         74.3    1e-13   Anabaena sp. PCC 7108
ref|YP_009092907.1|  photosystem I protein subunit XI                 73.9    1e-13   Chaetoceros simplex
ref|WP_006618479.1|  photosystem I reaction center protein subuni...  74.3    1e-13   Arthrospira platensis
ref|WP_011318298.1|  photosystem I reaction center protein subuni...  74.3    1e-13   Trichormus variabilis
ref|WP_010994284.1|  photosystem I reaction center protein subuni...  74.3    1e-13   Nostocaceae
gb|AFW93937.1|  photosystem I reaction center subunit XI PsaL         73.9    1e-13   Anabaena sp. 90
ref|WP_039203683.1|  Photosystem I reaction center subunit XI         73.9    1e-13   
ref|YP_003734518.1|  photosystem I protein subunit XI                 73.9    1e-13   Kryptoperidinium foliaceum
ref|YP_003734958.1|  photosystem I protein L                          73.9    1e-13   Durinskia baltica
ref|WP_027402288.1|  Photosystem I reaction center subunit XI         73.9    1e-13   
ref|WP_028948018.1|  Photosystem I reaction center subunit XI         73.9    1e-13   Synechocystis sp. PCC 6714
ref|WP_010874254.1|  photosystem I reaction center protein subuni...  73.9    1e-13   Synechocystis
ref|WP_041457745.1|  Photosystem I reaction center subunit XI         73.9    1e-13   
ref|YP_277352.1|  photosystem I subunit XI                            73.6    2e-13   Emiliania huxleyi
ref|YP_009028863.1|  photosystem I reaction center subunit XI         73.6    2e-13   Coscinodiscus radiatus
gb|AHY04408.1|  photosystem I reaction center subunit XI              73.6    2e-13   Chrysochromulina sp. CCMP291
gb|AIA61269.1|  photosystem I subunit XI (chloroplast)                73.6    2e-13   Cyanidiaceae sp. MX-AZ01
ref|YP_005090088.1|  psaL gene product                                73.6    2e-13   Fucus vesiculosus
ref|WP_015126598.1|  photosystem I reaction centre subunit XI PsaL    73.9    2e-13   Calothrix sp. PCC 7507
ref|WP_026733119.1|  Photosystem I reaction center subunit XI         73.9    2e-13   Fischerella sp. PCC 9605
ref|YP_004376665.1|  photosystem I protein L                          73.6    2e-13   Fistulifera solaris
ref|WP_027840947.1|  Photosystem I reaction center subunit XI         73.6    2e-13   Mastigocoleus testarum
ref|WP_004162779.1|  Photosystem I reaction center subunit XI         73.6    2e-13   Microcystis aeruginosa
dbj|GAL95076.1|  photosystem I subunit XI (PsaL)                      73.6    2e-13   Microcystis aeruginosa NIES-44
ref|WP_012267003.1|  photosystem I reaction center protein subuni...  73.6    2e-13   Microcystis
ref|WP_002757141.1|  Photosystem I reaction center subunit XI         73.2    2e-13   Microcystis aeruginosa
ref|WP_002802734.1|  Photosystem I reaction center subunit XI         73.2    2e-13   Microcystis aeruginosa
ref|WP_002737469.1|  MULTISPECIES: photosystem I reaction center ...  73.2    2e-13   Microcystis
gb|AGS18382.1|  PsaL                                                  73.2    3e-13   Chroococcidiopsis sp. TS-821
ref|YP_006639085.1|  photosystem I protein L                          72.8    3e-13   Saccharina japonica
ref|YP_007476281.1|  photosystem I reaction center subunit XI         72.8    3e-13   Pavlova lutheri
ref|YP_008965752.1|  photosystem I reaction centre subunit XI         72.4    3e-13   Porphyridium purpureum
ref|YP_063666.1|  photosystem I subunit XI                            72.8    4e-13   Gracilaria tenuistipitata var. liui
gb|AIA21251.1|  photosystem I subunit XI                              72.8    4e-13   Pyropia kanakaensis
ref|NP_053832.1|  photosystem I subunit XI                            72.8    4e-13   Porphyra purpurea
ref|YP_007947751.1|  photosystem I subunit XI                         72.8    4e-13   Pyropia haitanensis
ref|WP_015210165.1|  Photosystem I reaction centre subunit XI         73.2    4e-13   Cylindrospermum stagnale
ref|YP_009019674.1|  photosystem I reaction center subunit XI         72.8    4e-13   Gracilaria salicornia
gb|AIA21457.1|  photosystem I subunit XI                              72.8    4e-13   Pyropia fucicola
gb|AGH27547.1|  photosystem I subunit XI                              72.8    4e-13   Pyropia yezoensis
ref|YP_003289277.1|  Photosystem I reaction centre subunit XI         72.4    4e-13   Ectocarpus siliculosus
ref|YP_009027506.1|  photosystem I subunit XI                         72.8    4e-13   Pyropia perforata
ref|WP_007356850.1|  MULTISPECIES: Photosystem I reaction center ...  72.8    4e-13   Kamptonema
ref|WP_012627225.1|  photosystem I reaction center protein subuni...  72.8    4e-13   Cyanothece sp. PCC 7425
ref|WP_015174679.1|  photosystem I reaction centre subunit XI PsaL    72.8    4e-13   Oscillatoria nigro-viridis
ref|WP_015148867.1|  Photosystem I reaction centre subunit XI         72.8    4e-13   Oscillatoria acuminata
ref|WP_009459087.1|  MULTISPECIES: Photosystem I reaction center ...  72.4    5e-13   Fischerella thermalis
ref|XP_007509229.1|  photosystem I reaction center subunit XI         72.0    5e-13   Bathycoccus prasinos
ref|WP_017654966.1|  Photosystem I reaction center subunit XI         72.4    5e-13   Fortiea contorta
ref|WP_016867319.1|  Photosystem I reaction center subunit XI         72.4    5e-13   Fischerella muscicola
ref|WP_015224772.1|  photosystem I reaction centre subunit XI PsaL    72.4    6e-13   Halothece sp. PCC 7418
sp|P25902.2|PSAL_SYNEL  RecName: Full=Photosystem I reaction cent...  72.0    7e-13   Synechococcus elongatus
ref|WP_017320640.1|  Photosystem I reaction center subunit XI         72.0    8e-13   cyanobacterium PCC 7702
ref|WP_019492434.1|  Photosystem I reaction center subunit XI         72.0    9e-13   Calothrix sp. PCC 7103
ref|WP_017290020.1|  Photosystem I reaction center subunit XI         71.6    1e-12   Leptolyngbya boryana
ref|WP_015188950.1|  Photosystem I reaction center subunit XI         71.6    1e-12   Gloeocapsa sp. PCC 7428
ref|YP_008145458.1|  photosystem I subunit XI                         71.2    1e-12   Phaeocystis globosa
ref|WP_016862312.1|  MULTISPECIES: Photosystem I reaction center ...  71.6    1e-12   Fischerella
ref|YP_005088683.1|  photosystem I subunit XI                         71.2    1e-12   Phaeocystis antarctica
ref|WP_017310087.1|  MULTISPECIES: Photosystem I reaction center ...  71.6    1e-12   Hapalosiphonaceae
ref|WP_026082875.1|  Photosystem I reaction center subunit XI         71.2    2e-12   Mastigocladopsis repens
ref|WP_016868714.1|  Photosystem I reaction center subunit XI         70.9    2e-12   Fischerella muscicola
ref|WP_016871860.1|  Photosystem I reaction center subunit XI         70.9    2e-12   Fischerella
ref|YP_001936395.1|  photosystem I subunit XI                         70.1    3e-12   Heterosigma akashiwo
ref|WP_009787332.1|  photosystem I reaction center protein subuni...  70.5    3e-12   Lyngbya sp. PCC 8106
ref|YP_009051129.1|  photosystem I subunit XI                         70.1    3e-12   Galdieria sulphuraria
ref|WP_015230763.1|  Photosystem I reaction centre subunit XI         70.5    3e-12   Dactylococcopsis salina
ref|WP_009769096.1|  Photosystem I reaction centre subunit XI         70.5    3e-12   Oscillatoriales cyanobacterium JSC-12
ref|WP_012410219.1|  photosystem I reaction center protein subuni...  70.5    3e-12   Nostoc punctiforme
ref|WP_009453710.1|  photosystem I reaction centre subunit XI PsaL    70.5    3e-12   Fischerella thermalis
ref|WP_044291591.1|  Photosystem I reaction center subunit XI         70.1    4e-12   Rivularia sp. PCC 7116
gb|AFY54155.1|  Photosystem I reaction centre subunit XI              70.1    4e-12   Rivularia sp. PCC 7116
gb|KIJ80968.1|  Photosystem I reaction center subunit XI              70.1    4e-12   Scytonema tolypothrichoides VB-61278
ref|YP_536903.1|  photosystem I subunit XI                            69.7    5e-12   Pyropia yezoensis
ref|WP_023067428.1|  photosystem I reaction center subunit XI         69.3    7e-12   Lyngbya aestuarii
ref|WP_026734712.1|  Photosystem I reaction center subunit XI         69.7    7e-12   Fischerella sp. PCC 9605
ref|WP_006100107.1|  photosystem I reaction center subunit XI         68.9    8e-12   Coleofasciculus chthonoplastes
ref|WP_011610943.1|  photosystem I reaction center protein subuni...  68.9    1e-11   Trichodesmium erythraeum
ref|WP_022604376.1|  photosystem I reaction centre subunit XI         68.2    2e-11   Rubidibacter lacunae
ref|WP_006454456.1|  photosystem I reaction center subunit XI         68.2    2e-11   Synechococcus sp. PCC 7335
ref|WP_016879098.1|  Photosystem I reaction center subunit XI         68.2    2e-11   Chlorogloeopsis fritschii
ref|WP_009631136.1|  Photosystem I reaction centre subunit XI         67.4    3e-11   Synechocystis sp. PCC 7509
ref|WP_016873409.1|  Photosystem I reaction center subunit XI         67.4    3e-11   Chlorogloeopsis fritschii
ref|WP_015956422.1|  photosystem I reaction center protein subuni...  67.0    4e-11   Cyanothece sp. PCC 7424
ref|WP_026135024.1|  Photosystem I reaction center subunit XI         67.0    4e-11   Scytonema hofmannii
ref|WP_013323649.1|  photosystem I reaction centre subunit XI PsaL    67.0    5e-11   Cyanothece sp. PCC 7822
ref|WP_008315008.1|  Photosystem I reaction centre subunit XI         66.6    5e-11   Leptolyngbya sp. PCC 6406
ref|WP_027844098.1|  Photosystem I reaction center subunit XI         66.6    6e-11   Mastigocoleus testarum
ref|WP_015163614.1|  Photosystem I reaction center subunit XI         66.6    6e-11   Pseudanabaena sp. PCC 7367
ref|WP_015125220.1|  Photosystem I reaction centre subunit XI         66.2    7e-11   Synechococcus sp. PCC 6312
ref|WP_019507234.1|  hypothetical protein                             68.9    1e-10   Pleurocapsa sp. PCC 7319
ref|WP_008275885.1|  photosystem I reaction center protein subuni...  65.9    1e-10   Cyanothece sp. CCY0110
ref|WP_015153098.1|  photosystem I reaction centre subunit XI PsaL    65.9    1e-10   Cyanobacteria [blue-green bacteria]
ref|WP_006454815.1|  photosystem I reaction center subunit XI         65.9    1e-10   Synechococcus sp. PCC 7335
ref|WP_017659403.1|  Photosystem I reaction center subunit XI         65.9    1e-10   Geitlerinema sp. PCC 7105
ref|WP_039715795.1|  Photosystem I reaction center subunit XI         65.9    1e-10   
ref|WP_029634148.1|  Photosystem I reaction center subunit XI [       65.9    1e-10   [Scytonema hofmanni] UTEX B 1581
ref|WP_015153888.1|  photosystem I reaction centre subunit XI PsaL    65.9    1e-10   Cyanobacteria [blue-green bacteria]
ref|YP_003002022.1|  photosystem I reaction center subunit XI         65.5    1e-10   
gb|AFY77216.1|  Photosystem I reaction centre subunit XI              65.1    2e-10   
ref|WP_039725418.1|  MULTISPECIES: Photosystem I reaction center ...  64.7    3e-10   
gb|AFR24845.1|  photosystem I reaction center subunit XI              63.9    4e-10   
ref|WP_041041820.1|  Photosystem I reaction center subunit XI         64.3    5e-10   
ref|WP_041393047.1|  Photosystem I reaction center subunit XI         63.9    6e-10   
ref|WP_017301045.1|  hypothetical protein                             63.5    6e-10   
ref|WP_036001681.1|  hypothetical protein                             63.9    7e-10   
ref|WP_009547206.1|  MULTISPECIES: photosystem I reaction centre ...  63.5    7e-10   
ref|WP_036483422.1|  Photosystem I reaction center subunit XI         63.5    8e-10   
ref|WP_010468462.1|  photosystem I protein PsaL                       63.2    8e-10   
ref|WP_035985100.1|  Photosystem I reaction center subunit XI         63.2    1e-09   
ref|WP_015132339.1|  chlorophyll a/b binding light-harvesting pro...  65.9    1e-09   
ref|YP_008519860.1|  photosystem I subunit XI                         62.8    1e-09   
ref|YP_008519984.1|  photosystem I subunit XI                         62.8    1e-09   
ref|YP_008519737.1|  photosystem I subunit XI                         62.8    1e-09   
ref|YP_007317052.1|  photosystem I subunit XI                         62.8    1e-09   
ref|YP_008520110.1|  photosystem I subunit XI                         62.8    1e-09   
ref|WP_011612057.1|  photosystem antenna protein-like protein         65.5    1e-09   
ref|WP_039748229.1|  Photosystem I reaction center subunit XI         62.8    2e-09   
ref|WP_006510806.1|  Photosystem I reaction centre subunit XI         62.4    2e-09   
ref|WP_036011402.1|  Photosystem I reaction center subunit XI         62.0    3e-09   
gb|ABU39903.1|  photosystem I reaction center subunit XI              60.5    6e-09   
ref|WP_012161996.1|  photosystem I protein PsaL                       60.8    6e-09   
ref|WP_040934130.1|  Photosystem I reaction center subunit XI         60.5    8e-09   
ref|WP_017305686.1|  hypothetical protein                             60.1    1e-08   
ref|WP_012196198.1|  phosphorylase                                    59.7    2e-08   
ref|WP_035830912.1|  photosystem I reaction center protein subuni...  59.3    2e-08   
ref|WP_017718712.1|  hypothetical protein                             59.3    2e-08   
ref|WP_015171224.1|  photosystem I reaction centre subunit XI PsaL    58.9    2e-08   
ref|WP_011433113.1|  photosystem I reaction center protein subuni...  58.9    3e-08   
ref|WP_019504026.1|  hypothetical protein                             58.5    3e-08   
ref|WP_036900606.1|  photosystem I reaction center protein subuni...  58.9    4e-08   
ref|YP_003002280.1|  photosystem I reaction center subunit XI         58.5    4e-08   
ref|WP_009629213.1|  Photosystem I reaction center subunit XI         58.5    4e-08   
ref|WP_019501218.1|  hypothetical protein                             58.2    5e-08   
ref|WP_006508481.1|  chlorophyll a/b binding light-harvesting pro...  60.8    5e-08   
ref|WP_017711040.1|  Photosystem I reaction center subunit XI         58.2    5e-08   
gb|EAR19117.1|  putative photosystem I reaction center subunit XI...  58.2    5e-08   
ref|WP_036003610.1|  Photosystem I reaction center subunit XI         58.2    5e-08   
ref|WP_015145184.1|  chlorophyll a/b binding light-harvesting pro...  60.5    6e-08   
ref|WP_011428959.1|  photosystem I reaction center protein subuni...  57.4    9e-08   
ref|WP_035829861.1|  Photosystem I reaction center subunit XI         57.4    9e-08   
ref|WP_007304441.1|  Photosystem I reaction centre, subunit XI PsaL   57.4    1e-07   
ref|WP_015203410.1|  Photosystem I reaction center subunit XI         56.6    2e-07   
ref|WP_044495154.1|  Photosystem I reaction center subunit XI         56.6    2e-07   
ref|WP_015109435.1|  Photosystem I reaction centre subunit XI         56.6    2e-07   
ref|WP_017745301.1|  PsbB/PsbC family photosystem II protein          58.9    2e-07   
ref|WP_035799335.1|  Photosystem I reaction center subunit XI         56.2    2e-07   
gb|EGJ29452.1|  photosystem I reaction centre subunit XI              56.2    2e-07   
sp|B1WPZ7.1|PSAL_CYAA5  RecName: Full=Photosystem I reaction cent...  56.2    2e-07   
ref|WP_015132325.1|  Photosystem I reaction center subunit XI         56.2    3e-07   
ref|WP_036007420.1|  PsbB/PsbC family photosystem II protein          58.5    3e-07   
ref|WP_011618368.1|  phosphorylase                                    56.2    3e-07   
ref|WP_035856813.1|  MULTISPECIES: Photosystem I reaction center ...  55.8    3e-07   
ref|WP_023073697.1|  photosystem i reaction centre subunit xi         55.8    3e-07   
gb|EAZ91063.1|  photosystem I reaction center protein subunit XI      55.8    3e-07   
ref|WP_010315026.1|  phosphorylase                                    55.8    3e-07   
ref|WP_036029604.1|  PsbB/PsbC family photosystem II protein          58.5    3e-07   
ref|WP_007099850.1|  phosphorylase                                    55.8    3e-07   
ref|WP_015220962.1|  Photosystem I reaction center subunit XI         55.8    4e-07   
ref|WP_006909724.1|  phosphorylase                                    55.5    4e-07   
ref|WP_007100653.1|  phosphorylase                                    55.5    4e-07   
ref|WP_044494841.1|  PsbB/PsbC family photosystem II protein          57.8    5e-07   
ref|WP_006515849.1|  Photosystem I reaction centre subunit XI         55.5    5e-07   
ref|WP_038005163.1|  photosystem I reaction center protein subuni...  55.5    5e-07   
gb|EGJ30054.1|  chlorophyll a/b binding light-harvesting protein      57.8    5e-07   
ref|YP_002049204.1|  Photosystem I reaction centre subunit XI PsaL    54.7    8e-07   
ref|WP_006173319.1|  phosphorylase                                    54.7    8e-07   
ref|WP_006854790.1|  phosphorylase                                    54.7    9e-07   
ref|WP_032517847.1|  photosystem I reaction center protein subuni...  55.1    1e-06   
ref|WP_017285938.1|  hypothetical protein                             54.7    1e-06   
ref|WP_015223947.1|  photosystem I reaction centre subunit XI PsaL    54.3    1e-06   
ref|WP_032525917.1|  photosystem I reaction center protein subuni...  54.7    1e-06   
ref|WP_015129072.1|  Photosystem I reaction center subunit XI         56.6    1e-06   
ref|WP_012597175.1|  MULTISPECIES: photosystem I reaction centre ...  54.3    1e-06   
ref|WP_017326527.1|  hypothetical protein                             53.9    1e-06   
ref|WP_012308215.1|  photosystem I reaction center subunit XI         53.5    2e-06   
ref|WP_006513851.1|  chlorophyll a/b binding light-harvesting pro...  56.2    2e-06   
ref|WP_041236674.1|  photosystem I reaction centre subunit XI PsaL    53.5    2e-06   
ref|WP_040655167.1|  PsbB/PsbC family photosystem II protein          55.8    2e-06   
gb|ERN42298.1|  chlorophyll a/b binding light-harvesting protein      55.8    2e-06   
ref|WP_015169541.1|  Photosystem I reaction centre subunit XI         53.1    2e-06   
ref|WP_040943218.1|  PsbB/PsbC family photosystem II protein          55.8    2e-06   
ref|WP_010311583.1|  phosphorylase                                    53.5    2e-06   
ref|WP_040934890.1|  PsbB/PsbC family photosystem II protein          55.8    2e-06   
ref|WP_036919291.1|  MULTISPECIES: photosystem I reaction center ...  53.9    2e-06   
ref|WP_030007435.1|  Photosystem I reaction center subunit XI         53.1    2e-06   
ref|WP_011377153.1|  phosphorylase                                    53.9    2e-06   
ref|WP_036053427.1|  PsbB/PsbC family photosystem II protein          55.5    3e-06   
gb|ESA35981.1|  chlorophyll a b binding light-harvesting protein      55.5    3e-06   
gb|ACL43574.1|  photosystem I reaction centre subunit XI PsaL         53.9    3e-06   
ref|WP_025782015.1|  photosystem I reaction center protein subuni...  53.1    3e-06   
ref|WP_011142233.1|  photosystem I reaction center protein subuni...  52.8    3e-06   
ref|WP_024546622.1|  Photosystem I reaction center subunit XI         52.8    3e-06   
ref|WP_011932319.1|  phosphorylase                                    52.4    5e-06   
ref|WP_043694826.1|  photosystem I reaction center protein subuni...  52.4    5e-06   
ref|WP_011125828.1|  MULTISPECIES: phosphorylase                      52.8    5e-06   
ref|WP_017651801.1|  PsbB/PsbC family photosystem II protein          54.7    5e-06   
ref|WP_019479882.1|  phosphorylase                                    52.8    6e-06   
ref|WP_023174747.1|  photosystem I reaction center protein subuni...  52.0    6e-06   
gb|AII42399.1|  phosphorylase                                         52.0    6e-06   
ref|WP_025959183.1|  photosystem I reaction center protein subuni...  52.0    6e-06   
ref|WP_038543086.1|  photosystem I reaction center protein subuni...  52.0    6e-06   
ref|WP_006195136.1|  hypothetical protein                             54.3    6e-06   
ref|WP_010998142.1|  hypothetical protein                             54.3    7e-06   
ref|WP_015161629.1|  Photosystem I reaction centre subunit XI         52.0    8e-06   
ref|WP_009788900.1|  MULTISPECIES: phosphorylase                      51.6    9e-06   
ref|WP_036899647.1|  photosystem I reaction center protein subuni...  52.0    1e-05   
ref|WP_025936310.1|  hypothetical protein                             50.8    1e-05   
ref|WP_021832825.1|  Chlorophyll a(b) binding protein, photosyste...  53.5    1e-05   
ref|WP_017295712.1|  Photosystem I reaction center subunit XI         51.2    1e-05   
ref|WP_015228648.1|  chlorophyll a/b binding light-harvesting pro...  53.5    1e-05   
ref|WP_028953600.1|  photosystem I reaction center protein subuni...  51.2    1e-05   
ref|WP_019477827.1|  hypothetical protein                             51.6    1e-05   
ref|WP_025915127.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_002808371.1|  phosphorylase                                    51.6    1e-05   
ref|WP_032516048.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_032520088.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_025891181.1|  MULTISPECIES: photosystem I reaction center ...  51.6    1e-05   
ref|WP_025895039.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_011863628.1|  phosphorylase                                    51.6    1e-05   
ref|WP_025946454.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_025943425.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_025968317.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_025939233.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_032513787.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_025956989.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_007313368.1|  Chlorophyll a(b) binding protein, photosyste...  53.5    1e-05   
ref|WP_032522019.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_025963946.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_025889435.1|  photosystem I reaction center protein subuni...  51.6    1e-05   
ref|WP_012008414.1|  phosphorylase                                    51.6    1e-05   
ref|WP_025893579.1|  MULTISPECIES: photosystem I reaction center ...  51.6    1e-05   
ref|WP_011819132.1|  phosphorylase                                    51.6    1e-05   
ref|WP_015161881.1|  Photosystem I reaction centre subunit XI         51.2    2e-05   
ref|WP_011820998.1|  phosphorylase                                    51.6    2e-05   
ref|WP_025971344.1|  photosystem I reaction center protein subuni...  51.6    2e-05   
ref|WP_015213266.1|  Photosystem I reaction center subunit XI         53.1    2e-05   
ref|WP_025927049.1|  photosystem I reaction center protein subuni...  51.6    2e-05   
ref|WP_011936568.1|  phosphorylase                                    50.8    2e-05   
ref|WP_036923142.1|  photosystem I reaction center protein subuni...  51.2    2e-05   
ref|WP_011133147.1|  phosphorylase                                    51.6    2e-05   
ref|WP_025930915.1|  photosystem I reaction center protein subuni...  51.2    2e-05   
ref|WP_011378415.1|  MULTISPECIES: phosphorylase                      50.8    2e-05   
gb|AAW79346.1|  chloroplast photosystem I subunit XI                  52.4    2e-05   
ref|WP_019501732.1|  hypothetical protein                             52.4    3e-05   
ref|WP_011295428.1|  phosphorylase                                    50.4    3e-05   
gb|AHF62750.1|  putative photosystem I reaction center subunit XI...  50.1    3e-05   
ref|WP_038654281.1|  photosystem I reaction center protein subuni...  50.4    3e-05   
ref|WP_011363361.1|  MULTISPECIES: phosphorylase                      50.1    3e-05   
ref|WP_011128974.1|  phosphorylase                                    50.1    3e-05   
gb|AIQ98117.1|  photosystem I subunit XI (PsaL)                       50.4    3e-05   
ref|WP_011824483.1|  phosphorylase                                    50.4    3e-05   
ref|WP_017661293.1|  hypothetical protein                             52.0    4e-05   
gb|ABE11438.1|  photosystem I PsaL protein subunit XI                 50.4    5e-05   
sp|P31084.2|PSAL_SYNP6  RecName: Full=Photosystem I reaction cent...  49.7    5e-05   
ref|WP_019475423.1|  phosphorylase                                    50.1    5e-05   
ref|WP_015227569.1|  photosystem antenna family protein               51.6    5e-05   
ref|WP_006529016.1|  Photosystem I reaction centre subunit XI         49.3    6e-05   
gb|KCW48726.1|  hypothetical protein EUGRSUZ_K023622                  47.4    8e-05   
ref|WP_025960074.1|  hypothetical protein                             47.8    1e-04   
ref|WP_015139531.1|  chlorophyll a/b binding light-harvesting pro...  50.4    1e-04   
ref|WP_011434366.1|  phosphorylase                                    47.8    2e-04   
ref|WP_038544026.1|  photosystem I reaction center protein subuni...  47.8    3e-04   
ref|WP_011429203.1|  phosphorylase                                    46.6    7e-04   
ref|WP_040055021.1|  Photosystem I reaction center subunit XI         44.7    8e-04   



>ref|XP_006366817.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Solanum tuberosum]
Length=220

 Score =   195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 108/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            MAT ASTMASQL +  AS +TRG G+  PKGISGAPFK+ PS R SCFTVKAVQ++KPTF
Sbjct  1    MATAASTMASQLNSSFASSLTRGHGLVTPKGISGAPFKIFPSTRKSCFTVKAVQADKPTF  60

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP 
Sbjct  61   QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPF  120

Query  370  REGGP  384
             + GP
Sbjct  121  VKAGP  125



>ref|XP_006366818.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Solanum tuberosum]
Length=220

 Score =   193 bits (490),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 108/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            MAT ASTMAS LK+  AS +TRG G+  PKGISGAPFK+ PS R SCFTVKAVQ++KPTF
Sbjct  1    MATAASTMASPLKSSFASSLTRGHGLVTPKGISGAPFKIFPSTRKSCFTVKAVQADKPTF  60

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP 
Sbjct  61   QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPF  120

Query  370  REGGP  384
             + GP
Sbjct  121  VKAGP  125



>ref|XP_004242465.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Solanum lycopersicum]
Length=220

 Score =   192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            MAT ASTMASQLK+  AS +T+G G+  PKGI+GAP K+ PS R SCFTVKAVQ++KPTF
Sbjct  1    MATAASTMASQLKSSFASSLTKGLGLVTPKGITGAPLKIFPSTRKSCFTVKAVQADKPTF  60

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP 
Sbjct  61   QVVQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPF  120

Query  370  REGGP  384
             + GP
Sbjct  121  VKAGP  125



>ref|XP_009588187.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=220

 Score =   191 bits (486),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 108/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            MAT AS MASQLK+  AS +TRG G+  PKGISGAPFK+ PS R SCFT+KAVQ++KPT+
Sbjct  1    MATAASPMASQLKSSFASSLTRGSGLVTPKGISGAPFKIFPSTRKSCFTIKAVQTDKPTY  60

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP 
Sbjct  61   QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPF  120

Query  370  REGGP  384
             + GP
Sbjct  121  VKAGP  125



>ref|XP_004242464.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Solanum lycopersicum]
Length=220

 Score =   191 bits (486),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 108/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   MATVASTMASQLKAA--SLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            MAT AS MASQLK++  S +TRG G+  PKGISGAPFK+ PS R SCFT+KAVQ++KPTF
Sbjct  1    MATAASPMASQLKSSFTSSLTRGHGLVTPKGISGAPFKIFPSTRKSCFTIKAVQADKPTF  60

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP 
Sbjct  61   QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPF  120

Query  370  REGGP  384
             + GP
Sbjct  121  VKAGP  125



>gb|AAO85557.1| photosystem I subunit XI [Nicotiana attenuata]
Length=220

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            MAT AS MASQLK+  AS +TRG G+  PKGISG+PFK+ PS R SCFT+KAVQ++KPT+
Sbjct  1    MATAASPMASQLKSKFASSLTRGSGLVTPKGISGSPFKIFPSTRKSCFTIKAVQTDKPTY  60

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP 
Sbjct  61   QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPF  120

Query  370  REGGP  384
             + GP
Sbjct  121  VKAGP  125



>gb|AFW90576.1| photosystem I subunit XI Mrna (chloroplast) [Solanum tuberosum]
Length=213

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 108/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            MAT ASTMASQLK+  AS +TRG G+  PKGISGAPFK+ PS R SCFTVKAVQ++KPTF
Sbjct  1    MATAASTMASQLKSSFASSLTRGHGLVTPKGISGAPFKIFPSTRKSCFTVKAVQADKPTF  60

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QVIQPLNGDPFIGS ETPVTSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP 
Sbjct  61   QVIQPLNGDPFIGSPETPVTSSPLIAWYLSNLPAYRTAVDPLLRGVEVGLAHGFLLVGPF  120

Query  370  REGGP  384
             + GP
Sbjct  121  VKAGP  125



>ref|XP_009771265.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Nicotiana sylvestris]
Length=220

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 107/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            MAT AS MASQLK+  AS +TRG G+  PKGISG PFK+ PS R SCFT+KAVQ++KPT+
Sbjct  1    MATAASPMASQLKSSFASSLTRGSGLVTPKGISGVPFKIFPSTRKSCFTIKAVQTDKPTY  60

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP 
Sbjct  61   QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPF  120

Query  370  REGGP  384
             + GP
Sbjct  121  VKTGP  125



>ref|XP_002527284.1| Photosystem I reaction center subunit XI, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF35128.1| Photosystem I reaction center subunit XI, chloroplast precursor, 
putative [Ricinus communis]
Length=218

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 107/123 (87%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MAT AS MASQLK+  AS +TRG GVP+GISG PF+V P++R + FTVKA+QSEKPTFQV
Sbjct  1    MATTASPMASQLKSSFASSVTRGLGVPRGISGNPFRVSPAKRATSFTVKAIQSEKPTFQV  60

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  +
Sbjct  61   IQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFVK  120

Query  376  GGP  384
             GP
Sbjct  121  AGP  123



>ref|XP_009588188.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=221

 Score =   185 bits (470),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 107/126 (85%), Gaps = 5/126 (4%)
 Frame = +1

Query  22   MATVAST-MASQLKA--ASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPT  186
            MAT AST MASQLK+  AS +TRG G+  PKGISGAPFK  PS R S FT+KAVQ++KPT
Sbjct  1    MATAASTTMASQLKSSFASSLTRGSGLVTPKGISGAPFKFFPSTRKSYFTIKAVQTDKPT  60

Query  187  FQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGP  366
            +QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP
Sbjct  61   YQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGP  120

Query  367  IREGGP  384
              + GP
Sbjct  121  FVKAGP  126



>ref|XP_010111072.1| Photosystem I reaction center subunit XI [Morus notabilis]
 gb|EXC29934.1| Photosystem I reaction center subunit XI [Morus notabilis]
Length=218

 Score =   183 bits (464),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MAT  S MASQLK+   S ++R    PKG+S +P +VLPSRRPS FTVKAVQSEKPTFQV
Sbjct  1    MATATSPMASQLKSNFTSPLSRALLSPKGLSASPLRVLPSRRPSSFTVKAVQSEKPTFQV  60

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  +
Sbjct  61   IQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFVK  120

Query  376  GGP  384
             GP
Sbjct  121  AGP  123



>ref|XP_010268316.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Nelumbo nucifera]
Length=217

 Score =   182 bits (461),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 102/119 (86%), Gaps = 2/119 (2%)
 Frame = +1

Query  34   ASTMASQLKA--ASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQPL  207
            AS MASQLK+  AS +TRG   P G+SGAP +VLPSRR  CFTVKAVQ++KPT+QVIQP+
Sbjct  4    ASPMASQLKSNFASSLTRGLLSPNGLSGAPLRVLPSRRKPCFTVKAVQADKPTYQVIQPI  63

Query  208  NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  + GP
Sbjct  64   NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKAGP  122



>ref|XP_007049544.1| Photosystem I reaction center subunit XI [Theobroma cacao]
 gb|EOX93701.1| Photosystem I reaction center subunit XI [Theobroma cacao]
Length=218

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA--SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MA  AS MASQLK++  S +TRG  VP+GISGAPF+V P +R  CF+VKAVQ++KPT+QV
Sbjct  1    MAATASPMASQLKSSFTSSVTRGLVVPRGISGAPFRVSPGKRTPCFSVKAVQADKPTYQV  60

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHG L  GP   
Sbjct  61   IQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGFLLVGPFVI  120

Query  376  GGP  384
             GP
Sbjct  121  TGP  123



>gb|EYU46071.1| hypothetical protein MIMGU_mgv1a013446mg [Erythranthe guttata]
Length=220

 Score =   181 bits (459),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   MATV-ASTMASQLKA--ASLMTRGFGVPKGISGAPFKVLPS-RRPSCFTVKAVQSEKPTF  189
            MAT  ASTMASQLK+  AS +TRG   PKGISG PF+VLPS RR S FTV AV+S+KPTF
Sbjct  1    MATTGASTMASQLKSNFASSLTRGLISPKGISGTPFRVLPSSRRTSSFTVNAVKSDKPTF  60

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+QP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP 
Sbjct  61   QVVQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGLLLVGPF  120

Query  370  REGGP  384
             + GP
Sbjct  121  VKTGP  125



>gb|KHG07601.1| Photosystem I reaction center subunit XI, chloroplastic -like 
protein [Gossypium arboreum]
 gb|KHG25010.1| Photosystem I reaction center subunit XI, chloroplastic -like 
protein [Gossypium arboreum]
Length=219

 Score =   178 bits (452),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA--SLMTRGFGVPKGISGAPFKVLPSR-RPSCFTVKAVQSEKPTFQ  192
            MAT AS MA+QLK++  S +TRG  VP+GISG+PFKV   + R  CFTVKAVQS+K TFQ
Sbjct  1    MATTASPMATQLKSSFTSSVTRGLVVPRGISGSPFKVSSGKTRTPCFTVKAVQSDKSTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQP+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHG L  GP  
Sbjct  61   VIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGFLLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>ref|XP_010532930.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Tarenaya hassleriana]
Length=219

 Score =   178 bits (452),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA---SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++   +   R   VPKGISG+PF V P++R S FTVKAVQS+KPTFQ
Sbjct  1    MAASASPMASQLRSSFSSAFTARRLAVPKGISGSPFGVSPAKRSSSFTVKAVQSDKPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHG    GP  
Sbjct  61   VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGFFLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>ref|XP_006368099.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like, 
partial [Solanum tuberosum]
Length=171

 Score =   176 bits (446),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 2/106 (2%)
 Frame = +1

Query  73   MTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLNGDPFIGSLETPV  246
            +TRG G+  PKGISGAPFK+ PS R SCFTVKAVQ++KPTFQVIQPLNGDPFIGSLETPV
Sbjct  2    LTRGHGLVTPKGISGAPFKIFPSTRKSCFTVKAVQADKPTFQVIQPLNGDPFIGSLETPV  61

Query  247  TSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            TSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  + GP
Sbjct  62   TSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKAGP  107



>gb|KDP45210.1| hypothetical protein JCGZ_15075 [Jatropha curcas]
Length=219

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  52   QLKA--ASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLNGDPFI  225
            QLK+  +S +TRG  +P+GISGAPF+V P++R SCFTVKA+QSEKPTFQVIQP+NGDPFI
Sbjct  12   QLKSRFSSSITRGLVIPRGISGAPFRVSPTKRSSCFTVKAIQSEKPTFQVIQPINGDPFI  71

Query  226  GSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            GSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP  + GP
Sbjct  72   GSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGLLLVGPFVKAGP  124



>ref|XP_006414990.1| hypothetical protein EUTSA_v10026195mg [Eutrema salsugineum]
 gb|ESQ56443.1| hypothetical protein EUTSA_v10026195mg [Eutrema salsugineum]
Length=219

 Score =   175 bits (444),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA---SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++   + + R   VPKGISGAPF V P++R S  TV+AVQ++KPTFQ
Sbjct  1    MAASASPMASQLRSSFSSASIARRLAVPKGISGAPFGVSPTKRTSSLTVRAVQADKPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  
Sbjct  61   VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>emb|CDY34527.1| BnaA08g04820D [Brassica napus]
Length=219

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLK---AASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MAT AS MASQL+   +++   R   VPKGISGAPF V P+++   FTV+A+QS+KPTFQ
Sbjct  1    MATTASPMASQLRLSFSSATNARRLAVPKGISGAPFGVSPTKKTFSFTVRALQSDKPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  
Sbjct  61   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>ref|XP_011009621.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Populus euphratica]
Length=216

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MAT AS MASQLK+  AS + R   +P+GISGAPF+V P++R   FTVKAVQ++KPT+QV
Sbjct  1    MATTASPMASQLKSSLASSLGRRLVIPRGISGAPFRVSPNKR--SFTVKAVQADKPTYQV  58

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  +
Sbjct  59   IQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFVK  118

Query  376  GGP  384
             GP
Sbjct  119  AGP  121



>ref|XP_002303024.2| Photosystem I reaction center subunit XI family protein, partial 
[Populus trichocarpa]
 gb|EEE82297.2| Photosystem I reaction center subunit XI family protein, partial 
[Populus trichocarpa]
Length=227

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 4/124 (3%)
 Frame = +1

Query  19   RMATVASTMASQLKA--ASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            +MAT AS MASQLK+  AS + R   +P  ISGAPF+V PS+R   FTVKA+QSEKPT+Q
Sbjct  11   QMATAASPMASQLKSSFASSLARRLVIPTAISGAPFRVSPSKR--SFTVKAIQSEKPTYQ  68

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  
Sbjct  69   VVQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFV  128

Query  373  EGGP  384
            + GP
Sbjct  129  KAGP  132



>ref|XP_002320562.1| Photosystem I reaction center subunit XI family protein [Populus 
trichocarpa]
 gb|ABK95404.1| unknown [Populus trichocarpa]
 gb|ABK96038.1| unknown [Populus trichocarpa]
 gb|EEE98877.1| Photosystem I reaction center subunit XI family protein [Populus 
trichocarpa]
Length=216

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = +1

Query  22   MATVASTMASQLKA--ASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MAT AS MASQLK+  AS + R   +P+GISGAPF+V P++R   FTVKAVQ++KPT+QV
Sbjct  1    MATTASPMASQLKSSLASSLGRRLVIPRGISGAPFRVSPNKR--SFTVKAVQADKPTYQV  58

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            +QP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  +
Sbjct  59   VQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFVK  118

Query  376  GGP  384
             GP
Sbjct  119  AGP  121



>emb|CDY70523.1| BnaC04g55930D [Brassica napus]
Length=219

 Score =   173 bits (439),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA---SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++   + + R   VPKGISG  F V P++R S FTV+AVQS+KPTFQ
Sbjct  1    MAASASPMASQLRSSFSSTSIARRLAVPKGISGPSFGVYPTKRISSFTVRAVQSDKPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  
Sbjct  61   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>ref|XP_006447949.1| hypothetical protein CICLE_v10016637mg [Citrus clementina]
 ref|XP_006469342.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Citrus sinensis]
 gb|ESR61189.1| hypothetical protein CICLE_v10016637mg [Citrus clementina]
Length=218

 Score =   173 bits (438),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA--SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MA+V+S MASQLK++  S ++R    P+GISG+PF+V+PS+R   F VKA+QSEKPT+QV
Sbjct  1    MASVSSPMASQLKSSFTSPVSRSLLTPRGISGSPFRVVPSKRSPRFIVKAIQSEKPTYQV  60

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP  +
Sbjct  61   IQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPFVK  120

Query  376  GGP  384
             GP
Sbjct  121  AGP  123



>ref|XP_009139665.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Brassica rapa]
 emb|CDY39710.1| BnaA04g07250D [Brassica napus]
Length=219

 Score =   173 bits (438),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA---SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++   + + R   VPKGISG  F V P++R S FTV+AVQS+KPTFQ
Sbjct  1    MAASASPMASQLRSSLSSTSIARRLAVPKGISGPSFGVYPTKRISSFTVRAVQSDKPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  
Sbjct  61   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>gb|KDO43506.1| hypothetical protein CISIN_1g027843mg [Citrus sinensis]
Length=218

 Score =   173 bits (438),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA--SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MA+V+S MASQLK++  S ++R    P+GISG+PF+V+PS+R   F VKA+QSEKPT+QV
Sbjct  1    MASVSSPMASQLKSSFTSPVSRSLLTPRGISGSPFRVVPSKRSPRFLVKAIQSEKPTYQV  60

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP  +
Sbjct  61   IQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPFVK  120

Query  376  GGP  384
             GP
Sbjct  121  AGP  123



>ref|XP_011080550.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Sesamum indicum]
Length=220

 Score =   172 bits (437),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +1

Query  64   ASLMTRGFGVPKGISGAPFKVLPS--RRPSCFTVKAVQSEKPTFQVIQPLNGDPFIGSLE  237
            AS  TR    P+GISGAPF+VLPS  RR S FT+KAVQS+KPTFQVIQP+NGDPFIGSLE
Sbjct  17   ASSFTRALATPRGISGAPFRVLPSTSRRTSSFTIKAVQSDKPTFQVIQPINGDPFIGSLE  76

Query  238  TPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            TPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  + GP
Sbjct  77   TPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKAGP  125



>ref|XP_010440626.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Camelina sativa]
 ref|XP_010450247.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Camelina sativa]
Length=219

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA---SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++   + + +   VPKGISGAPF V P++R S FTV+AV+S+KPTFQ
Sbjct  1    MAASASPMASQLRSSFSSTSLAKRLAVPKGISGAPFGVSPTKRVSSFTVRAVKSDKPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLP YRTAVNPLLRG+EVGLAHG    GP  
Sbjct  61   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  353  FLVGPFVKAGPLRNTVYAGSAXSLA  427
            FLVGPFVKAGPLRNTVYAG A SLA
Sbjct  114  FLVGPFVKAGPLRNTVYAGQAGSLA  138



>ref|XP_010435345.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Camelina sativa]
Length=219

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKA---ASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL++   ++ + +   VPKGISGAPF V P++R S FTV+AV+S+KPTFQ
Sbjct  1    MAASASPMASQLRSNFSSTSLAKRLAVPKGISGAPFGVSPTKRVSSFTVRAVKSDKPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLP YRTAVNPLLRG+EVGLAHG    GP  
Sbjct  61   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  353  FLVGPFVKAGPLRNTVYAGSAXSLA  427
            FLVGPFVKAGPLRNTVYAG A SLA
Sbjct  114  FLVGPFVKAGPLRNTVYAGQAGSLA  138



>ref|XP_010039031.1| PREDICTED: LOW QUALITY PROTEIN: photosystem I reaction center 
subunit XI, chloroplastic [Eucalyptus grandis]
Length=153

 Score =   169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 105/144 (73%), Gaps = 11/144 (8%)
 Frame = +1

Query  25   ATVASTMASQLKAASLMTRG-----FGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            A  AS MA+QLK++   +          PKG+SG+ F+ LP+RR   FTVKA+QSEKPTF
Sbjct  3    AATASPMATQLKSSFASSSSSSARSLIAPKGLSGSSFRALPTRRTHSFTVKAIQSEKPTF  62

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP 
Sbjct  63   QVVQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPF  122

Query  370  REGGP-----TEKHGL-RRECXVL  423
               GP      E+  + RR C +L
Sbjct  123  VXAGPLRHEYAEQQIIGRRACVIL  146



>ref|XP_011015312.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Populus euphratica]
Length=216

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 100/123 (81%), Gaps = 4/123 (3%)
 Frame = +1

Query  22   MATVASTMASQLK--AASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MAT AS MASQLK   AS + R   +P  I GAPF+V PS+R   FTVKA+QSEKPT+QV
Sbjct  1    MATAASPMASQLKRSFASSLARRLVIPTTIYGAPFRVSPSKR--SFTVKAIQSEKPTYQV  58

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  +
Sbjct  59   IQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFVK  118

Query  376  GGP  384
             GP
Sbjct  119  AGP  121



>ref|XP_010913060.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Elaeis guineensis]
Length=219

 Score =   170 bits (431),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MAT-VASTMASQLKAASLM--TRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MAT  AS MASQLK++ L   TRG   P+GISG+P + + SR+  C TVKA+QSEKPT+Q
Sbjct  1    MATATASPMASQLKSSFLSSSTRGLVTPRGISGSPLRDMHSRKRPCLTVKAIQSEKPTYQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQP+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  
Sbjct  61   VIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KTGP  124



>gb|KJB08749.1| hypothetical protein B456_001G101200 [Gossypium raimondii]
Length=219

 Score =   170 bits (431),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAA--SLMTRGFGVPKGISGAPFKVLPSR-RPSCFTVKAVQSEKPTFQ  192
            MAT +S +A +LK++  S +T    VPKGISGAPF+  P + R  CFTVKAVQS++PTFQ
Sbjct  1    MATTSSPLAGRLKSSFTSSLTGKLVVPKGISGAPFRFSPGKTRTPCFTVKAVQSDEPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQP+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHG L  GP  
Sbjct  61   VIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGFLLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>ref|XP_010037093.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Eucalyptus grandis]
 gb|KCW48727.1| hypothetical protein EUGRSUZ_K023621 [Eucalyptus grandis]
Length=219

 Score =   170 bits (431),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = +1

Query  25   ATVASTMASQLKAASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVI  198
            A  AS MASQLK++   +    +  PKG+SG+ F+ LP+RR   FTVKA+QSEKPTFQV+
Sbjct  3    AATASPMASQLKSSFASSSSRSLIAPKGLSGSSFRALPTRRTRSFTVKAIQSEKPTFQVV  62

Query  199  QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREG  378
            QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  + 
Sbjct  63   QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKA  122

Query  379  GP  384
            GP
Sbjct  123  GP  124



>ref|XP_008813507.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Phoenix dactylifera]
Length=219

 Score =   170 bits (430),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MAT-VASTMASQLKAA--SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MAT  AS MASQLK++  S+ TRG   P+GISG+P + + SR+  C TVKA+QSEKPT+Q
Sbjct  1    MATATASPMASQLKSSLLSIGTRGLVTPRGISGSPLRDMNSRKRPCLTVKAIQSEKPTYQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETP+TSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  
Sbjct  61   VVQPINGDPFIGSLETPITSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KTGP  124



>gb|KJB84065.1| hypothetical protein B456_N002100 [Gossypium raimondii]
Length=218

 Score =   169 bits (429),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = +1

Query  22   MATVASTMASQLKAA--SLMTRGFGVPKGISGAPFKVLPSR-RPSCFTVKAVQSEKPTFQ  192
            MAT AS MA+QLK++  S +TRG  VP+GISG+PFKV   + R  CFTVKAVQS+K   Q
Sbjct  1    MATTASPMATQLKSSFTSSVTRGLVVPRGISGSPFKVSSGKTRTPCFTVKAVQSDKXX-Q  59

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHG L  GP  
Sbjct  60   VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGFLLVGPFV  119

Query  373  EGGP  384
            + GP
Sbjct  120  KAGP  123



>emb|CDP03987.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  22   MATVAST---MASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MAT AST      Q   AS +T     PKGIS APF+VLPSRR SCFT+KA+QSEKPT+Q
Sbjct  1    MATAASTTMASQLQSSLASSLTTRLATPKGISAAPFRVLPSRRKSCFTIKAIQSEKPTYQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQPLNGDPFIGSLETPVTSSP++AW+LSNLP YRTAV+PLLRGIEVGLAHG L  GP  
Sbjct  61   VIQPLNGDPFIGSLETPVTSSPIVAWFLSNLPGYRTAVSPLLRGIEVGLAHGYLLVGPFV  120

Query  373  EGGPTEKHGLR  405
              GP     ++
Sbjct  121  ITGPLRNTDIK  131



>ref|XP_008218442.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Prunus mume]
Length=252

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 100/120 (83%), Gaps = 3/120 (3%)
 Frame = +1

Query  34   ASTMASQLKA--ASLMTRGFGV-PKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQP  204
            AS MASQLK+   S +TR   V PKG+S +P  +LPS+R S FT+KAVQSEKPTFQVIQP
Sbjct  38   ASPMASQLKSNFTSPITRAALVSPKGLSASPLSLLPSKRLSSFTIKAVQSEKPTFQVIQP  97

Query  205  LNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            +NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  + GP
Sbjct  98   INGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFVKAGP  157



>ref|XP_006282464.1| hypothetical protein CARUB_v10005700mg [Capsella rubella]
 gb|EOA15362.1| hypothetical protein CARUB_v10005700mg [Capsella rubella]
Length=219

 Score =   168 bits (426),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMT---RGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++   T   +   VPKGISGAPF V P++R S FTV+AV+S+KPTFQ
Sbjct  1    MAASASPMASQLRSSFSSTSLSKRLAVPKGISGAPFGVSPTKRVSPFTVRAVKSDKPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQP+NGDPFIGSLETPVTSSPLIAWYLSNLP YRTAVNPLLRG+EVGLAHG    GP  
Sbjct  61   VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124


 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  353  FLVGPFVKAGPLRNTVYAGSAXSLA  427
            FLVGPFVKAGPLRNTVYAG A SLA
Sbjct  114  FLVGPFVKAGPLRNTVYAGQAGSLA  138



>ref|XP_007205874.1| hypothetical protein PRUPE_ppa011229mg [Prunus persica]
 gb|EMJ07073.1| hypothetical protein PRUPE_ppa011229mg [Prunus persica]
Length=218

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 99/120 (83%), Gaps = 3/120 (3%)
 Frame = +1

Query  34   ASTMASQLKA--ASLMTR-GFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQP  204
            AS MASQLK+   S +TR     PKG+S +P  +LPS+R S FT+KAVQS+KPTFQVIQP
Sbjct  4    ASPMASQLKSNFTSPITRPALVSPKGLSASPLSLLPSKRLSSFTIKAVQSDKPTFQVIQP  63

Query  205  LNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            +NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  + GP
Sbjct  64   INGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFVKAGP  123



>ref|NP_001236868.1| uncharacterized protein LOC100527240 [Glycine max]
 gb|ACU16295.1| unknown [Glycine max]
 gb|KHN29272.1| Photosystem I reaction center subunit XI, chloroplastic [Glycine 
soja]
Length=214

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 96/118 (81%), Gaps = 3/118 (3%)
 Frame = +1

Query  34   ASTMASQLKAASLMTRGFGVPKGISGA-PFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLN  210
            AS MASQLK  S  TR    PKG+S + P  ++PSRR   FTVKA+QSEKPT+QVIQP+N
Sbjct  4    ASPMASQLK--STFTRTLVAPKGLSASSPLHLVPSRRQFSFTVKAIQSEKPTYQVIQPIN  61

Query  211  GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  + GP
Sbjct  62   GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFVKAGP  119



>ref|NP_193016.1| photosystem I subunit L [Arabidopsis thaliana]
 sp|Q9SUI4.2|PSAL_ARATH RecName: Full=Photosystem I reaction center subunit XI, chloroplastic; 
Short=PSI-L; AltName: Full=PSI subunit V; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL16216.1|AF428447_1 AT4g12800/T20K18_150 [Arabidopsis thaliana]
 gb|AAL48225.1|AF446350_1 AT4g12800/T20K18_150 [Arabidopsis thaliana]
 emb|CAB40997.1| probable photosystem I chain XI precursor [Arabidopsis thaliana]
 emb|CAB78322.1| probable photosystem I chain XI precursor [Arabidopsis thaliana]
 gb|AAL24431.1| probable photosystem I chain XI precursor [Arabidopsis thaliana]
 gb|AAM19943.1| AT4g12800/T20K18_150 [Arabidopsis thaliana]
 gb|AAM64889.1| probable photosystem I chain XI precursor [Arabidopsis thaliana]
 gb|AEE83186.1| photosystem I subunit L [Arabidopsis thaliana]
Length=219

 Score =   166 bits (419),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMT---RGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++       +   VPKGISGAPF V P++R S FTV+AV+S+K TFQ
Sbjct  1    MAASASPMASQLRSSFSSASLSQRLAVPKGISGAPFGVSPTKRVSSFTVRAVKSDKTTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLP YRTAVNPLLRG+EVGLAHG    GP  
Sbjct  61   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>gb|ACG24344.1| photosystem I reaction center subunit XI [Zea mays]
Length=219

 Score =   165 bits (418),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMT---RGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++       +   VPKGISGAPF V P++R S FTV+AV+S+K TFQ
Sbjct  1    MAASASPMASQLRSSFSSASLSQRLAVPKGISGAPFGVSPTKRVSSFTVRAVKSDKTTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLP YRTAVNPLLRG+EVGLAHG    GP  
Sbjct  61   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>gb|KCW48725.1| hypothetical protein EUGRSUZ_K023622, partial [Eucalyptus grandis]
Length=118

 Score =   162 bits (409),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 5/115 (4%)
 Frame = +1

Query  25   ATVASTMASQLKAASLMTRG-----FGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTF  189
            A  AS MA+QLK++   +          PKG+SG+ F+ LP+RR   FTVKA+QSEKPTF
Sbjct  3    AATASPMATQLKSSFASSSSSSARSLIAPKGLSGSSFRALPTRRTHSFTVKAIQSEKPTF  62

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSL  354
            QV+QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L
Sbjct  63   QVVQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFL  117



>gb|AGV54333.1| photosystem I reaction center subunit XI [Phaseolus vulgaris]
 gb|AGV54505.1| photosystem I reaction center subunit XI [Phaseolus vulgaris]
Length=214

 Score =   165 bits (417),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 96/118 (81%), Gaps = 3/118 (3%)
 Frame = +1

Query  34   ASTMASQLKAASLMTRGFGVPKGISGA-PFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLN  210
            +S MASQLK  S  TR    PKG+S + P  + PSRR S FTVKA+QS+KPT+QVIQP+N
Sbjct  4    SSPMASQLK--STFTRTLVSPKGLSASSPLPLFPSRRHSTFTVKAIQSDKPTYQVIQPIN  61

Query  211  GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  + GP
Sbjct  62   GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFVKAGP  119



>ref|XP_002863290.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39549.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=219

 Score =   165 bits (417),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRG---FGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MAT AS MASQL+++           VPKGISGAPF V  ++R S FTV+AV+S+KPTFQ
Sbjct  1    MATSASPMASQLRSSFSSASLSRRLAVPKGISGAPFGVSSTKRVSSFTVRAVKSDKPTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQP+NGDPFIGSLETPVTSSPLIAWYLSNLP YRTAVNPLLRG+EVGLAHG    GP  
Sbjct  61   VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>ref|XP_007139728.1| hypothetical protein PHAVU_008G054400g [Phaseolus vulgaris]
 gb|ESW11722.1| hypothetical protein PHAVU_008G054400g [Phaseolus vulgaris]
Length=256

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +1

Query  16   PRMATVASTMASQLKAASLMTRGFGVPKGISGA-PFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            P MA  +S MASQLK  S  TR    PKG+S + P  + PSRR S FTVKA+QS+KPT+Q
Sbjct  41   PIMA-ASSPMASQLK--STFTRTLVSPKGLSASSPLPLFPSRRHSTFTVKAIQSDKPTYQ  97

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            VIQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  
Sbjct  98   VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFV  157

Query  373  EGGP  384
            + GP
Sbjct  158  KAGP  161



>gb|KFK25351.1| hypothetical protein AALP_AA8G101400 [Arabis alpina]
Length=219

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAASL---MTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++     + R   VPKGISGAPF V  ++R S FTV+AV+S+K  FQ
Sbjct  1    MAASASPMASQLRSSFSSSSIERRLAVPKGISGAPFGVSSTKRVSSFTVRAVKSDKQNFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLP YRTAVNPLLRG+EVGLAHG    GP  
Sbjct  61   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>ref|NP_001236277.1| uncharacterized protein LOC100500317 [Glycine max]
 gb|ACU15356.1| unknown [Glycine max]
 gb|KHN40470.1| Photosystem I reaction center subunit XI, chloroplastic [Glycine 
soja]
Length=214

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 96/118 (81%), Gaps = 3/118 (3%)
 Frame = +1

Query  34   ASTMASQLKAASLMTRGFGVPKGISGA-PFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLN  210
            AS MASQLK  S  T+    PKG+S + P  +LPS+R   FTV+A+QSEKPT+QVIQP+N
Sbjct  4    ASPMASQLK--STFTKTLVAPKGLSASSPLHLLPSKRQFSFTVRAIQSEKPTYQVIQPIN  61

Query  211  GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  + GP
Sbjct  62   GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFVKAGP  119



>ref|XP_007029381.1| Photosystem I reaction center subunit XI [Theobroma cacao]
 gb|EOY09883.1| Photosystem I reaction center subunit XI [Theobroma cacao]
Length=217

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 2/119 (2%)
 Frame = +1

Query  34   ASTMASQLKAA--SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQPL  207
            AS MAS LK++  S ++R    PK    +P +VLPSRR S FT++AVQSEKPT+QVIQP+
Sbjct  4    ASPMASHLKSSFTSPISRALVSPKVPFASPLRVLPSRRQSSFTIRAVQSEKPTYQVIQPI  63

Query  208  NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  + GP
Sbjct  64   NGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFVKAGP  122



>sp|Q41385.1|PSAL_SPIOL RecName: Full=Photosystem I reaction center subunit XI, chloroplastic; 
Short=PSI-L; AltName: Full=PSI subunit V; Flags: Precursor 
[Spinacia oleracea]
 pdb|2WSC|L Chain L, Improved Model Of Plant Photosystem I
 pdb|2WSE|L Chain L, Improved Model Of Plant Photosystem I
 pdb|2WSF|L Chain L, Improved Model Of Plant Photosystem I
 emb|CAA45775.1| subunit XI of photosystem I reaction center [Spinacia oleracea]
Length=216

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 96/122 (79%), Gaps = 2/122 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPS-RRPSCFTVKAVQSEKPTFQVI  198
            MA   S MASQLK+    T+   VPKGISG   +  PS RR + FTV+A+++EKPT+QVI
Sbjct  1    MAATTSPMASQLKSG-FTTKALVVPKGISGPALRGFPSPRRHTSFTVRAIKTEKPTYQVI  59

Query  199  QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREG  378
            QPLNGDPFIG LETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  + 
Sbjct  60   QPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKA  119

Query  379  GP  384
            GP
Sbjct  120  GP  121



>ref|XP_004492835.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Cicer arietinum]
Length=214

 Score =   162 bits (411),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 94/118 (80%), Gaps = 3/118 (3%)
 Frame = +1

Query  34   ASTMASQLKAASLMTRGFGVPKGISGA-PFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLN  210
            AS MASQLK++   TR    PKG+ G+ P    PSRR   FTVKA+QSEKPT+QVIQP+N
Sbjct  4    ASPMASQLKSS--FTRPLVTPKGLCGSSPLHHFPSRRQFNFTVKAIQSEKPTYQVIQPIN  61

Query  211  GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            GDPFIGSLETPVTSSPL+AWYLSNLPAYRTAVNPLLRGIEVGLAHG    GP  + GP
Sbjct  62   GDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVNPLLRGIEVGLAHGFFLVGPFVKAGP  119



>ref|XP_009405532.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=221

 Score =   162 bits (410),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 4/118 (3%)
 Frame = +1

Query  43   MASQLKAASLMT----RGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLN  210
            MASQLK++ L +    R   +P+G+S  P + L SR+  C TV+A+Q+EKPT+QVIQP+N
Sbjct  9    MASQLKSSLLFSCRSSRRLVIPRGLSATPLRDLHSRKKLCLTVRAIQAEKPTYQVIQPIN  68

Query  211  GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP  + GP
Sbjct  69   GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFVKAGP  126



>ref|XP_004302156.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=216

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 3/119 (3%)
 Frame = +1

Query  34   ASTMASQLKAA--SLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQPL  207
            A+ MASQLK+   S ++R    PKG+S +P K+ PS+R S FT+KA Q++KP FQVIQP+
Sbjct  4    AAPMASQLKSTFTSPVSRALLAPKGLSASPLKLFPSKRSSSFTIKATQTDKP-FQVIQPI  62

Query  208  NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP  + GP
Sbjct  63   NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFVKAGP  121



>emb|CAB53034.1| photosystem I subunit XI precursor [Arabidopsis thaliana]
Length=219

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 96/124 (77%), Gaps = 3/124 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMT---RGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQ  192
            MA  AS MASQL+++       +   VPK  SGAPF V P++R S FTV+AV+S+K TFQ
Sbjct  1    MAASASPMASQLRSSFSSASLSQRLAVPKQFSGAPFGVSPTKRVSSFTVRAVKSDKTTFQ  60

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLP YRTAVNPLLRG+EVGLAHG    GP  
Sbjct  61   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFV  120

Query  373  EGGP  384
            + GP
Sbjct  121  KAGP  124



>gb|ACS68717.1| photosystem I subunit XI [Sonneratia alba]
 gb|ACS68788.1| photosystem I subunit XI, partial [Sonneratia alba]
Length=103

 Score =   158 bits (399),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +1

Query  76   TRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSS  255
            +RG   PKGISG+P +  PSRR +  T++AVQ++KPTFQVIQP+NGDPFIGSLETPVTSS
Sbjct  1    SRGLIAPKGISGSPLQAFPSRRTASLTIRAVQADKPTFQVIQPINGDPFIGSLETPVTSS  60

Query  256  PLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            PLIAWYLSNLPAYRT+V+PLLRG+EVGLAHG L  GP  + GP
Sbjct  61   PLIAWYLSNLPAYRTSVSPLLRGVEVGLAHGFLLVGPFVKAGP  103



>ref|XP_009338009.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Pyrus x bretschneideri]
Length=219

 Score =   160 bits (405),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 98/121 (81%), Gaps = 4/121 (3%)
 Frame = +1

Query  34   ASTMASQLKA---ASLMTR-GFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            AS MASQLK+   + + TR     PKG+S +PF++ PS+R S F++KAVQS+K  FQVIQ
Sbjct  4    ASPMASQLKSNFTSPITTRPALLSPKGLSASPFRLFPSKRLSSFSIKAVQSDKQNFQVIQ  63

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP  + G
Sbjct  64   PINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPFVKTG  123

Query  382  P  384
            P
Sbjct  124  P  124



>ref|XP_003624162.1| Photosystem I reaction center subunit XI [Medicago truncatula]
 gb|ABD28376.1| Photosystem I reaction centre, subunit XI PsaL [Medicago truncatula]
 gb|AES80380.1| photosystem I reaction center subunit XI [Medicago truncatula]
 gb|AFK46479.1| unknown [Medicago truncatula]
Length=214

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 93/118 (79%), Gaps = 3/118 (3%)
 Frame = +1

Query  34   ASTMASQLKAASLMTRGFGVPKGISGA-PFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLN  210
            AS MASQLK++   TR    P+G+ G+ P   LPSRR   FTVKA+QSEKP +QVIQP+N
Sbjct  4    ASPMASQLKSS--FTRPLVTPRGLCGSSPLHQLPSRRQFNFTVKAIQSEKPNYQVIQPIN  61

Query  211  GDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            GDPFIGSLETPVTSSPL+AWYLSNLP YRTAVNPLLRGIEVGLAHG    GP  + GP
Sbjct  62   GDPFIGSLETPVTSSPLVAWYLSNLPGYRTAVNPLLRGIEVGLAHGFFLVGPFVKAGP  119



>ref|XP_008370824.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Malus domestica]
 ref|XP_008345745.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Malus domestica]
 ref|XP_008355852.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Malus domestica]
Length=219

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 97/121 (80%), Gaps = 4/121 (3%)
 Frame = +1

Query  34   ASTMASQLKA---ASLMTR-GFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            AS MASQLK+   + + TR     PKG+S +P ++ PS+R S F++KAVQS+K  FQVIQ
Sbjct  4    ASPMASQLKSNFTSPITTRPALFSPKGLSASPLRLFPSKRLSSFSIKAVQSDKQNFQVIQ  63

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  + G
Sbjct  64   PINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFVKTG  123

Query  382  P  384
            P
Sbjct  124  P  124



>ref|XP_010673930.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=216

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 97/139 (70%), Gaps = 5/139 (4%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPS-RRPSCFTVKAVQSEKPTFQVI  198
            MA   + MASQLK+    TR    PKGISG   +  PS RR   FT+KA+QSEK  +QVI
Sbjct  1    MAATTAPMASQLKSG-FTTRTLVAPKGISGPALRGFPSSRRNPSFTIKAIQSEKQAYQVI  59

Query  199  QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREG  378
            QPLNGDPFIG LETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP  + 
Sbjct  60   QPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKT  119

Query  379  GP---TEKHGLRRECXVLG  426
            GP   TE  G       +G
Sbjct  120  GPLRNTEYAGAAGSLAAVG  138



>ref|XP_008388809.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Malus domestica]
Length=219

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 95/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  34   ASTMASQLKA---ASLMTR-GFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            AS MASQLK+   + + TR     PKG+S +P  + PS+R S F++KAVQS+K  FQVIQ
Sbjct  4    ASPMASQLKSNFTSPITTRPALLSPKGLSASPLXLFPSKRLSSFSIKAVQSDKQNFQVIQ  63

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV PLLRGIEVGLAHG L  GP  + G
Sbjct  64   PINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVXPLLRGIEVGLAHGFLLVGPFVKTG  123

Query  382  P  384
            P
Sbjct  124  P  124



>gb|ABG21996.1| Photosystem I reaction center subunit XI, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=199

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 99/130 (76%), Gaps = 11/130 (8%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            MAT  + MASQL  +SL+      P+G+SGA      +RRP  FTVKA+QSEKPT+QV+Q
Sbjct  1    MATAYAPMASQLMKSSLVCSK---PRGLSGASL----TRRPR-FTVKAIQSEKPTYQVVQ  52

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP    G
Sbjct  53   PINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALTG  112

Query  382  P---TEKHGL  402
            P   T  HGL
Sbjct  113  PLRNTPVHGL  122



>ref|XP_010095590.1| Photosystem I reaction center subunit XI [Morus notabilis]
 gb|EXB61163.1| Photosystem I reaction center subunit XI [Morus notabilis]
Length=224

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 96/126 (76%), Gaps = 11/126 (9%)
 Frame = +1

Query  34   ASTMASQLKAASLMTRG------FGVPKGISGAPFKVLPS---RRPSCFTVKAVQSEKPT  186
            AS MASQ K +  +TR          PKGI G+  + LPS    RP CFTV+A+QSEKPT
Sbjct  6    ASPMASQPKNS--ITRCAASWELLASPKGICGSQLRALPSFNRSRPRCFTVRAIQSEKPT  63

Query  187  FQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGP  366
            +QVIQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP
Sbjct  64   YQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGP  123

Query  367  IREGGP  384
              + GP
Sbjct  124  FVKTGP  129



>ref|XP_002278780.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Vitis vinifera]
 emb|CAN82638.1| hypothetical protein VITISV_028819 [Vitis vinifera]
 emb|CBI17642.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +1

Query  22   MATVASTMASQLKAA---SLMTRGFGV--PKGISGAPFKVLPSRR-PSCFTVKAVQSEKP  183
            MAT AS MASQLK++      +R   V  PKG+S +P +   SRR PS F++KA+QSEKP
Sbjct  1    MAT-ASPMASQLKSSFTSPTTSRALPVASPKGLSASPLRPFSSRRAPSSFSIKAIQSEKP  59

Query  184  TFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGG  363
            T+QVIQP+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAV+P+LRGIEVGLAHG L  G
Sbjct  60   TYQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPVLRGIEVGLAHGFLLVG  119

Query  364  PIREGGP  384
            P  + GP
Sbjct  120  PFVKTGP  126



>ref|NP_001066659.1| Os12g0420400 [Oryza sativa Japonica Group]
 gb|ABA97624.1| Photosystem I reaction center subunit XI, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29678.1| Os12g0420400 [Oryza sativa Japonica Group]
 gb|EAY82911.1| hypothetical protein OsI_38125 [Oryza sativa Indica Group]
 dbj|BAG93929.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97117.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87099.1| unnamed protein product [Oryza sativa Japonica Group]
Length=208

 Score =   154 bits (389),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 95/121 (79%), Gaps = 8/121 (7%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            MAT  + MASQL  +SL+      P+G+SGA      +RRP  FTVKA+QSEKPT+QV+Q
Sbjct  1    MATAYAPMASQLMKSSLVCSK---PRGLSGASL----TRRPR-FTVKAIQSEKPTYQVVQ  52

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP    G
Sbjct  53   PINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALTG  112

Query  382  P  384
            P
Sbjct  113  P  113



>ref|XP_009415117.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=219

 Score =   152 bits (384),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  91   VPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAW  270
            +PKGIS  P + L SRR    TV+A+Q+EKPT+QVIQP+NGDPFIGSLETPVTSSPL+AW
Sbjct  27   IPKGISRTPLRDLQSRRKPSLTVRAIQAEKPTYQVIQPINGDPFIGSLETPVTSSPLVAW  86

Query  271  YLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            YLSNLPAYRTAV+PLLRG+EVGLAHG L  GP  + GP
Sbjct  87   YLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFVKAGP  124



>ref|NP_001267647.1| photosystem I reaction center subunit XI, chloroplastic [Cucumis 
sativus]
 dbj|BAA11677.1| subunit of photosystem I [Cucumis sativus]
 gb|KGN61263.1| Photosystem I reaction center subunit XI [Cucumis sativus]
Length=217

 Score =   150 bits (380),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAASLM--TRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MAT  S +ASQL ++     TR    PKG+S +P + +P+R  S FT++A+Q++KPTFQV
Sbjct  1    MATATSPIASQLSSSFASSNTRALISPKGLSASPLRRIPTRTHS-FTIRAIQADKPTFQV  59

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG    GP  +
Sbjct  60   IQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFFLVGPFVK  119

Query  376  GGP  384
             GP
Sbjct  120  AGP  122



>sp|Q39654.1|PSAL_CUCSA RecName: Full=Photosystem I reaction center subunit XI, chloroplastic; 
Short=PSI-L; AltName: Full=PSI subunit V; Flags: Precursor 
[Cucumis sativus]
 dbj|BAA09047.1| PsaL [Cucumis sativus]
Length=217

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 86/103 (83%), Gaps = 1/103 (1%)
 Frame = +1

Query  76   TRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSS  255
            TR    PKG+S +P + +P+R  S FT++A+Q++KPTFQVIQP+NGDPFIGSLETPVTSS
Sbjct  21   TRALISPKGLSASPLRRIPTRTHS-FTIRAIQADKPTFQVIQPINGDPFIGSLETPVTSS  79

Query  256  PLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            PLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG    GP  + GP
Sbjct  80   PLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFFLVGPFVKAGP  122



>gb|EPS59631.1| hypothetical protein M569_15172, partial [Genlisea aurea]
Length=228

 Score =   150 bits (379),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = +1

Query  94   PKGISGA-PFKVLPSRRPSC--FTVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLI  264
            PKGISG+ P + + SRR +   FT+KA+QSEKPT+QVIQP+NGDPFIGSLETPVTSSPLI
Sbjct  34   PKGISGSSPLRFIASRRRTTPSFTIKAIQSEKPTYQVIQPINGDPFIGSLETPVTSSPLI  93

Query  265  AWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            AWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP    GP
Sbjct  94   AWYLSNLPAYRTAVNPLLRGVEVGLAHGYLLVGPFVIAGP  133



>ref|XP_008655244.1| PREDICTED: uncharacterized protein LOC100383080 isoform X1 [Zea 
mays]
 gb|ACF85882.1| unknown [Zea mays]
 gb|ACF86419.1| unknown [Zea mays]
 gb|AFW80144.1| photosystem I reaction center subunit XI isoform 1 [Zea mays]
 gb|AFW80145.1| photosystem I reaction center subunit XI isoform 2 [Zea mays]
Length=211

 Score =   150 bits (378),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 93/121 (77%), Gaps = 5/121 (4%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            MAT  + MASQ+  +SL+      P+G+SGA      +RRP  FTVKA+Q EK T+QV+Q
Sbjct  1    MATAYAPMASQVMKSSLVVHS--RPRGLSGA---AALTRRPGRFTVKAIQPEKATYQVVQ  55

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP    G
Sbjct  56   PINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFALTG  115

Query  382  P  384
            P
Sbjct  116  P  116



>gb|ACG28265.1| photosystem I reaction center subunit XI [Zea mays]
 gb|ACG28472.1| photosystem I reaction center subunit XI [Zea mays]
Length=211

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 93/121 (77%), Gaps = 5/121 (4%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            MAT  + MASQ+  +SL+      P+G+SGA      +RRP  FTVKA+Q EK T+QV+Q
Sbjct  1    MATAYAPMASQVMKSSLVVHS--RPRGLSGA---AALTRRPGRFTVKAIQPEKATYQVVQ  55

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP    G
Sbjct  56   PINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFALTG  115

Query  382  P  384
            P
Sbjct  116  P  116



>ref|XP_008441854.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Cucumis melo]
Length=217

 Score =   149 bits (377),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +1

Query  22   MATVASTMASQLKAASLM--TRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MAT  S +ASQL ++     TR    PKG+S +P + +P+R  S FT++A+Q++KPT+QV
Sbjct  1    MATATSPIASQLSSSFASSNTRALISPKGLSASPLRRIPTRTHS-FTIRAIQADKPTYQV  59

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG    GP  +
Sbjct  60   IQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFFLVGPFVK  119

Query  376  GGP  384
             GP
Sbjct  120  AGP  122



>gb|AFW80143.1| hypothetical protein ZEAMMB73_091068 [Zea mays]
Length=240

 Score =   150 bits (378),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 93/121 (77%), Gaps = 5/121 (4%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            MAT  + MASQ+  +SL+      P+G+SGA      +RRP  FTVKA+Q EK T+QV+Q
Sbjct  1    MATAYAPMASQVMKSSLVVHS--RPRGLSGA---AALTRRPGRFTVKAIQPEKATYQVVQ  55

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP    G
Sbjct  56   PINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFALTG  115

Query  382  P  384
            P
Sbjct  116  P  116



>ref|XP_002457272.1| hypothetical protein SORBIDRAFT_03g004560 [Sorghum bicolor]
 gb|EES02392.1| hypothetical protein SORBIDRAFT_03g004560 [Sorghum bicolor]
Length=211

 Score =   147 bits (372),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            MAT  + MASQ+  +SL       P+G+SGA      +RRP  FTVKA+Q EK T+QV+Q
Sbjct  1    MATAYAPMASQVMKSSLQLHS--KPRGLSGAALTT--TRRPR-FTVKAIQPEKATYQVVQ  55

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP    G
Sbjct  56   PINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALTG  115

Query  382  P  384
            P
Sbjct  116  P  116



>gb|ACG28232.1| photosystem I reaction center subunit XI [Zea mays]
Length=210

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 93/121 (77%), Gaps = 6/121 (5%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            MAT  + MASQ+  +SL+      P+G+SGA      +RRP  FTVKA+Q EK T+QV+Q
Sbjct  1    MATAYAPMASQVMKSSLVVHS--RPRGLSGA---AALTRRPR-FTVKAIQPEKATYQVVQ  54

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP    G
Sbjct  55   PINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFALTG  114

Query  382  P  384
            P
Sbjct  115  P  115



>ref|XP_004962578.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Setaria italica]
Length=208

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 92/121 (76%), Gaps = 8/121 (7%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            MAT  + MASQ+  + L+      P+G+SGA      +RRP  FTVKA+Q EK T+QV+Q
Sbjct  1    MATAYAPMASQVMKSGLV---HSRPRGLSGAAL----TRRPR-FTVKAIQPEKTTYQVVQ  52

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGG  381
            P+NGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP    G
Sbjct  53   PINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALTG  112

Query  382  P  384
            P
Sbjct  113  P  113



>ref|XP_009785828.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Nicotiana sylvestris]
Length=204

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 92/126 (73%), Gaps = 22/126 (17%)
 Frame = +1

Query  22   MATVAST-MASQLKA--ASLMTRGFGV--PKGISGAPFKVLPSRRPSCFTVKAVQSEKPT  186
            MAT AST MASQLK+  AS +TRG G+  PKGISGAPFK+ PS R SCFT+KAVQ++K  
Sbjct  1    MATAASTTMASQLKSSFASSLTRGNGLVTPKGISGAPFKIFPSTRKSCFTIKAVQTDK--  58

Query  187  FQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGP  366
                           LETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  GP
Sbjct  59   ---------------LETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGP  103

Query  367  IREGGP  384
              + GP
Sbjct  104  FVKAGP  109



>sp|P23993.1|PSAL_HORVU RecName: Full=Photosystem I reaction center subunit XI, chloroplastic; 
Short=PSI-L; AltName: Full=PSI subunit V; Flags: Precursor 
[Hordeum vulgare]
 gb|AAA62700.1| photosystem I hydrophobic protein [Hordeum vulgare]
 dbj|BAK05513.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90437.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=209

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 96/136 (71%), Gaps = 9/136 (7%)
 Frame = +1

Query  22   MATV-ASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVI  198
            MAT  A  MASQ+  + L       P+G+SGA      +RRP  F VKAV+S+KPT+QV+
Sbjct  1    MATAYAPPMASQVMKSGLACSK---PRGMSGASL----TRRPR-FVVKAVKSDKPTYQVV  52

Query  199  QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREG  378
            QP+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP    
Sbjct  53   QPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALT  112

Query  379  GPTEKHGLRRECXVLG  426
            GP     +  +   LG
Sbjct  113  GPLRNTPVHGQAGTLG  128



>gb|EMT01873.1| Photosystem I reaction center subunit XI, chloroplastic [Aegilops 
tauschii]
Length=209

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 96/136 (71%), Gaps = 9/136 (7%)
 Frame = +1

Query  22   MATV-ASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVI  198
            MAT  A  MASQ+  + L+      P+G+SGA      +RRP  F VKAV+S+K T+QV+
Sbjct  1    MATAYAPPMASQVMKSGLVCSK---PRGLSGASL----TRRPR-FVVKAVKSDKGTYQVV  52

Query  199  QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREG  378
            QP+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP    
Sbjct  53   QPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALT  112

Query  379  GPTEKHGLRRECXVLG  426
            GP     +  +   LG
Sbjct  113  GPLRNTPIHGQAGTLG  128



>ref|XP_006664004.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Oryza brachyantha]
Length=207

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 95/136 (70%), Gaps = 11/136 (8%)
 Frame = +1

Query  22   MATV-ASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVI  198
            MAT  A  MASQL  +SL       P+G+ GA      +RRP  FT+KA+Q +K T+QV+
Sbjct  1    MATAYAPPMASQLMKSSLSK-----PRGLPGASL----TRRPR-FTIKAIQPDKATYQVV  50

Query  199  QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREG  378
            QP+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP    
Sbjct  51   QPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLLGPFALT  110

Query  379  GPTEKHGLRRECXVLG  426
            GP     +  +   LG
Sbjct  111  GPLRNTPVHGQAGALG  126



>ref|XP_003576628.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Brachypodium distachyon]
Length=209

 Score =   139 bits (351),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 91/122 (75%), Gaps = 9/122 (7%)
 Frame = +1

Query  22   MAT-VASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVI  198
            MAT  A  MASQL  +SL       P+G+SGA      +RRP  F VKA++ +K T+QV+
Sbjct  1    MATAFAPPMASQLMKSSLACSK---PRGLSGASL----TRRPR-FVVKAIKPDKATYQVV  52

Query  199  QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREG  378
            QP+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP    
Sbjct  53   QPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALT  112

Query  379  GP  384
            GP
Sbjct  113  GP  114



>gb|ABK55685.1| PsaL [Cucumis sativus]
Length=163

 Score =   135 bits (340),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  FTVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIE  330
            FT++A+Q++KPTFQVIQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIE
Sbjct  2    FTIRAIQADKPTFQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIE  61

Query  331  VGLAHGSLPGGPIREGGP  384
            VGLAHG    GP  + GP
Sbjct  62   VGLAHGFFLVGPFVKAGP  79



>gb|EMS46316.1| Photosystem I reaction center subunit XI, chloroplastic [Triticum 
urartu]
Length=378

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 97/137 (71%), Gaps = 9/137 (7%)
 Frame = +1

Query  19   RMATV-ASTMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
             MAT  A  MASQ+  + L++     P+G+SGA      +RRP  F VKAV+S+K T+QV
Sbjct  169  EMATAYAPPMASQVMKSGLVSSK---PRGLSGASL----TRRPR-FVVKAVKSDKGTYQV  220

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            +QP+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP   
Sbjct  221  VQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFAL  280

Query  376  GGPTEKHGLRRECXVLG  426
             GP     +  +   LG
Sbjct  281  TGPLRNTPIHGQAGTLG  297



>gb|ABK20972.1| unknown [Picea sitchensis]
 gb|ABK22424.1| unknown [Picea sitchensis]
Length=240

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +1

Query  127  LPSRRPSCFTVKA-VQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTA  303
            L +  PS FTVKA +Q++KPTFQVI+PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTA
Sbjct  59   LAAGSPSNFTVKATLQTDKPTFQVIEPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTA  118

Query  304  VNPLLRGIEVGLAHGSLPGGPIREGGP  384
            V+PLLRGIEVGLAHG    GP  + GP
Sbjct  119  VSPLLRGIEVGLAHGFFLVGPFVKAGP  145



>gb|ACG28145.1| photosystem I reaction center subunit XI [Zea mays]
 gb|ACN32174.1| unknown [Zea mays]
 tpg|DAA53272.1| TPA: photosystem I reaction center subunit XI [Zea mays]
Length=212

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 92/124 (74%), Gaps = 10/124 (8%)
 Frame = +1

Query  22   MATVAST-MASQ-LKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKA-VQSEKPTFQ  192
            MAT A   MASQ +K++ + +R    P+G+SGA    L   RP    VKA +Q EK T+Q
Sbjct  1    MATTAYAPMASQVMKSSPVHSR----PRGLSGA---ALTRPRPRFSVVKAAIQPEKATYQ  53

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP  
Sbjct  54   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFA  113

Query  373  EGGP  384
              GP
Sbjct  114  LTGP  117



>ref|NP_001148071.1| photosystem I reaction center subunit XI [Zea mays]
 gb|ACG29645.1| photosystem I reaction center subunit XI [Zea mays]
Length=212

 Score =   134 bits (337),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 92/124 (74%), Gaps = 10/124 (8%)
 Frame = +1

Query  22   MATVAST-MASQ-LKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKA-VQSEKPTFQ  192
            MAT A   MASQ +K++ + +R    P+G+SGA    L   RP    VKA +Q EK T+Q
Sbjct  1    MATTAYAPMASQVMKSSPVHSR----PRGLSGA---ALTRPRPRFSVVKAAIQPEKATYQ  53

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L  GP  
Sbjct  54   VVQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFA  113

Query  373  EGGP  384
              GP
Sbjct  114  LTGP  117



>ref|XP_006840921.1| hypothetical protein AMTR_s00087p00141000 [Amborella trichopoda]
 gb|ERN02596.1| hypothetical protein AMTR_s00087p00141000 [Amborella trichopoda]
Length=223

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 82/107 (77%), Gaps = 8/107 (7%)
 Frame = +1

Query  82   GFGVPKGI-SGAPFKVLPSRR-----PSCFTVKAVQSEKPTFQVIQPLNGDPFIGSLETP  243
            G   PKGI SG P   L SRR      S FTVKA+Q+EK  +QVI+PLNGDPFIG LETP
Sbjct  24   GLSSPKGIISGLPLTPLSSRRRASYSYSGFTVKAIQTEK--YQVIEPLNGDPFIGGLETP  81

Query  244  VTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            +TSSPLIAWYLSNLPAYRT+V+PLLRGIEVGLAHG L  GP  + GP
Sbjct  82   ITSSPLIAWYLSNLPAYRTSVSPLLRGIEVGLAHGFLLVGPFVKTGP  128



>ref|WP_026060795.1| hypothetical protein, partial [Vibrio vulnificus]
Length=91

 Score =   122 bits (305),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  166  VQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAH  345
            +Q+EKPT+QVIQP+NGDPFIGSLETP+TSSPLIAW LSNLPAYRTAV+PLLRGIEVGLAH
Sbjct  1    MQAEKPTYQVIQPINGDPFIGSLETPITSSPLIAWDLSNLPAYRTAVSPLLRGIEVGLAH  60

Query  346  GSLPGGPIREGGP  384
            G L  GP  + GP
Sbjct  61   GYLLVGPFVKTGP  73



>pdb|4RKU|L Chain L, Crystal Structure Of Plant Photosystem I At 3 Angstrom 
Resolution
Length=163

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  172  SEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGS  351
            SEKPT+QV+QP+NGDPFIGSLETPVTSSPL+AWYLSNLP YRTAVNPLLRGIEVGLAHG 
Sbjct  1    SEKPTYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPGYRTAVNPLLRGIEVGLAHGF  60

Query  352  LPGGPIREGGP  384
               GP  + GP
Sbjct  61   FLVGPFVKAGP  71



>gb|KCW48728.1| hypothetical protein EUGRSUZ_K023621, partial [Eucalyptus grandis]
Length=163

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  181  PTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPG  360
            PTFQV+QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  
Sbjct  1    PTFQVVQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLV  60

Query  361  GPIREGGP  384
            GP  + GP
Sbjct  61   GPFVKAGP  68



>pdb|2O01|L Chain L, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=164

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  178  KPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLP  357
            KPT+QVIQPLNGDPFIG LETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L 
Sbjct  1    KPTYQVIQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLL  60

Query  358  GGPIREGGP  384
             GP  + GP
Sbjct  61   VGPFVKAGP  69



>pdb|3LW5|L Chain L, Improved Model Of Plant Photosystem I
Length=161

 Score =   122 bits (307),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  178  KPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLP  357
            KPT+QVIQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L 
Sbjct  1    KPTYQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLL  60

Query  358  GGPIREGGP  384
             GP  + GP
Sbjct  61   VGPFVKAGP  69



>gb|ADI88463.1| PSAL protein, partial [Silene vulgaris]
 gb|ADI88464.1| PSAL protein, partial [Silene vulgaris]
Length=139

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  181  PTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPG  360
            PTFQV+QPLNGDPFIG LETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  
Sbjct  1    PTFQVVQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGLLLV  60

Query  361  GPIREGGP  384
            GP  + GP
Sbjct  61   GPFVKAGP  68



>gb|ADI88316.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88317.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88318.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88319.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88320.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88321.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88322.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88323.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88324.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88325.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88326.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88327.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88328.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88329.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88330.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88331.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88332.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88333.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88334.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88335.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88336.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88337.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88338.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88339.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88340.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88341.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88344.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88345.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88347.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88350.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88351.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88352.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88353.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88354.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88355.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88356.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88357.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88358.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88359.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88360.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88361.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88363.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88465.1| PSAL protein, partial [Silene vulgaris]
 gb|ADI88466.1| PSAL protein, partial [Silene vulgaris]
Length=139

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  181  PTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPG  360
            PTFQV+QPLNGDPFIG LETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  
Sbjct  1    PTFQVVQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGLLLV  60

Query  361  GPIREGGP  384
            GP  + GP
Sbjct  61   GPFVKAGP  68



>ref|XP_004155128.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like 
[Cucumis sativus]
Length=177

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  178  KPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLP  357
            +PTFQVIQP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG   
Sbjct  14   QPTFQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFFL  73

Query  358  GGPIREGGP  384
             GP  + GP
Sbjct  74   VGPFVKAGP  82



>gb|ADI87881.1| PSAL protein, partial [Silene dioica]
 gb|ADI87885.1| PSAL protein, partial [Silene dioica]
 gb|ADI87889.1| PSAL protein, partial [Silene dioica]
 gb|ADI87893.1| PSAL protein, partial [Silene dioica]
 gb|ADI88346.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88362.1| PSAL protein, partial [Silene latifolia]
Length=139

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  181  PTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPG  360
            PTFQV+QPLNGDPFIG LETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  
Sbjct  1    PTFQVVQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGLLLV  60

Query  361  GPIREGGP  384
            GP  + GP
Sbjct  61   GPFVKTGP  68



>gb|ADI87877.1| PSAL protein, partial [Silene dioica]
 gb|ADI87878.1| PSAL protein, partial [Silene dioica]
 gb|ADI87879.1| PSAL protein, partial [Silene dioica]
 gb|ADI87880.1| PSAL protein, partial [Silene dioica]
 gb|ADI87882.1| PSAL protein, partial [Silene dioica]
 gb|ADI87883.1| PSAL protein, partial [Silene dioica]
 gb|ADI87884.1| PSAL protein, partial [Silene dioica]
 gb|ADI87886.1| PSAL protein, partial [Silene dioica]
 gb|ADI87887.1| PSAL protein, partial [Silene dioica]
 gb|ADI87888.1| PSAL protein, partial [Silene dioica]
 gb|ADI87890.1| PSAL protein, partial [Silene dioica]
 gb|ADI87891.1| PSAL protein, partial [Silene dioica]
 gb|ADI87892.1| PSAL protein, partial [Silene dioica]
 gb|ADI87894.1| PSAL protein, partial [Silene dioica]
 gb|ADI88342.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88343.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88348.1| PSAL protein, partial [Silene latifolia]
 gb|ADI88349.1| PSAL protein, partial [Silene latifolia]
Length=139

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  181  PTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPG  360
            PTFQV+QPLNGDPFIG LETPVTSSPLIAWYLSNLPAYRTAVNPLLRG+EVGLAHG L  
Sbjct  1    PTFQVVQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGLLLV  60

Query  361  GPIREGGP  384
            GP  + GP
Sbjct  61   GPFVKTGP  68



>gb|AIS72753.1| psal protein, partial [Rhizophora apiculata]
Length=101

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  181  PTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPG  360
            PT+QVIQP+NGDPFIG+LETP+TSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  
Sbjct  1    PTYQVIQPINGDPFIGTLETPITSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLV  60

Query  361  GPIREGGP  384
            GP  + GP
Sbjct  61   GPFVKAGP  68



>ref|XP_001760296.1| predicted protein [Physcomitrella patens]
 gb|EDQ75052.1| predicted protein [Physcomitrella patens]
Length=220

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +1

Query  145  SCFTVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRG  324
            S FT++A  + K  +QVI+PLNGDPFIG LETPVTSSPLIAWYLSNLPAYRTAV PLLRG
Sbjct  48   SAFTIRAGAAGK--YQVIEPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVAPLLRG  105

Query  325  IEVGLAHGSLPGGPIREGGPTEKHGLRRECXVL  423
            +E+GLAHG L  GP    GP     +R E   L
Sbjct  106  VEIGLAHGYLLVGPFVLAGPLRNSAVRGEAGSL  138



>gb|EAY82914.1| hypothetical protein OsI_38129 [Oryza sativa Indica Group]
Length=170

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  178  KPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLP  357
            +PT+QV+QP+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRGIEVGLAHG L 
Sbjct  7    QPTYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLL  66

Query  358  GGPIREGGP  384
             GP    GP
Sbjct  67   VGPFALTGP  75



>tpg|DAA53271.1| TPA: hypothetical protein ZEAMMB73_645930, partial [Zea mays]
Length=107

 Score =   116 bits (291),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +1

Query  178  KPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLP  357
            + T+QV+QP+NGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRG+EVGLAHG L 
Sbjct  6    QATYQVVQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLL  65

Query  358  GGPIREGGP  384
             GP    GP
Sbjct  66   VGPFALTGP  74



>ref|XP_001754840.1| predicted protein [Physcomitrella patens]
 gb|EDQ80294.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   118 bits (296),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +1

Query  157  VKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVG  336
            V AV++    +QVI+PLNGDPFIG  ETPVTSSPLIAWYLSNLPAYRTAV PLLRG+E+G
Sbjct  39   VMAVRAGAEKYQVIEPLNGDPFIGGFETPVTSSPLIAWYLSNLPAYRTAVAPLLRGVEIG  98

Query  337  LAHGSLPGGPIREGGPTEKHGLRRECXVL  423
            LAHG L  GP    GP     +R E   L
Sbjct  99   LAHGYLLVGPFVLAGPLRNSAVRGEAGSL  127



>ref|NP_001169222.1| uncharacterized protein LOC100383080 [Zea mays]
 gb|ACN32011.1| unknown [Zea mays]
 gb|AFW80146.1| hypothetical protein ZEAMMB73_091068 [Zea mays]
Length=165

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +1

Query  178  KPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLP  357
            + T+QV+QP+NGDPFIGSLETPVTSSPL+AWYLSNLPAYRTAV+PLLRG+EVGLAHG L 
Sbjct  2    QATYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLL  61

Query  358  GGPIREGGP  384
             GP    GP
Sbjct  62   VGPFALTGP  70



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =   123 bits (308),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 6/103 (6%)
 Frame = +1

Query  34   ASTMASQLKAA---SLMTR-GFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVIQ  201
            AS MASQLK++    + TR     PKG+S +PF + PS+R S F +KAVQS+K  FQV+Q
Sbjct  4    ASPMASQLKSSFTSPITTRPSLLSPKGLSTSPFWLFPSKRLSSFPIKAVQSDKQNFQVVQ  63

Query  202  PLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIE  330
            P+NG  FIGSLETPVTSSPLIAWYLSNL AYRTAV+PLLR IE
Sbjct  64   PING--FIGSLETPVTSSPLIAWYLSNLLAYRTAVSPLLRVIE  104



>ref|XP_001762315.1| predicted protein [Physcomitrella patens]
 gb|EDQ72782.1| predicted protein, partial [Physcomitrella patens]
Length=165

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  166  VQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAH  345
            V++    +QVI+PLNGDPFIG  ETPVTSSPLIAWYLSNLPAYRTAV PLLRG+E+GLAH
Sbjct  1    VRAGAEKYQVIEPLNGDPFIGGFETPVTSSPLIAWYLSNLPAYRTAVAPLLRGVEIGLAH  60

Query  346  GSLPGGPIREGGPTEKHGLRRECXVL  423
            G L  GP    GP     +R E   L
Sbjct  61   GYLLVGPFVLTGPLRNSAVRGEAGSL  86



>gb|ACN37088.1| unknown [Zea mays]
Length=204

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 83/124 (67%), Gaps = 18/124 (15%)
 Frame = +1

Query  22   MATVAST-MASQ-LKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKA-VQSEKPTFQ  192
            MAT A   MASQ +K++ + +R    P+G+SGA    L   RP    VKA +Q EK T+Q
Sbjct  1    MATTAYAPMASQVMKSSPVHSR----PRGLSGA---ALTRPRPRFSVVKAAIQPEKATYQ  53

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
            V+QP+NGDPFIGSLETPVTS         NLPAYRTAV+PLLRG+EVGLAHG L  GP  
Sbjct  54   VVQPINGDPFIGSLETPVTS--------FNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFA  105

Query  373  EGGP  384
              GP
Sbjct  106  LTGP  109



>ref|XP_003060103.1| photosystem I subunit XI, chloroplast precursor [Micromonas pusilla 
CCMP1545]
 gb|EEH56055.1| photosystem I subunit XI, chloroplast precursor [Micromonas pusilla 
CCMP1545]
Length=206

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 82/122 (67%), Gaps = 7/122 (6%)
 Frame = +1

Query  22   MATVAS-TMASQLKAASLMTRGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQVI  198
            MA +AS ++A+++ A  +  R   + KG+SG    + P+R      V    +EK   QVI
Sbjct  1    MAAIASMSVAARVAAPKVTARRSFLGKGVSG----LAPARAAKASVVVRAAAEKA--QVI  54

Query  199  QPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREG  378
            +P+NGDPFIG LETPVTS+P++A +LSNLPAYRT V+PL RG+EVGLAHG    GP  + 
Sbjct  55   KPINGDPFIGMLETPVTSAPIVANFLSNLPAYRTGVSPLTRGVEVGLAHGFFLTGPFIKL  114

Query  379  GP  384
            GP
Sbjct  115  GP  116



>ref|XP_002948330.1| hypothetical protein VOLCADRAFT_80111 [Volvox carteri f. nagariensis]
 gb|EFJ50737.1| hypothetical protein VOLCADRAFT_80111 [Volvox carteri f. nagariensis]
Length=198

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  139  RPSCFTVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLL  318
            R S   V A+       QVI P+NGDPF+G LETPVTS+P++A YLSNLPAYRT V PLL
Sbjct  26   RASTLRVVAMADAAKKAQVITPVNGDPFVGMLETPVTSAPIVATYLSNLPAYRTGVAPLL  85

Query  319  RGIEVGLAHGSLPGGPIREGGP  384
            RG+E+GLAHG L  GP  + GP
Sbjct  86   RGVEIGLAHGFLVAGPFIKLGP  107



>ref|XP_001691084.1| photosystem I reaction center subunit XI [Chlamydomonas reinhardtii]
 gb|EDP05530.1| photosystem I reaction center subunit XI [Chlamydomonas reinhardtii]
Length=196

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  154  TVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEV  333
            TV+   ++    QVI P+NGDPF+G LETPVTS+P++A YLSNLPAYRT V P+LRG+E+
Sbjct  29   TVRVCAADTKKAQVISPVNGDPFVGMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVEI  88

Query  334  GLAHGSLPGGPIREGGP  384
            GLAHG L  GP  + GP
Sbjct  89   GLAHGFLLAGPFIKLGP  105



>ref|XP_002504254.1| photosystem I subunit XI, chloroplast precursor [Micromonas sp. 
RCC299]
 gb|ACO65512.1| photosystem I subunit XI, chloroplast precursor [Micromonas sp. 
RCC299]
Length=206

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 81/123 (66%), Gaps = 9/123 (7%)
 Frame = +1

Query  22   MATVASTMASQLKAASLMT--RGFGVPKGISGAPFKVLPSRRPSCFTVKAVQSEKPTFQV  195
            MA +AS  A    AA  +T  R F + KG++G     L   RP+  +V  V++     QV
Sbjct  1    MAAIASINAVARVAAPKVTARRSF-LGKGVAG-----LAPVRPAVRSV-VVRAAAEKAQV  53

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            I+PLNGDPFIG LETPVTS+P++A +LSNLPAYRT V+PL RG+EVGLAHG    GP  +
Sbjct  54   IKPLNGDPFIGMLETPVTSAPIVANFLSNLPAYRTGVSPLTRGVEVGLAHGFFLTGPFIK  113

Query  376  GGP  384
             GP
Sbjct  114  LGP  116



>ref|XP_005844020.1| hypothetical protein CHLNCDRAFT_32796 [Chlorella variabilis]
 gb|EFN51918.1| hypothetical protein CHLNCDRAFT_32796 [Chlorella variabilis]
Length=194

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  154  TVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEV  333
             V  V++     QVIQP+NGDPFIG LETPVTSSPL+A +LSNLPAYRT V PLLRG+EV
Sbjct  26   VVAPVRAMADKAQVIQPVNGDPFIGMLETPVTSSPLVAGFLSNLPAYRTGVPPLLRGVEV  85

Query  334  GLAHGSLPGGPIREGGP  384
            GLAHG L  GP  + GP
Sbjct  86   GLAHGFLLVGPFIKLGP  102



>ref|XP_005650700.1| PsaL-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26156.1| PsaL-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=210

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QVIQP+NGDPFIG LETPVTSSPL+A +LSNLPAYR  V+PLLRG+E+GL HG L  GP 
Sbjct  54   QVIQPINGDPFIGMLETPVTSSPLVAGFLSNLPAYRIGVSPLLRGVEIGLVHGFLVTGPF  113

Query  370  REGGP  384
             + GP
Sbjct  114  IKLGP  118



>gb|KIY98480.1| Photosystem I reaction center subunit XI [Monoraphidium neglectum]
Length=189

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +1

Query  127  LPSRRPSCFTVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAV  306
            LPSRR     V   ++E    QVIQPLNGDPF+  LETPVTSSPL+  YLS+LPAYRT V
Sbjct  19   LPSRR-----VLVCRAENKA-QVIQPLNGDPFVSMLETPVTSSPLVVSYLSSLPAYRTGV  72

Query  307  NPLLRGIEVGLAHGSLPGGPIREGGP  384
            +PLLRG+E+GLAHG    GP  + GP
Sbjct  73   SPLLRGVEIGLAHGFFLPGPFIKLGP  98



>ref|XP_001416150.1| photosystem I subunit XI precursor [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94443.1| photosystem I subunit XI precursor [Ostreococcus lucimarinus 
CCE9901]
Length=209

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 63/101 (62%), Gaps = 3/101 (3%)
 Frame = +1

Query  91   VPKGISGAPFKVLPSRRPSCFTV---KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPL  261
            V K I    + VL S      T      V +     Q+I+P+NGDPFIG LETPVTSSP 
Sbjct  19   VAKKIIFVEYHVLQSNVWPVITTARRSVVLASSDKVQIIKPINGDPFIGMLETPVTSSPD  78

Query  262  IAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            +A +LSNLPAYRT V PLLRG+EVGLAHG    GP  + GP
Sbjct  79   VANFLSNLPAYRTGVAPLLRGVEVGLAHGFFLTGPFIKLGP  119



>ref|XP_003074802.1| PsaL photosystem I subunit XI precursor (IC) [Ostreococcus tauri]
Length=202

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  166  VQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAH  345
            V +     Q+++P+NGDPFIG LETPVTSSP +A +LSNLPAYRT V PLLRG+EVGLAH
Sbjct  40   VSASSDKVQIVKPINGDPFIGMLETPVTSSPDVANFLSNLPAYRTGVAPLLRGVEVGLAH  99

Query  346  GSLPGGPIREGGP  384
            G    GP  + GP
Sbjct  100  GFFVTGPFIKLGP  112



>emb|CEG00928.1| Photosystem I PsaL, reaction centre subunit XI [Ostreococcus 
tauri]
Length=204

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  166  VQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAH  345
            V +     Q+++P+NGDPFIG LETPVTSSP +A +LSNLPAYRT V PLLRG+EVGLAH
Sbjct  42   VSASSDKVQIVKPINGDPFIGMLETPVTSSPDVANFLSNLPAYRTGVAPLLRGVEVGLAH  101

Query  346  GSLPGGPIREGGP  384
            G    GP  + GP
Sbjct  102  GFFVTGPFIKLGP  114



>gb|KIY94971.1| Photosystem I reaction center subunit XI [Monoraphidium neglectum]
Length=142

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QVIQPLNGDPF+  LETPVTSSPL+  YLS+LPAYRT V+PLLRG+E+GLAHG    GP 
Sbjct  32   QVIQPLNGDPFVSMLETPVTSSPLVVSYLSSLPAYRTGVSPLLRGVEIGLAHGFFLPGPF  91



>ref|WP_039311754.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91124.1| hypothetical protein QW71_36455, partial [Paenibacillus sp. IHB 
B 3415]
Length=148

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  226  GSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            GSLETPVTSSPLIAWYLSNLPAYRTAV+PLLRGIEVGLAHG L  GP  + GP
Sbjct  1    GSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFVKTGP  53



>ref|XP_011398968.1| Photosystem I reaction center subunit XI, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26072.1| Photosystem I reaction center subunit XI, chloroplastic [Auxenochlorella 
protothecoides]
Length=201

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            IQP+NGDP+IG LETPVTSSPL+A +LSNLPAYR  V+PL RG+E+GL HG    GP  +
Sbjct  47   IQPINGDPYIGMLETPVTSSPLVAGFLSNLPAYRIGVSPLQRGVEIGLTHGFFLVGPFIK  106

Query  376  GGP  384
             GP
Sbjct  107  LGP  109



>ref|WP_015193668.1| Photosystem I reaction center subunit XI [Stanieria cyanosphaera]
 gb|AFZ36000.1| Photosystem I reaction center subunit XI [Stanieria cyanosphaera 
PCC 7437]
Length=159

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  178  KPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLP  357
            KP  QV++P N DPFIG L TP++ S  +  Y+ NLP YR  ++PLLRG+EVGLAHG   
Sbjct  3    KPFTQVVKPYNDDPFIGHLSTPISDSDFVRTYIRNLPGYRRGLSPLLRGLEVGLAHGYFL  62

Query  358  GGPIREGGP  384
             GP    GP
Sbjct  63   AGPWTVFGP  71



>ref|WP_035156342.1| Photosystem I reaction center subunit XI [Calothrix sp. 336/3]
 gb|KFB85260.1| Photosystem I reaction center subunit XI [Calothrix sp. 336/3]
Length=164

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  169  QSEKP-TFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAH  345
            QS  P   +V+ PL GDP +G+LETP+ SSP+I W++ NLPAYR  + P  RG+EVG+AH
Sbjct  3    QSTDPRNAEVVFPLGGDPQLGNLETPINSSPVIKWFIGNLPAYRPGLTPFRRGLEVGMAH  62

Query  346  GSLPGGPIREGGPTEK  393
            G L  GP    GP   
Sbjct  63   GYLLFGPFSLLGPLRN  78



>gb|KEI67674.1| PsaL [Planktothrix agardhii NIVA-CYA 126/8]
Length=175

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  178  KPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLP  357
             P  ++I+P NGDPF+G L TP++ S     ++ NLPAYR  ++PLLRG+EVG+AHG   
Sbjct  17   NPMAELIKPYNGDPFVGHLSTPISDSDFTRAFIGNLPAYRKGLSPLLRGLEVGMAHGYFL  76

Query  358  GGPIREGGPTEKH  396
             GP  + GP   H
Sbjct  77   IGPWIKLGPLRDH  89



>gb|AFZ03678.1| Photosystem I reaction center subunit XI [Calothrix sp. PCC 6303]
Length=157

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  184  TFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGG  363
            T +VI+P   DPFIG+LETP+ SS  + W+++NLPAYR  + P  RG+EVG+AHG L  G
Sbjct  2    TQEVIKPAGRDPFIGNLETPINSSSTVQWFINNLPAYRPGLTPFRRGLEVGMAHGYLLFG  61

Query  364  PIREGGPTEKH  396
            P  + GP    
Sbjct  62   PFAKLGPLRNE  72



>gb|AJH65986.1| photosystem I reaction center subunit XI [Vertebrata lanosa]
Length=152

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              IQP N DPF+G+L TP+++S     +LSNLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    NFIQPYNNDPFVGNLSTPISTSSFTKSFLSNLPAYRRGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|WP_041740877.1| Photosystem I reaction center subunit XI, partial [Calothrix 
parietina]
Length=155

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            +VI+P   DPFIG+LETP+ SS  + W+++NLPAYR  + P  RG+EVG+AHG L  GP 
Sbjct  2    EVIKPAGRDPFIGNLETPINSSSTVQWFINNLPAYRPGLTPFRRGLEVGMAHGYLLFGPF  61

Query  370  REGGPTEKH  396
             + GP    
Sbjct  62   AKLGPLRNE  70



>ref|YP_007878290.1| photosystem I subunit XI (chloroplast) [Calliarthron tuberculosum]
 gb|AGA63901.1| photosystem I subunit XI (chloroplast) [Calliarthron tuberculosum]
Length=143

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              IQP N DPF+G+L TP+++S     ++SNLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    DFIQPYNNDPFVGNLSTPISTSSFTKGFISNLPAYRRGLSPLLRGLEIGMAHGYFLVGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|WP_026787895.1| MULTISPECIES: Photosystem I reaction center subunit XI [Planktothrix]
Length=157

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++I+P NGDPF+G L TP++ S     ++ NLPAYR  ++PLLRG+EVG+AHG    GP 
Sbjct  3    ELIKPYNGDPFVGHLSTPISDSDFTRAFIGNLPAYRKGLSPLLRGLEVGMAHGYFLIGPW  62

Query  370  REGGPTEKH  396
             + GP   H
Sbjct  63   IKLGPLRDH  71



>ref|WP_008233423.1| photosystem I subunit XI (PsaL) [Richelia intracellularis]
 emb|CCH67189.1| photosystem I subunit XI (PsaL) [Richelia intracellularis HH01]
Length=174

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    + I    GDP IG+LETP+ SSPL+ W++SNLPAYR ++ P  RG+EVG+
Sbjct  9    KDLSSDPRNREAIMAAGGDPQIGNLETPINSSPLVKWFISNLPAYRPSLTPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG    GP    GP
Sbjct  69   AHGYFIYGPFLVLGP  83



>ref|YP_001293537.1| photosystem I subunit XI [Rhodomonas salina]
 gb|ABO70745.1| photosystem I subunit XI [Rhodomonas salina]
Length=153

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            Q I+P N DPF+G+L TPV++S      LSNLPAYR  ++PLLRG+E+GL HG    GP 
Sbjct  3    QFIKPYNDDPFVGNLATPVSTSSFTKSLLSNLPAYRAGLSPLLRGVEIGLTHGYFLVGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   YKLGP  67



>ref|WP_024124204.1| photosystem I reaction center subunit XI PsaL [Thermosynechococcus 
sp. NK55a]
 gb|AHB87791.1| photosystem I reaction center subunit XI PsaL [Thermosynechococcus 
sp. NK55a]
Length=155

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++I+P NGDPF+G L TPV+ S L+  ++ NLPAYR  ++P+LRG+EVG+AHG    GP 
Sbjct  4    ELIKPYNGDPFVGHLSTPVSDSGLVKTFIGNLPAYRQGLSPILRGLEVGMAHGYFLIGPW  63

Query  370  REGGP  384
             + GP
Sbjct  64   VKLGP  68



>ref|WP_006194866.1| photosystem I reaction center protein subunit XI [Nodularia spumigena]
 gb|EAW46654.1| photosystem I reaction center protein subunit XI [Nodularia spumigena 
CCY9414]
 gb|AHJ30306.1| photosystem I subunit XI (PsaL) [Nodularia spumigena CCY9414]
Length=173

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            +V+ P   DP  G+LETP+ SSPL+ W+++NLPAYR  +NP  RG+EVG+AHG L  GP 
Sbjct  19   EVVAPAGRDPQQGNLETPINSSPLVKWFINNLPAYRQGLNPSRRGLEVGMAHGYLLFGPF  78

Query  370  REGGP  384
             + GP
Sbjct  79   AKLGP  83



>ref|YP_007627448.1| photosystem I subunit XI [Chondrus crispus]
 emb|CCP38195.1| photosystem I subunit XI [Chondrus crispus]
Length=152

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              IQP N DPF+G+L TP+++S +    LSNLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    DFIQPYNNDPFVGNLSTPISTSSITKGLLSNLPAYRRGLSPLLRGLEIGMAHGYFLVGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|XP_011024730.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic 
[Populus euphratica]
Length=142

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  244  VTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            +TSSPLIAW+LSNLPAYRTAV+PLLRGIEVGLAHG L  GP  + GP
Sbjct  1    MTSSPLIAWHLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFVKAGP  47



>ref|WP_009555355.1| Photosystem I reaction centre subunit XI [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ70781.1| Photosystem I reaction centre subunit XI [Oscillatoriales cyanobacterium 
JSC-12]
Length=155

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
             +I+P NGDPF+G L TP++ S     ++SNLPAYR  ++PLLRG+E+GLAHG    GP 
Sbjct  3    DLIKPYNGDPFVGHLSTPISDSAFTRAFISNLPAYRKGLSPLLRGLEIGLAHGYFLIGPW  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>gb|AIR75599.1| photosystem I protein subunit XI (chloroplast) [Cyclotella sp. 
WC03_2]
Length=148

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS L    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSSLTRALLKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   AQLGP  67



>gb|AIR75458.1| photosystem I protein subunit XI (chloroplast) [Cyclotella sp. 
L04_2]
Length=148

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS L    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSSLTRALLKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   AQLGP  67



>ref|YP_009093201.1| photosystem I protein subunit XI (chloroplast) [Roundia cardiophora]
 gb|AIR75874.1| photosystem I protein subunit XI (chloroplast) [Roundia cardiophora]
Length=148

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS L    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSSLTRALLKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   AQLGP  67



>ref|YP_874557.1| photosystem I protein L [Thalassiosira pseudonana]
 ref|XP_002297527.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 sp|A0T0U5.1|PSAL_THAPS RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Thalassiosira 
pseudonana]
 gb|ABK20780.1| photosystem I protein L [Thalassiosira pseudonana]
 gb|EED86167.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=148

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS L    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSSLTRALLKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   AQLGP  67



>ref|WP_015185145.1| Photosystem I reaction centre subunit XI [Microcoleus sp. PCC 
7113]
 gb|AFZ21012.1| Photosystem I reaction centre subunit XI [Microcoleus sp. PCC 
7113]
Length=171

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++I+P NGDPF G L TP++ S ++  +L+NLPAYR  ++PLLRG+E+GLAHG    GP 
Sbjct  8    ELIKPFNGDPFTGHLSTPISDSGIVRAFLNNLPAYRKGISPLLRGLEIGLAHGYFIIGPW  67

Query  370  REGGPTEKH  396
               GP   +
Sbjct  68   VIFGPLRDY  76



>ref|YP_009059176.1| photosystem I reaction center subunit XI (chloroplast) [Eunotia 
naegelii]
 gb|AHI51123.1| photosystem I reaction center subunit XI (chloroplast) [Eunotia 
naegelii]
Length=152

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TPVTSS L    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPVTSSALTRAILQNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|WP_015212807.1| Photosystem I reaction center subunit XI [Anabaena cylindrica]
 gb|AFZ56153.1| Photosystem I reaction center subunit XI [Anabaena cylindrica 
PCC 7122]
Length=173

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    + ++P   DP  G+LETP+ SSPL+ W+++NLPAYR  +NP  RG+EVG+
Sbjct  9    KNLPSDPRNRETVRPAGRDPQDGNLETPINSSPLVKWFINNLPAYRPGLNPSRRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG L  GP  + GP
Sbjct  69   AHGYLLFGPFAKLGP  83



>ref|WP_036534591.1| Photosystem I reaction center subunit XI [Neosynechococcus sphagnicola]
 gb|KGF72192.1| Photosystem I reaction center subunit XI [Neosynechococcus sphagnicola 
sy1]
Length=164

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++I+P  GDPF+G L TP+++S     ++SNLPAYRT ++P+LRG+EVGLAHG    GP 
Sbjct  4    ELIKPYKGDPFVGHLATPISASAFTETFISNLPAYRTGLSPILRGLEVGLAHGYFLIGPW  63

Query  370  REGGP  384
             + GP
Sbjct  64   VKLGP  68



>ref|YP_004072550.1| photosystem I reaction center subunit XI [Thalassiosira oceanica 
CCMP1005]
 gb|ADB27504.1| photosystem I reaction center subunit XI [Thalassiosira oceanica 
CCMP1005]
 gb|EJK52348.1| hypothetical protein THAOC_28395 [Thalassiosira oceanica]
 gb|EJK55850.1| hypothetical protein THAOC_24361 [Thalassiosira oceanica]
Length=148

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS L    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSSLTRALLKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   AKLGP  67



>ref|WP_011058236.1| photosystem I reaction center protein subunit XI [Thermosynechococcus 
elongatus]
 ref|NP_683194.1| photosystem I reaction center protein subunit XI [Thermosynechococcus 
elongatus BP-1]
 sp|Q8DGB4.1|PSAL_THEEB RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC09956.1| photosystem I subunit XI [Thermosynechococcus elongatus BP-1]
Length=155

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++++P NGDPF+G L TP++ S L+  ++ NLPAYR  ++P+LRG+EVG+AHG    GP 
Sbjct  4    ELVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMAHGYFLIGPW  63

Query  370  REGGP  384
             + GP
Sbjct  64   VKLGP  68



>ref|WP_013193113.1| photosystem I reaction centre subunit XI PsaL [Trichormus azollae]
 gb|ADI66104.1| photosystem I reaction centre subunit XI PsaL ['Nostoc azollae' 
0708]
Length=173

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    + ++P   DP  G+LETPV SSPL+ W++ NLPAYR  + PL RG+EVG+
Sbjct  9    KNLPSDPRNRETVRPAGRDPQDGNLETPVNSSPLVKWFIGNLPAYRPGLTPLRRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG L  GP  + GP
Sbjct  69   AHGYLLFGPFSKLGP  83



>ref|NP_045050.1| photosystem I subunit XI [Cyanidium caldarium]
 sp|Q9TM17.1|PSAL_CYACA RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Cyanidium 
caldarium]
 gb|AAF12996.1|AF022186_168 unknown [Cyanidium caldarium]
Length=152

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P   +PF+G+L TPV SS +  WYL NLP YR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    NYIKPYGSNPFVGNLSTPVNSSKVTIWYLKNLPIYRRGLSPLLRGLEIGMAHGYFIIGPF  62

Query  370  REGGPTEKHGL  402
             + GP     L
Sbjct  63   YKLGPLRNTDL  73



>pdb|1JB0|L Chain L, Crystal Structure Of Photosystem I: A Photosynthetic 
Reaction Center And Core Antenna System From Cyanobacteria
 pdb|3PCQ|L Chain L, Femtosecond X-Ray Protein Nanocrystallography
 pdb|4FE1|L Chain L, Improving The Accuracy Of Macromolecular Structure Refinement 
At 7 A Resolution
Length=154

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++++P NGDPF+G L TP++ S L+  ++ NLPAYR  ++P+LRG+EVG+AHG    GP 
Sbjct  3    ELVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMAHGYFLIGPW  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|NP_050726.1| photosystem I subunit XI (chloroplast) [Guillardia theta]
 sp|O78469.1|PSAL_GUITH RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Guillardia 
theta]
 gb|AAC35660.1| PSI reaction centre subunit XI (chloroplast) [Guillardia theta]
Length=152

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            Q ++P N DPF+G+L TP+T+S      LSNLPAYR  ++PLLRG+E+G+ HG    GP 
Sbjct  3    QFVKPYNDDPFVGNLATPITTSSFTRTLLSNLPAYRAGLSPLLRGLEIGMTHGYFLVGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   YKLGP  67



>ref|WP_037217173.1| Photosystem I reaction center subunit XI [Richelia intracellularis]
 emb|CDN11019.1| photosystem I subunit XI (PsaL) [Richelia intracellularis]
Length=173

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    + +    GDP IG+LETPV +SPLI W++SNLPAYR  + P  RG+EVG+
Sbjct  9    KNLASDPRNREAVLAAGGDPQIGNLETPVNASPLIKWFISNLPAYRPGLTPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGPTEKH  396
            AHG    GP    GP    
Sbjct  69   AHGYFIYGPFLLLGPLRND  87



>ref|YP_009093474.1| photosystem I protein subunit XI (chloroplast) [Thalassiosira 
weissflogii]
 gb|AIR76147.1| photosystem I protein subunit XI (chloroplast) [Thalassiosira 
weissflogii]
Length=148

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS L    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSSLTRTLLKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
               GP
Sbjct  63   ANLGP  67



>ref|WP_015112406.1| Photosystem I reaction center subunit XI [Nostoc sp. PCC 7107]
 gb|AFY42182.1| Photosystem I reaction center subunit XI [Nostoc sp. PCC 7107]
Length=172

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP +G+LETPV SSP++ W+++NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDVRNREVVFPAERDPQLGNLETPVNSSPVVKWFINNLPAYRLGLTPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG    GP  + GP
Sbjct  69   AHGYWIFGPFAKYGP  83



>ref|WP_009341978.1| Photosystem I reaction centre, subunit XI PsaL [Raphidiopsis 
brookii]
 gb|EFA73879.1| Photosystem I reaction centre, subunit XI PsaL [Raphidiopsis 
brookii D9]
Length=173

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    Q ++   G+P  G+LETPV SSPL+ W++ NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDPRNQQTVRAAGGNPQDGNLETPVNSSPLVKWFIGNLPAYRPGLTPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGPTEKHGLRRECXVLG  426
            AHG L  GP  + GP           +LG
Sbjct  69   AHGYLLFGPFDKLGPLRDSANANLAGLLG  97



>ref|WP_018399449.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=169

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++I+P  G+PF+G L TP+T+S     +++NLPAYRT V+PL+RG+EVG+AHG    GP 
Sbjct  7    EMIKPYEGNPFVGHLATPITASGFTKTFINNLPAYRTGVSPLIRGLEVGMAHGYFLVGPW  66

Query  370  REGGPTEKHG  399
               GP    G
Sbjct  67   TVLGPLRDFG  76



>ref|YP_009029425.1| photosystem I reaction center subunit XI (chloroplast) [Lithodesmium 
undulatum]
 gb|AGH28956.1| photosystem I reaction center subunit XI (chloroplast) (chloroplast) 
[Lithodesmium undulatum]
Length=152

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRAILKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   AQLGP  67



>ref|WP_028089973.1| Photosystem I reaction center subunit XI [Dolichospermum circinale]
Length=154

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  214  DPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGPTEK  393
            DP  G LETP+ S+PL+ W++SNLPAYR  +NP  RG+EVG+AHG L  GP  + GP   
Sbjct  8    DPQKGDLETPINSAPLVKWFISNLPAYRAGLNPFRRGLEVGMAHGYLLFGPFDKLGPLRN  67



>ref|YP_008144917.1| photosystem I reaction center subunit XI [Grateloupia taiwanensis]
 gb|AGO19842.1| photosystem I reaction center subunit XI [Grateloupia taiwanensis]
Length=154

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + I+P N DPF+G+L TP+++S +    LSNLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFIRPYNNDPFVGNLSTPISTSSITKGLLSNLPAYRRGLSPLLRGLEIGMAHGYFLVGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|WP_015127201.1| Photosystem I reaction center subunit XI [Calothrix sp. PCC 7507]
 gb|AFY31378.1| Photosystem I reaction center subunit XI [Calothrix sp. PCC 7507]
Length=173

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP IG+LETPV SSP++ W+++NLPAYR  + P  RG+E+G 
Sbjct  9    KNLASDPRNREVVFPAGRDPQIGNLETPVNSSPVVKWWINNLPAYRPGLTPFRRGLEIGQ  68

Query  340  AHGSLPGGPIREGGPTEKHGLRRECXVLG  426
            AHG L  GP  + GP           +LG
Sbjct  69   AHGYLLFGPFAKLGPLRDTASADLAGLLG  97



>ref|WP_028083754.1| Photosystem I reaction center subunit XI [Dolichospermum circinale]
Length=154

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  214  DPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGPTEK  393
            DP  G LETP+ S+PL+ W++SNLPAYR  +NP  RG+EVG+AHG L  GP  + GP   
Sbjct  8    DPQKGDLETPINSAPLVKWFISNLPAYRAGLNPFRRGLEVGMAHGYLLFGPFDKLGPLRN  67



>ref|YP_009093314.1| photosystem I protein subunit XI (chloroplast) [Cerataulina daemon]
 gb|AIR75987.1| photosystem I protein subunit XI (chloroplast) [Cerataulina daemon]
Length=150

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRALLGNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   AKLGP  67



>ref|NP_043675.1| photosystem I subunit XI [Odontella sinensis]
 sp|P49486.1|PSAL_ODOSI RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Odontella 
sinensis]
 emb|CAA91707.1| PSI, subunit XI [Odontella sinensis]
Length=150

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSSITRAILKNLPAYRFGLTPLLRGLEIGLAHGYFLMGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|YP_009029163.1| photosystem I reaction center subunit XI (chloroplast) [Didymosphenia 
geminata]
 gb|AGH28694.1| photosystem I reaction center subunit XI (chloroplast) (chloroplast) 
[Didymosphenia geminata]
Length=151

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRALLQNLPAYRFGLTPLLRGLEIGLAHGYFLMGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|WP_006276003.1| Photosystem I reaction centre, subunit XI PsaL [Cylindrospermopsis 
raciborskii]
 gb|EFA71042.1| Photosystem I reaction centre, subunit XI PsaL [Cylindrospermopsis 
raciborskii CS-505]
Length=173

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    Q ++   G+P  G+LETP+ SSPL+ W++ NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDPRNQQTVRAAGGNPQDGNLETPINSSPLVKWFIGNLPAYRPGLTPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGPTEKHGLRRECXVLG  426
            AHG L  GP  + GP           +LG
Sbjct  69   AHGYLLFGPFDKLGPLRDSANANLAGLLG  97



>ref|WP_002747669.1| photosystem I reaction center subunit XI [Microcystis aeruginosa]
 emb|CAO89237.1| psaL [Microcystis aeruginosa PCC 7806]
 gb|ELS45773.1| photosystem I reaction center subunit XI [Microcystis aeruginosa 
DIANCHI905]
Length=160

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+ P N DPFIG L TP+++S     ++ NLPAYR  ++P+LRG+EVG+AHG   GGP 
Sbjct  8    QVVTPYNDDPFIGHLATPISASGFTKAFIGNLPAYRPGLDPILRGLEVGMAHGYFLGGPW  67

Query  370  REGGP  384
               GP
Sbjct  68   VVLGP  72



>ref|NP_849135.1| photosystem I subunit XI [Cyanidioschyzon merolae strain 10D]
 sp|Q85FP8.1|PSAL_CYAME RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Cyanidioschyzon 
merolae]
 dbj|BAC76297.1| photosystem I reaction center subunit XI (chloroplast) [Cyanidioschyzon 
merolae strain 10D]
Length=140

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+ SS L   YLS LP YR  V+P LRG+E+G+AHG    GP 
Sbjct  3    DYIKPYNNDPFVGHLATPINSSSLTRAYLSQLPIYRRGVSPFLRGLEIGMAHGYFLIGPF  62

Query  370  REGGPTEKHGLRRECXVL  423
             + GP     ++    +L
Sbjct  63   VQLGPLRNTDIKYLAGLL  80



>ref|YP_874366.1| photosystem I protein L [Phaeodactylum tricornutum]
 sp|A0T0M6.1|PSAL_PHATC RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Phaeodactylum 
tricornutum CCAP 1055/1]
 gb|ABK20589.1| photosystem I protein L [Phaeodactylum tricornutum]
Length=151

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRAILQNLPAYRFGLTPLLRGLEIGLAHGYFLMGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|YP_009028732.1| photosystem I reaction center subunit XI (chloroplast) [Asterionellopsis 
glacialis]
 gb|AGH28281.1| photosystem I reaction center subunit XI (chloroplast) (chloroplast) 
[Asterionellopsis glacialis]
Length=152

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRAILKNLPAYRFGLTPLLRGLEIGLAHGYFLMGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|YP_009028637.1| photosystem I reaction center subunit XI (chloroplast) [Asterionella 
formosa]
 gb|AGH28188.1| photosystem I reaction center subunit XI (chloroplast) (chloroplast) 
[Asterionella formosa]
Length=152

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAITRGILQNLPAYRFGLTPLLRGLEIGLAHGYFLMGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|YP_002327559.1| PSI reaction center subunit XI [Vaucheria litorea]
 gb|ACF70976.1| PSI reaction center subunit XI [Vaucheria litorea]
Length=149

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+T+S +   +L NLP YR  ++PL RG+EVG+AHG L  GP 
Sbjct  3    NFIKPYNNDPFVGHLSTPITTSLITKTFLGNLPIYRENLSPLFRGLEVGMAHGYLLVGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   EKLGP  67



>gb|AAW79347.1| chloroplast photosystem I subunit XI (chloroplast) [Isochrysis 
galbana]
Length=147

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + ++P N DPF+G+L TPVT+S     YL NLP YR  + PLLRG+E+G+AHG    GP 
Sbjct  5    EFVKPFNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLTPLLRGLEIGMAHGYFLIGPF  64

Query  370  REGGP  384
               GP
Sbjct  65   YILGP  69



>sp|Q5ENP6.2|PSAL_ISOGA RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Isochrysis 
galbana]
Length=145

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + ++P N DPF+G+L TPVT+S     YL NLP YR  + PLLRG+E+G+AHG    GP 
Sbjct  3    EFVKPFNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLTPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
               GP
Sbjct  63   YILGP  67



>ref|YP_009093008.1| photosystem I protein subunit XI (chloroplast) [Rhizosolenia 
imbricata]
 gb|AIR75681.1| photosystem I protein subunit XI (chloroplast) [Rhizosolenia 
imbricata]
Length=149

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAITRAILKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|WP_015143921.1| Photosystem I reaction centre subunit XI [Pleurocapsa minor]
 gb|AFY77618.1| Photosystem I reaction centre subunit XI [Pleurocapsa sp. PCC 
7327]
Length=161

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+QP NGDPF G L TP+++S     ++ NLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  6    QVVQPYNGDPFTGHLATPISASDFTKAFIGNLPAYRPGLSPLLRGLEIGMAHGYFIIGPW  65

Query  370  REGGP  384
               GP
Sbjct  66   VLLGP  70



>gb|ADJ57433.1| photosystem I subunit XI [uncultured prymnesiophyte C19847]
Length=145

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + ++P N DPF+G+L TPVT+S     YL NLP YR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFVKPYNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
               GP
Sbjct  63   YILGP  67



>ref|YP_009029047.1| photosystem I reaction center subunit XI (chloroplast) [Cylindrotheca 
closterium]
 gb|AGH28586.1| photosystem I reaction center subunit XI (chloroplast) (chloroplast) 
[Cylindrotheca closterium]
Length=150

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRAILQNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|WP_015137729.1| Photosystem I reaction centre subunit XI [Nostoc sp. PCC 7524]
 gb|AFY47275.1| Photosystem I reaction centre subunit XI [Nostoc sp. PCC 7524]
Length=172

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            +V+ P   DP IG+LETPV + PL+ W+++NLPAYR  + P  RG+EVG+AHG L  GP 
Sbjct  19   EVVFPAGRDPQIGNLETPVNAYPLVKWFINNLPAYRPGLTPFRRGLEVGMAHGYLLFGPF  78

Query  370  REGGP  384
             + GP
Sbjct  79   AKLGP  83



>gb|AJO68493.1| photosystem I subunit XI (chloroplast) [Gracilariopsis lemaneiformis]
Length=150

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              IQ  N DPF+G+L TPV++S      LSNLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    DFIQSYNNDPFVGNLSTPVSTSTFTKGLLSNLPAYRRGLSPLLRGLEIGMAHGYFLVGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|WP_006633219.1| photosystem I reaction centre subunit XI PsaL [Microcoleus vaginatus]
 gb|EGK87663.1| photosystem I reaction centre subunit XI PsaL [Microcoleus vaginatus 
FGP-2]
Length=169

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++I+P NGDPF G L TP+++S     YL NLP YR  ++PL+RG+E+GLAHG    GP 
Sbjct  8    ELIKPFNGDPFTGHLATPISASDFTKAYLGNLPIYRKGLSPLVRGLEIGLAHGYFLIGPQ  67

Query  370  REGGPTEKHG  399
               GP   +G
Sbjct  68   IVFGPLRDYG  77



>ref|YP_005089645.1| psaL gene product (chloroplast) [Ulnaria acus]
 gb|AEX37770.1| photosystem I subunit XI (chloroplast) [Ulnaria acus]
Length=149

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRAILQNLPAYRFGLTPLLRGLEIGLAHGYFLMGPF  62

Query  370  REGGP  384
               GP
Sbjct  63   VNLGP  67



>ref|YP_009029354.1| photosystem I reaction center subunit XI (chloroplast) [Leptocylindrus 
danicus]
 gb|AGH28885.1| photosystem I reaction center subunit XI (chloroplast) (chloroplast) 
[Leptocylindrus danicus]
Length=145

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRSILKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|WP_006623822.1| MULTISPECIES: photosystem I reaction centre subunit XI PsaL [Arthrospira]
 gb|EDZ96003.1| photosystem I reaction centre subunit XI PsaL [Arthrospira maxima 
CS-328]
 emb|CCE18478.1| Photosystem I reaction center subunit XI (PSI-L) (PSI subunit 
V) [Arthrospira sp. PCC 8005]
 gb|EKD08287.1| photosystem I reaction centre subunit XI PsaL [Arthrospira platensis 
C1]
 emb|CDM97189.1| Photosystem I reaction center subunit XI (PSI-L) (PSI subunit 
V) [Arthrospira sp. PCC 8005]
Length=161

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGP  366
            +IQ  NGDPF+G L TP++ S     ++ NLPAYR  ++PLLRG+E+G+AHG   GGP
Sbjct  9    LIQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRPGLSPLLRGLEIGMAHGYFIGGP  66



>ref|WP_016949894.1| Photosystem I reaction center subunit XI [Anabaena sp. PCC 7108]
Length=173

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    + ++P   DP  G+LETP+ SSPL+ W++ NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDPRNRETVRPAGRDPQDGNLETPINSSPLVKWFIGNLPAYRLGLTPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG L  GP  + GP
Sbjct  69   AHGYLLFGPFAKLGP  83



>ref|YP_009092907.1| photosystem I protein subunit XI (chloroplast) [Chaetoceros simplex]
 gb|AIR75298.1| photosystem I protein subunit XI (chloroplast) [Chaetoceros simplex]
Length=151

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRALLKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|WP_006618479.1| photosystem I reaction center protein subunit XI [Arthrospira 
platensis]
 dbj|BAI91708.1| photosystem I reaction center subunit XI [Arthrospira platensis 
NIES-39]
 gb|KDR56772.1| Photosystem I reaction center subunit XI [Arthrospira platensis 
str. Paraca]
Length=161

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGP  366
            +IQ  NGDPF+G L TP++ S     ++ NLPAYR  ++PLLRG+E+G+AHG   GGP
Sbjct  9    LIQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRPGLSPLLRGLEIGMAHGYFIGGP  66



>ref|WP_011318298.1| photosystem I reaction center protein subunit XI [Anabaena variabilis]
 sp|P31092.2|PSAL_ANAVT RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L [Anabaena variabilis 
ATCC 29413]
 gb|ABA21099.1| Photosystem I reaction centre, subunit XI PsaL [Anabaena variabilis 
ATCC 29413]
Length=172

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP  G+LETPV +SPL+ W+++NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDPRNREVVFPAGRDPQWGNLETPVNASPLVKWFINNLPAYRPGLTPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGPTEKHGLRRECXVLG  426
            AHG    GP  + GP           +LG
Sbjct  69   AHGYFLFGPFAKLGPLRDAANANLAGLLG  97



>ref|WP_010994284.1| photosystem I reaction center protein subunit XI [Nostoc sp. 
PCC 7120]
 sp|P58577.1|PSAL_NOSS1 RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L [Nostoc sp. PCC 
7120]
 dbj|BAB77631.1| photosystem I subunit XI [Nostoc sp. PCC 7120]
Length=172

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP  G+LETPV +SPL+ W+++NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDPRNREVVFPAGRDPQWGNLETPVNASPLVKWFINNLPAYRPGLTPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGPTEKHGLRRECXVLG  426
            AHG    GP  + GP           +LG
Sbjct  69   AHGYFLFGPFAKLGPLRDAANANLAGLLG  97



>gb|AFW93937.1| photosystem I reaction center subunit XI PsaL [Anabaena sp. 90]
Length=153

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  214  DPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGPTEK  393
            DP  G LETP+ S+PL+ W++SNLPAYR  +NP  RG+EVG+AHG L  GP    GP   
Sbjct  7    DPQKGDLETPINSAPLVKWFISNLPAYRPGLNPFRRGLEVGMAHGYLLFGPFHRLGPLRN  66



>ref|WP_039203683.1| Photosystem I reaction center subunit XI [Aphanizomenon flos-aquae]
 gb|KHG39951.1| Photosystem I reaction center subunit XI [Aphanizomenon flos-aquae 
2012/KM1/D3]
Length=154

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  214  DPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGPTEK  393
            DP  G LETP+ S+PL+ W++SNLPAYR  +NP  RG+EVG+AHG L  GP  + GP   
Sbjct  8    DPQKGDLETPINSAPLVKWFISNLPAYRPGLNPFRRGLEVGMAHGYLLFGPFDKLGPLRN  67



>ref|YP_003734518.1| photosystem I protein subunit XI [Kryptoperidinium foliaceum]
 gb|ADI40303.1| photosystem I protein subunit XI [Kryptoperidinium foliaceum]
Length=150

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRAILQNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|YP_003734958.1| photosystem I protein L [Durinskia baltica]
 gb|ADI40175.1| photosystem I protein L [Durinskia baltica]
Length=150

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRAILQNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   VKLGP  67



>ref|WP_027402288.1| Photosystem I reaction center subunit XI [Aphanizomenon flos-aquae]
Length=154

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  214  DPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGPTEK  393
            DP  G LETP+ S+PL+ W++SNLPAYR  +NP  RG+EVG+AHG L  GP  + GP   
Sbjct  8    DPQKGDLETPINSAPLVKWFISNLPAYRPGLNPFRRGLEVGMAHGYLLFGPFDKLGPLRN  67



>ref|WP_028948018.1| Photosystem I reaction center subunit XI [Synechocystis sp. PCC 
6714]
 gb|AIE74486.1| photosystem I subunit XI (PsaL) [Synechocystis sp. PCC 6714]
Length=157

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+Q  NGDPF+G L TP++ S     ++ NLPAYR  ++P+LRG+EVG+AHG    GP 
Sbjct  6    QVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPW  65

Query  370  REGGP  384
               GP
Sbjct  66   TLLGP  70



>ref|WP_010874254.1| photosystem I reaction center protein subunit XI [Synechocystis 
sp. PCC 6803]
 ref|NP_442961.1| photosystem I reaction center protein subunit XI [Synechocystis 
sp. PCC 6803]
 sp|P37277.1|PSAL_SYNY3 RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L [Synechocystis sp. 
PCC 6803 substr. Kazusa]
 pdb|4L6V|L Chain L, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|LL Chain l, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|8 Chain 8, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 gb|AAA27296.1| photosystem I subunit [Synechocystis sp.]
 dbj|BAA18773.1| photosystem I subunit XI [Synechocystis sp. PCC 6803]
 dbj|BAK51815.1| photosystem I subunit XI [Synechocystis sp. PCC 6803]
 dbj|BAL30813.1| photosystem I subunit XI [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL33982.1| photosystem I subunit XI [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL37151.1| photosystem I subunit XI [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM53356.1| photosystem I reaction center protein subunitXI [Bacillus subtilis 
BEST7613]
 gb|AGF53322.1| photosystem I subunit XI [Synechocystis sp. PCC 6803]
Length=157

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+Q  NGDPF+G L TP++ S     ++ NLPAYR  ++P+LRG+EVG+AHG    GP 
Sbjct  6    QVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPW  65

Query  370  REGGP  384
               GP
Sbjct  66   TLLGP  70



>ref|WP_041457745.1| Photosystem I reaction center subunit XI [Anabaena sp. 90]
Length=166

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  214  DPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGPTEK  393
            DP  G LETP+ S+PL+ W++SNLPAYR  +NP  RG+EVG+AHG L  GP    GP   
Sbjct  20   DPQKGDLETPINSAPLVKWFISNLPAYRPGLNPFRRGLEVGMAHGYLLFGPFHRLGPLRN  79



>ref|YP_277352.1| photosystem I subunit XI [Emiliania huxleyi]
 sp|Q4G3B5.1|PSAL_EMIHU RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Emiliania 
huxleyi]
 gb|AAX13851.1| photosystem I subunit XI [Emiliania huxleyi]
 gb|AEI29513.1| photosystem I subunit XI [Emiliania huxleyi]
Length=145

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + ++P N DPF+G+L TPVT+S     YL NLP YR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFVKPYNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
               GP
Sbjct  63   YILGP  67



>ref|YP_009028863.1| photosystem I reaction center subunit XI (chloroplast) [Coscinodiscus 
radiatus]
 gb|AGH28407.1| photosystem I reaction center subunit XI (chloroplast) (chloroplast) 
[Coscinodiscus radiatus]
Length=152

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAVTRALLKNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   IKLGP  67



>gb|AHY04408.1| photosystem I reaction center subunit XI (chloroplast) [Chrysochromulina 
sp. CCMP291]
Length=145

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + ++P N DPF+G+L TPVT+S     YL NLP YR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFVKPYNNDPFVGNLSTPVTTSTATKIYLGNLPIYRKGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
               GP
Sbjct  63   YILGP  67



>gb|AIA61269.1| photosystem I subunit XI (chloroplast) (chloroplast) [Cyanidiaceae 
sp. MX-AZ01]
Length=139

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + I+P N DPF+G L TPV SS L   YLS LP YR  ++P LRG+E+G+AHG    GP 
Sbjct  3    EYIKPYNNDPFVGHLATPVNSSSLTRGYLSQLPIYRRGLSPFLRGLEIGMAHGYFLIGPF  62

Query  370  REGGPTEKHGLRRECXVL  423
             + GP     ++    +L
Sbjct  63   VQLGPLRNTEMKYLAGLL  80



>ref|YP_005090088.1| psaL gene product (chloroplast) [Fucus vesiculosus]
 emb|CAX12471.1| photosystem I protein L [Fucus vesiculosus]
Length=145

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DP +G L TP+TSS     YL++LPAYR  ++PLLRG+E+G+AHG L  GP 
Sbjct  3    SFIKPYNDDPSVGHLSTPITSSAATKAYLASLPAYRKGLSPLLRGLEIGMAHGYLLLGPF  62

Query  370  REGGPTEKHGL  402
             + GP  +  L
Sbjct  63   EKLGPLRESEL  73



>ref|WP_015126598.1| photosystem I reaction centre subunit XI PsaL [Calothrix sp. 
PCC 7507]
 gb|AFY30770.1| photosystem I reaction centre subunit XI PsaL [Calothrix sp. 
PCC 7507]
Length=181

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
             +I+P  GDP +G+L TP+  SPL+  ++SNLPAYR  + P +RG+E+G+AHG L  GP 
Sbjct  18   DIIKPFKGDPCLGNLSTPINDSPLVRAFISNLPAYRKGLTPFMRGLEIGMAHGYLLVGPE  77

Query  370  REGGPTEK--HG  399
               GP  +  HG
Sbjct  78   VVVGPLRESVHG  89



>ref|WP_026733119.1| Photosystem I reaction center subunit XI [Fischerella sp. PCC 
9605]
Length=172

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP +G+LETP+ SSP   W+++NLPAYR  + P  RG+E+G+
Sbjct  9    KNLPSDPRNREVVFPAKRDPQVGNLETPINSSPFTKWFINNLPAYRQGITPFRRGLEIGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG    GP  + GP
Sbjct  69   AHGYWLFGPFAKLGP  83



>ref|YP_004376665.1| photosystem I protein L (chloroplast) [Fistulifera solaris]
 dbj|BAK19031.1| photosystem I protein L (chloroplast) [Fistulifera solaris]
Length=151

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G L TP+TSS +    L NLPAYR  + PLLRG+E+GLAHG    GP 
Sbjct  3    NFIKPYNDDPFVGHLATPITSSAITRALLQNLPAYRFGLTPLLRGLEIGLAHGYFLIGPF  62

Query  370  REGGP  384
               GP
Sbjct  63   VMLGP  67



>ref|WP_027840947.1| Photosystem I reaction center subunit XI [Mastigocoleus testarum]
Length=165

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            +V+     DP  G+LETPV SSP++ WY++NLPAYR  + P  RG+EVG+AHG L  GP 
Sbjct  12   EVVTAAGRDPQQGNLETPVNSSPIVKWYINNLPAYRPGLTPFRRGLEVGMAHGYLLFGPF  71

Query  370  REGGPTEKHGLRRECXVLG  426
             + GP           +LG
Sbjct  72   AKLGPLRNANNGNLAGLLG  90



>ref|WP_004162779.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa]
 emb|CCI29852.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa 
PCC 9809]
Length=160

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+ P N DPFIG L TP+++S     ++ NLPAYR  + P+LRG+EVG+AHG   GGP 
Sbjct  8    QVVTPYNDDPFIGHLATPISASGFTKAFIGNLPAYRPGLAPILRGLEVGMAHGYFLGGPW  67

Query  370  REGGP  384
               GP
Sbjct  68   VVLGP  72



>dbj|GAL95076.1| photosystem I subunit XI (PsaL) [Microcystis aeruginosa NIES-44]
Length=160

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+ P N DPFIG L TP+++S     ++ NLPAYR  + P+LRG+EVG+AHG   GGP 
Sbjct  8    QVVTPYNDDPFIGHLATPISASGFTKAFIGNLPAYRPGLAPILRGLEVGMAHGYFLGGPW  67

Query  370  REGGP  384
               GP
Sbjct  68   VVLGP  72



>ref|WP_012267003.1| photosystem I reaction center protein subunit XI [Microcystis 
aeruginosa]
 sp|B0JT88.1|PSAL_MICAN RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L [Microcystis aeruginosa 
NIES-843]
 dbj|BAG04191.1| photosystem I subunit XI [Microcystis aeruginosa NIES-843]
Length=160

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+ P N DPFIG L TP+++S     ++ NLPAYR  + P+LRG+EVG+AHG   GGP 
Sbjct  8    QVVTPYNDDPFIGHLATPISASGFTKAFIGNLPAYRPGLAPILRGLEVGMAHGYFLGGPW  67

Query  370  REGGP  384
               GP
Sbjct  68   VVLGP  72



>ref|WP_002757141.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa]
 emb|CCH99057.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa 
PCC 9717]
Length=160

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+ P N DPFIG L TP+++S     ++ NLPAYR  + P+LRG+EVG+AHG   GGP 
Sbjct  8    QVVTPYNDDPFIGHLATPISASGFTKAFIGNLPAYRPGLAPILRGLEVGMAHGYFLGGPW  67

Query  370  REGGP  384
               GP
Sbjct  68   VVLGP  72



>ref|WP_002802734.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa]
 emb|CCI37262.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa 
PCC 9701]
Length=160

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+ P N DPFIG L TP+++S     ++ NLPAYR  + P+LRG+EVG+AHG   GGP 
Sbjct  8    QVVTPYNDDPFIGHLATPISASGFTKAFIGNLPAYRPGLAPILRGLEVGMAHGYFLGGPW  67

Query  370  REGGP  384
               GP
Sbjct  68   VVLGP  72



>ref|WP_002737469.1| MULTISPECIES: photosystem I reaction center subunit XI [Microcystis]
 emb|CCH93141.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa 
PCC 9432]
 emb|CCI04960.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa 
PCC 9443]
 emb|CCI06549.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa 
PCC 7941]
 emb|CCI15110.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa 
PCC 9806]
 emb|CCI20100.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa 
PCC 9807]
 emb|CCI24618.1| Photosystem I reaction center subunit XI [Microcystis aeruginosa 
PCC 9808]
 emb|CCI34207.1| Photosystem I reaction center subunit XI [Microcystis sp. T1-4]
 gb|ELP54786.1| photosystem I reaction center subunit XI [Microcystis aeruginosa 
TAIHU98]
 gb|EPF21290.1| hypothetical protein MAESPC_02906 [Microcystis aeruginosa SPC777]
Length=160

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            QV+ P N DPFIG L TP+++S     ++ NLPAYR  + P+LRG+EVG+AHG   GGP 
Sbjct  8    QVVTPYNDDPFIGHLATPISASGFTKAFIGNLPAYRPGLAPILRGLEVGMAHGYFLGGPW  67

Query  370  REGGP  384
               GP
Sbjct  68   VVLGP  72



>gb|AGS18382.1| PsaL [Chroococcidiopsis sp. TS-821]
Length=172

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            +V+ P   DP IG+LETP+ +S L+ W+++NLPAYR  + PL RG+EVG+AHG    GP 
Sbjct  19   EVVYPSRRDPQIGNLETPINNSSLVKWFINNLPAYRPGITPLRRGLEVGMAHGYWLLGPF  78

Query  370  REGGP  384
             + GP
Sbjct  79   AKLGP  83



>ref|YP_006639085.1| photosystem I protein L (chloroplast) [Saccharina japonica]
 gb|AFC40139.1| photosystem I protein L (chloroplast) [Saccharina japonica]
Length=145

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            I+P N DP +G L TPVTSS     YL +LPAYR  ++PLLRG+E+G+AHG L  GP  +
Sbjct  5    IKPYNDDPSVGHLSTPVTSSAATKAYLGSLPAYRKGLSPLLRGLEIGMAHGYLLLGPFEK  64

Query  376  GGP  384
             GP
Sbjct  65   LGP  67



>ref|YP_007476281.1| photosystem I reaction center subunit XI (chloroplast) [Pavlova 
lutheri]
 gb|AGE93779.1| photosystem I reaction center subunit XI (chloroplast) [Pavlova 
lutheri]
Length=145

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + I+P N DPF+G L TPVT+S     +L NLP YR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFIKPYNNDPFVGHLATPVTASAFTRTWLLNLPIYRKNLSPLLRGLEIGMAHGYFLLGPF  62

Query  370  REGGP  384
               GP
Sbjct  63   YTFGP  67



>ref|YP_008965752.1| photosystem I reaction centre subunit XI (chloroplast) [Porphyridium 
purpureum]
 dbj|BAO23728.1| photosystem I reaction centre subunit XI (chloroplast) [Porphyridium 
purpureum]
Length=144

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I P N DPF+G+L TP+ +S      LSNLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    DFISPYNEDPFVGNLSTPINTSSFTKGLLSNLPAYRRGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   YKLGP  67



>ref|YP_063666.1| photosystem I subunit XI [Gracilaria tenuistipitata var. liui]
 sp|Q6B8P4.1|PSAL_GRATL RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Gracilaria 
tenuistipitata var. liui]
 gb|AAT79741.1| photosystem I reaction center subunit XI [Gracilaria tenuistipitata 
var. liui]
Length=150

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              IQ  N DPF+G+L TPV++S      L+NLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    DFIQSYNNDPFLGNLSTPVSTSTFTKGLLNNLPAYRRGLSPLLRGLEIGMAHGYFLVGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>gb|AIA21251.1| photosystem I subunit XI [Pyropia kanakaensis]
Length=153

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + I+P N DPF+G+L TPV++S      L NLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFIKPYNDDPFVGNLSTPVSTSSFSKGLLGNLPAYRRGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|NP_053832.1| photosystem I subunit XI [Porphyra purpurea]
 sp|P51222.1|PSAL_PORPU RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L (chloroplast) [Porphyra 
purpurea]
 gb|AAC08108.1| Photosystem I reaction centre subunit XI (chloroplast) [Porphyra 
purpurea]
 gb|AFC39892.1| photosystem I subunit XI [Porphyra umbilicalis]
Length=153

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + I+P N DPF+G+L TPV++S      L NLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFIKPYNDDPFVGNLSTPVSTSSFSKGLLGNLPAYRRGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|YP_007947751.1| photosystem I subunit XI (chloroplast) [Pyropia haitanensis]
 gb|AGG37000.1| photosystem I subunit XI (chloroplast) [Pyropia haitanensis]
Length=153

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + I+P N DPF+G+L TPV++S      L NLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFIKPYNDDPFVGNLSTPVSTSSFSKGLLGNLPAYRRGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|WP_015210165.1| Photosystem I reaction centre subunit XI [Cylindrospermum stagnale]
 gb|AFZ26928.1| Photosystem I reaction centre subunit XI [Cylindrospermum stagnale 
PCC 7417]
Length=173

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +   P   DP  G LETP+ SSPLI W+++NLPAYR  +NP  RG+EVG+
Sbjct  9    KNLPSDPRNREAAFPAGRDPQKGDLETPINSSPLIKWFINNLPAYRPGLNPGRRGLEVGM  68

Query  340  AHGSLPGGPIREGGPTEK  393
            AHG L  GP  + GP  +
Sbjct  69   AHGYLLFGPFSKLGPLRE  86



>ref|YP_009019674.1| photosystem I reaction center subunit XI (chloroplast) [Gracilaria 
salicornia]
 gb|AHH24642.1| photosystem I reaction center subunit XI (chloroplast) [Gracilaria 
salicornia]
Length=150

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              IQ  N DPF+G+L TP+++S      LSNLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    DFIQSYNKDPFVGNLSTPISTSTFTRGLLSNLPAYRRGLSPLLRGLEIGMAHGYFLVGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>gb|AIA21457.1| photosystem I subunit XI [Pyropia fucicola]
Length=153

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + I+P N DPF+G+L TPV++S      L NLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFIKPYNDDPFVGNLSTPVSTSSFSKGLLGNLPAYRRGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>gb|AGH27547.1| photosystem I subunit XI (chloroplast) [Pyropia yezoensis]
Length=153

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + I+P N DPF+G+L TPV++S      L NLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFIKPYNDDPFVGNLSTPVSTSSFSKGLLGNLPAYRRGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|YP_003289277.1| Photosystem I reaction centre subunit XI [Ectocarpus siliculosus]
 emb|CAV31308.1| Photosystem I reaction centre subunit XI [Ectocarpus siliculosus]
 emb|CAT18861.1| Photosystem I reaction centre subunit XI [Ectocarpus siliculosus]
Length=147

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DP +G L TPVTSS     YL +LPAYR  ++PLLRG+E+G+AHG L  GP 
Sbjct  3    SFIKPYNNDPSVGHLSTPVTSSAATKAYLGSLPAYRKGLSPLLRGLEIGMAHGYLLLGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   EKLGP  67



>ref|YP_009027506.1| photosystem I subunit XI [Pyropia perforata]
 gb|AGQ17055.1| photosystem I subunit XI [Pyropia perforata]
 gb|AHB35000.1| photosystem I subunit XI (chloroplast) [Pyropia perforata]
 gb|AHB35209.1| photosystem I subunit XI (chloroplast) [Pyropia perforata]
 gb|AIA19371.1| photosystem I subunit XI [Pyropia perforata]
 gb|AIA19580.1| photosystem I subunit XI [Pyropia perforata]
 gb|AIA19789.1| photosystem I subunit XI [Pyropia perforata]
 gb|AIA19998.1| photosystem I subunit XI [Pyropia perforata]
 gb|AIA20207.1| photosystem I subunit XI [Pyropia perforata]
 gb|AIA20416.1| photosystem I subunit XI [Pyropia perforata]
 gb|AIA20625.1| photosystem I subunit XI [Pyropia perforata]
 gb|AIA20834.1| photosystem I subunit XI [Pyropia perforata]
 gb|AIA21043.1| photosystem I subunit XI [Pyropia perforata]
Length=153

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + I+P N DPF+G+L TPV++S      L NLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    EFIKPYNDDPFVGNLSTPVSTSSFSKGLLGNLPAYRRGLSPLLRGLEIGMAHGYFLIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   DKLGP  67



>ref|WP_007356850.1| MULTISPECIES: Photosystem I reaction center subunit XI [Kamptonema]
 emb|CBN57656.1| Photosystem I reaction center subunit XI [ [[Oscillatoria] sp. 
PCC 6506]
Length=167

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++I+P NGDPF+G L TP+++S     ++ NLPAYR  ++P++RG+E+GLAHG    GP 
Sbjct  8    ELIKPFNGDPFVGHLATPISASDFTKTFIGNLPAYRKNLSPIVRGLEIGLAHGYFLVGPE  67

Query  370  REGGPTEKH  396
               GP   +
Sbjct  68   IVFGPLRDY  76



>ref|WP_012627225.1| photosystem I reaction center protein subunit XI [Cyanothece 
sp. PCC 7425]
 sp|B8HRF0.1|PSAL_CYAP4 RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L [Cyanothece sp. 
PCC 7425]
 gb|ACL44138.1| photosystem I reaction centre subunit XI PsaL [Cyanothece sp. 
PCC 7425]
Length=159

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  169  QSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHG  348
             ++    ++I+P NGDPF G L TP++ S     ++ NLPAYR  ++P+LRG+E+G+AHG
Sbjct  1    MADARDMELIKPYNGDPFTGHLSTPISDSDFTRTFIGNLPAYRKGLSPILRGLEIGMAHG  60

Query  349  SLPGGPIREGGP  384
                GP  + GP
Sbjct  61   YFLIGPWVKLGP  72



>ref|WP_015174679.1| photosystem I reaction centre subunit XI PsaL [Oscillatoria nigro-viridis]
 gb|AFZ05349.1| photosystem I reaction centre subunit XI PsaL [Oscillatoria nigro-viridis 
PCC 7112]
Length=169

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++I+P NGDPF G L TP+++S     ++ NLPAYR  ++PL+RG+E+GLAHG    GP 
Sbjct  8    ELIKPFNGDPFTGHLATPISASDFTKAFIGNLPAYRKGLSPLVRGLEIGLAHGYFLVGPE  67

Query  370  REGGPTEKH  396
               GP   +
Sbjct  68   IVFGPLRDY  76



>ref|WP_015148867.1| Photosystem I reaction centre subunit XI [Oscillatoria acuminata]
 gb|AFY82226.1| Photosystem I reaction centre subunit XI [Oscillatoria acuminata 
PCC 6304]
Length=169

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +1

Query  169  QSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHG  348
             ++    ++++P  GDPF+G L TP++ S     ++ NLPAYR  ++P+LRGIE+G+AHG
Sbjct  1    MADARDIEMVKPYGGDPFVGHLSTPISDSAFTKAFIGNLPAYRKGLSPILRGIEIGMAHG  60

Query  349  SLPGGPIREGGPTEKH  396
                GP  + GP   +
Sbjct  61   YFLIGPWIKFGPLRDY  76



>ref|WP_009459087.1| MULTISPECIES: Photosystem I reaction center subunit XI [Fischerella]
 gb|EHC10250.1| Photosystem I reaction center subunit XI [Fischerella sp. JSC-11]
Length=172

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP IG+LETP+ SS L  W+++NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDPRNREVVFPATRDPQIGNLETPINSSALTKWFINNLPAYRPGITPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG    GP  + GP
Sbjct  69   AHGYWIFGPFAKLGP  83



>ref|XP_007509229.1| photosystem I reaction center subunit XI [Bathycoccus prasinos]
 emb|CCO19686.1| photosystem I reaction center subunit XI [Bathycoccus prasinos]
Length=142

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  232  LETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIREGGP  384
            LETPVTS+P+++ +LSNLPAYRT V+PLLRG+EVGLAHG    GP  + GP
Sbjct  2    LETPVTSAPIVSNFLSNLPAYRTGVSPLLRGVEVGLAHGFFVAGPFIKLGP  52



>ref|WP_017654966.1| Photosystem I reaction center subunit XI [Microchaete sp. PCC 
7126]
Length=172

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP IG+LETP+ +SP+  W+++NLPAYR  + P  RG+EVG 
Sbjct  9    KNLASDPRNREVVFPAGRDPQIGNLETPINASPISKWWINNLPAYRPGLTPFRRGLEVGQ  68

Query  340  AHGSLPGGPIREGGPTEKHGLRRECXVLG  426
            AHG L  GP  + GP           +LG
Sbjct  69   AHGYLLFGPFAKLGPLRDTDSANLAGLLG  97



>ref|WP_016867319.1| Photosystem I reaction center subunit XI [Fischerella muscicola]
Length=172

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP IG+LETP+ SS L  W+++NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDPRNREVVFPAKRDPQIGNLETPINSSALTKWFINNLPAYRPGITPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG    GP  + GP
Sbjct  69   AHGYWIFGPFAKLGP  83



>ref|WP_015224772.1| photosystem I reaction centre subunit XI PsaL [Halothece sp. 
PCC 7418]
 gb|AFZ42894.1| photosystem I reaction centre subunit XI PsaL [Halothece sp. 
PCC 7418]
Length=168

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  172  SEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGS  351
            +E    Q IQP N D ++G L TP++ S     +++NLPAYR  ++PLLRG+E+G+AHG 
Sbjct  2    AETQNMQYIQPYNDDVYVGHLSTPISDSGFTRTFINNLPAYREGISPLLRGLEIGMAHGY  61

Query  352  LPGGPIREGGP  384
               GP    GP
Sbjct  62   FLVGPWTLLGP  72



>sp|P25902.2|PSAL_SYNEL RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L [Synechococcus elongatus]
 pir||S22209 photosystem I chain XI - Synechococcus sp
 emb|CAA45296.1| photosystem I subunit XI [Synechococcus sp.]
Length=149

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++++P NGDPF+G L TP++ S L+  ++ NLPAYR  ++P+L G+EVG+AHG    GP 
Sbjct  4    ELVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILPGLEVGMAHGYFLIGPW  63

Query  370  REGGP  384
             + GP
Sbjct  64   VKLGP  68



>ref|WP_017320640.1| Photosystem I reaction center subunit XI [cyanobacterium PCC 
7702]
 sp|O31126.1|PSAL_MASLA RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L [Mastigocladus laminosus]
 gb|AAC04841.1| photosystem I subunit XI [Fischerella sp. PCC 7605]
Length=173

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            +V+ P   DP IG LETP+ SSPL+ W++ NLPAYR  +    RG+EVG+AHG    GP 
Sbjct  19   EVVFPAYRDPQIGDLETPINSSPLVKWFIGNLPAYRPGITTFRRGLEVGMAHGYWIFGPF  78

Query  370  REGGP  384
             + GP
Sbjct  79   AKLGP  83



>ref|WP_019492434.1| Photosystem I reaction center subunit XI [Calothrix sp. PCC 7103]
Length=172

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            +V+ P   +P  G+LETP+ +SPL  WY++NLPAYR  + P  RG+EVG+AHG    GP 
Sbjct  19   EVVFPAGRNPLEGNLETPINASPLTKWYINNLPAYRAGLTPFRRGLEVGMAHGYFIFGPF  78

Query  370  REGGP  384
             + GP
Sbjct  79   AKLGP  83



>ref|WP_017290020.1| Photosystem I reaction center subunit XI [Leptolyngbya boryana]
Length=156

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            ++I+P NGDPF G L TP++ S     ++ NLPAYR  ++PLLRG+E+G+AHG    GP 
Sbjct  4    ELIKPYNGDPFTGHLSTPISDSGFTRAFIGNLPAYRKGLSPLLRGLEIGMAHGYFLVGPW  63

Query  370  REGGP  384
               GP
Sbjct  64   TLLGP  68



>ref|WP_015188950.1| Photosystem I reaction center subunit XI [Gloeocapsa sp. PCC 
7428]
 gb|AFZ31078.1| Photosystem I reaction center subunit XI [Gloeocapsa sp. PCC 
7428]
Length=172

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            +V+ P   DP IG+LETP+ +S L+ W+++NLPAYR  + PL RG+E G+AHG    GP 
Sbjct  19   EVVYPSKRDPQIGNLETPINNSSLVKWFINNLPAYRPGITPLRRGLEAGMAHGYWLLGPF  78

Query  370  REGGP  384
             + GP
Sbjct  79   AKLGP  83



>ref|YP_008145458.1| photosystem I subunit XI (chloroplast) [Phaeocystis globosa]
 gb|AGO44920.1| photosystem I subunit XI (chloroplast) [Phaeocystis globosa]
Length=145

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + ++P N DPF+G+L TPVT+S     YL NLP YR  ++ L+RG+EVG+AHG    GP 
Sbjct  3    EFVKPYNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLSALMRGLEVGMAHGYFLIGPF  62

Query  370  REGGPTEK  393
               GP   
Sbjct  63   YILGPMRN  70



>ref|WP_016862312.1| MULTISPECIES: Photosystem I reaction center subunit XI [Fischerella]
Length=172

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP IG+LETP+ SS L  W+++NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDPRNREVVFPAMRDPQIGNLETPINSSALTKWFINNLPAYRPGITPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG    GP  + GP
Sbjct  69   AHGYWIFGPFAKLGP  83



>ref|YP_005088683.1| photosystem I subunit XI [Phaeocystis antarctica]
 gb|AEK26787.1| photosystem I subunit XI [Phaeocystis antarctica]
Length=145

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            + ++P N DPF+G+L TPVT+S     YL NLP YR  ++ L+RG+EVG+AHG    GP 
Sbjct  3    EFVKPYNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLSALMRGLEVGMAHGYFLIGPF  62

Query  370  REGGPTEK  393
               GP   
Sbjct  63   YILGPMRN  70



>ref|WP_017310087.1| MULTISPECIES: Photosystem I reaction center subunit XI [Stigonematales]
 gb|KIY13047.1| Photosystem I reaction center subunit XI [Mastigocladus laminosus 
UU774]
Length=172

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP IG+LETP+ SS L  W+++NLPAYR  + P  RG+EVG+
Sbjct  9    KNLPSDPRNREVVFPAMRDPQIGNLETPINSSALTKWFINNLPAYRPGITPFRRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG    GP  + GP
Sbjct  69   AHGYWIFGPFAKLGP  83



>ref|WP_026082875.1| Photosystem I reaction center subunit XI [Mastigocladopsis repens]
Length=172

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            +V+ P   DP  G+LETP+ +SPL+ WY++ LPAYR+ + P  RG+E+G+AHG    GP 
Sbjct  19   EVVFPQWRDPQQGNLETPINASPLVKWYINTLPAYRSGITPFRRGLEIGMAHGYWIFGPF  78

Query  370  REGGP  384
             + GP
Sbjct  79   AKLGP  83



>ref|WP_016868714.1| Photosystem I reaction center subunit XI [Fischerella muscicola]
Length=174

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +1

Query  154  TVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEV  333
            TV  V ++     +I+P  GDP +G+L TP+  SPL   +++NLPAYR  + P +RG+E+
Sbjct  4    TVDTVDND-----IIKPFKGDPCLGNLSTPINDSPLAKAFINNLPAYRKGLTPFMRGLEI  58

Query  334  GLAHGSLPGGPIREGGPTEK--HG  399
            G+AHG    GP    GP  +  HG
Sbjct  59   GMAHGYFLVGPEVVIGPLRESAHG  82



>ref|WP_016871860.1| Photosystem I reaction center subunit XI [Fischerella thermalis]
Length=174

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +1

Query  154  TVKAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEV  333
            TV  V ++     +I+P  GDP +G+L TP+  SPL   +++NLPAYR  + P +RG+E+
Sbjct  4    TVDTVDND-----IIKPFKGDPCLGNLSTPINDSPLAKAFINNLPAYRKGLTPFMRGLEI  58

Query  334  GLAHGSLPGGPIREGGPTEK--HG  399
            G+AHG    GP    GP  +  HG
Sbjct  59   GMAHGYFLVGPEVVIGPLRESAHG  82



>ref|YP_001936395.1| photosystem I subunit XI [Heterosigma akashiwo]
 gb|ABV66001.1| photosystem I reaction center subunit XI [Heterosigma akashiwo]
 gb|ABV70142.1| photosystem I reaction center subunit XI [Heterosigma akashiwo]
Length=148

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DP +G L TP+++S     +L NLPAYR  ++PLLRG+EVG+AHG L  GP 
Sbjct  3    NFIKPYNNDPSVGHLSTPISNSAATRAFLGNLPAYRPGLSPLLRGLEVGMAHGYLLVGPF  62

Query  370  REGGPTEK  393
             + GP   
Sbjct  63   DKFGPLRN  70



>ref|WP_009787332.1| photosystem I reaction center protein subunit XI [Lyngbya sp. 
PCC 8106]
 gb|EAW34067.1| photosystem I reaction center protein subunit XI [Lyngbya sp. 
PCC 8106]
Length=163

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  193  VIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIR  372
             +QP  GDPF G L TP++ S     ++ NLPAYR  ++PLLRG+E+G+AHG    GP  
Sbjct  12   FVQPYKGDPFTGHLSTPISDSDFTRAFIGNLPAYRKGLSPLLRGLEIGMAHGYFLIGPWV  71

Query  373  EGGP  384
            + GP
Sbjct  72   KLGP  75



>ref|YP_009051129.1| photosystem I subunit XI [Galdieria sulphuraria]
 gb|ADO32974.1| photosystem I subunit L [Galdieria sulphuraria]
 gb|AIG92572.1| photosystem I subunit XI [Galdieria sulphuraria]
Length=141

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
              I+P N DPF+G+L TP+ +S L    L NLP YR  ++PLLRG+E+G+AHG    GP 
Sbjct  3    DFIKPYNDDPFVGNLATPINTSSLTKNLLGNLPIYRRRLSPLLRGLEIGMAHGYFFIGPF  62

Query  370  REGGP  384
             + GP
Sbjct  63   YKLGP  67



>ref|WP_015230763.1| Photosystem I reaction centre subunit XI [Dactylococcopsis salina]
 gb|AFZ51787.1| Photosystem I reaction centre subunit XI [Dactylococcopsis salina 
PCC 8305]
Length=166

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  190  QVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPI  369
            Q IQP N D ++G L TP++ S     +++NLPAYR  V+PLLRG+E+G+AHG    GP 
Sbjct  6    QYIQPYNDDVYVGHLSTPISDSGFTRAFINNLPAYREGVSPLLRGLEIGMAHGYFLVGPW  65

Query  370  REGGP  384
               GP
Sbjct  66   TLLGP  70



>ref|WP_009769096.1| Photosystem I reaction centre subunit XI [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ66835.1| Photosystem I reaction centre subunit XI [Oscillatoriales cyanobacterium 
JSC-12]
Length=171

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +1

Query  196  IQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGLAHGSLPGGPIRE  375
            ++P  GDPF+G+L TPV  SPL+  ++ NLPAYR  + P +RG+E+G+AHG    GP   
Sbjct  10   VKPYKGDPFLGNLSTPVNDSPLVRAFIRNLPAYRPGLTPFMRGLEIGMAHGYFLIGPEIV  69

Query  376  GGPTEK--HG  399
             GP  +  HG
Sbjct  70   VGPLRETAHG  79



>ref|WP_012410219.1| photosystem I reaction center protein subunit XI [Nostoc punctiforme]
 sp|B2J591.1|PSAL_NOSP7 RecName: Full=Photosystem I reaction center subunit XI; AltName: 
Full=PSI subunit V; AltName: Full=PSI-L [Nostoc punctiforme 
PCC 73102]
 gb|ACC82248.1| photosystem I reaction centre, subunit XI PsaL [Nostoc punctiforme 
PCC 73102]
Length=173

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +1

Query  160  KAVQSEKPTFQVIQPLNGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGIEVGL  339
            K + S+    +V+ P   DP +G+LETPV +SPL  W+++NLPAYR  ++P  RG+EVG+
Sbjct  9    KNLPSDPRNREVVFPAFRDPQLGNLETPVNASPLSKWFINNLPAYRPGLSPARRGLEVGM  68

Query  340  AHGSLPGGPIREGGP  384
            AHG    GP  + GP
Sbjct  69   AHGYWIFGPFAKLGP  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175