BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J06

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010690130.1|  PREDICTED: GDSL esterase/lipase APG-like           244   9e-77   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAM08277.1|  zinc finger protein                                    241   4e-75   Malus domestica [apple tree]
ref|XP_009344493.1|  PREDICTED: GDSL esterase/lipase APG-like           240   5e-75   Pyrus x bretschneideri [bai li]
ref|XP_008380836.1|  PREDICTED: GDSL esterase/lipase APG-like           241   5e-75   
ref|XP_008358081.1|  PREDICTED: GDSL esterase/lipase APG-like           241   6e-75   
ref|XP_008375835.1|  PREDICTED: GDSL esterase/lipase APG-like           239   1e-74   Malus domestica [apple tree]
ref|XP_008228396.1|  PREDICTED: GDSL esterase/lipase APG                239   2e-74   Prunus mume [ume]
ref|XP_010654595.1|  PREDICTED: GDSL esterase/lipase APG-like           238   4e-74   Vitis vinifera
ref|XP_009337919.1|  PREDICTED: GDSL esterase/lipase APG-like           238   4e-74   Pyrus x bretschneideri [bai li]
ref|XP_007215590.1|  hypothetical protein PRUPE_ppa007650mg             238   6e-74   Prunus persica
gb|KHN39266.1|  GDSL esterase/lipase APG                                236   2e-73   Glycine soja [wild soybean]
ref|NP_001242561.1|  uncharacterized protein LOC100815273 precursor     235   3e-73   
ref|XP_009343018.1|  PREDICTED: GDSL esterase/lipase APG-like           236   4e-73   Pyrus x bretschneideri [bai li]
ref|XP_011072453.1|  PREDICTED: GDSL esterase/lipase APG                235   4e-73   Sesamum indicum [beniseed]
gb|ACJ84797.1|  unknown                                                 231   8e-73   Medicago truncatula
ref|XP_009759976.1|  PREDICTED: GDSL esterase/lipase APG                234   9e-73   Nicotiana sylvestris
ref|XP_009612468.1|  PREDICTED: GDSL esterase/lipase APG                234   1e-72   Nicotiana tomentosiformis
gb|KDO38517.1|  hypothetical protein CISIN_1g018227mg                   229   1e-72   Citrus sinensis [apfelsine]
ref|XP_010267093.1|  PREDICTED: GDSL esterase/lipase APG-like           234   1e-72   Nelumbo nucifera [Indian lotus]
gb|KDO38518.1|  hypothetical protein CISIN_1g018227mg                   229   1e-72   Citrus sinensis [apfelsine]
ref|XP_006343026.1|  PREDICTED: GDSL esterase/lipase APG-like           234   1e-72   Solanum tuberosum [potatoes]
emb|CAB81548.2|  putative proline-rich protein APG isolog               234   1e-72   Cicer arietinum [garbanzo]
ref|XP_004235632.1|  PREDICTED: GDSL esterase/lipase APG-like           234   2e-72   Solanum lycopersicum
ref|XP_004510325.1|  PREDICTED: GDSL esterase/lipase APG-like           233   2e-72   Cicer arietinum [garbanzo]
gb|KDO38516.1|  hypothetical protein CISIN_1g018227mg                   230   5e-72   Citrus sinensis [apfelsine]
ref|XP_003543615.1|  PREDICTED: GDSL esterase/lipase APG-like           232   6e-72   Glycine max [soybeans]
gb|KHN30020.1|  GDSL esterase/lipase APG                                232   6e-72   Glycine soja [wild soybean]
ref|XP_010062556.1|  PREDICTED: GDSL esterase/lipase APG                232   6e-72   Eucalyptus grandis [rose gum]
gb|KHN05319.1|  GDSL esterase/lipase APG                                232   7e-72   Glycine soja [wild soybean]
gb|ACU24285.1|  unknown                                                 232   7e-72   Glycine max [soybeans]
ref|XP_007150584.1|  hypothetical protein PHAVU_005G164800g             232   9e-72   Phaseolus vulgaris [French bean]
ref|XP_003597654.1|  GDSL esterase/lipase APG                           231   1e-71   Medicago truncatula
ref|XP_003531641.2|  PREDICTED: GDSL esterase/lipase APG-like           232   2e-71   
gb|KDO38513.1|  hypothetical protein CISIN_1g018227mg                   229   3e-71   Citrus sinensis [apfelsine]
ref|XP_003627082.1|  GDSL esterase/lipase APG                           229   8e-71   Medicago truncatula
ref|XP_006465718.1|  PREDICTED: GDSL esterase/lipase APG-like           229   9e-71   Citrus sinensis [apfelsine]
ref|XP_006426844.1|  hypothetical protein CICLE_v10025938mg             229   9e-71   Citrus clementina [clementine]
ref|XP_007135613.1|  hypothetical protein PHAVU_010G143600g             230   1e-70   Phaseolus vulgaris [French bean]
ref|XP_010244385.1|  PREDICTED: GDSL esterase/lipase APG-like           227   9e-70   Nelumbo nucifera [Indian lotus]
ref|XP_006343027.1|  PREDICTED: GDSL esterase/lipase APG-like           227   1e-69   Solanum tuberosum [potatoes]
ref|XP_004486794.1|  PREDICTED: GDSL esterase/lipase APG-like           226   2e-69   Cicer arietinum [garbanzo]
ref|XP_006406840.1|  hypothetical protein EUTSA_v10021008mg             226   2e-69   Eutrema salsugineum [saltwater cress]
emb|CDO97957.1|  unnamed protein product                                226   3e-69   Coffea canephora [robusta coffee]
ref|XP_002515932.1|  zinc finger protein, putative                      225   4e-69   Ricinus communis
ref|XP_010098171.1|  GDSL esterase/lipase APG                           224   6e-69   Morus notabilis
ref|XP_009408845.1|  PREDICTED: GDSL esterase/lipase APG-like           224   7e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK38989.1|  hypothetical protein AALP_AA3G185500                    224   1e-68   Arabis alpina [alpine rockcress]
ref|XP_004302841.1|  PREDICTED: GDSL esterase/lipase APG                224   2e-68   Fragaria vesca subsp. vesca
ref|XP_002436473.1|  hypothetical protein SORBIDRAFT_10g003340          224   2e-68   Sorghum bicolor [broomcorn]
ref|XP_004235633.1|  PREDICTED: GDSL esterase/lipase APG-like           225   2e-68   Solanum lycopersicum
ref|XP_007024353.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    223   2e-68   
ref|XP_010925408.1|  PREDICTED: GDSL esterase/lipase APG                223   3e-68   Elaeis guineensis
gb|EYU21440.1|  hypothetical protein MIMGU_mgv1a009146mg                223   3e-68   Erythranthe guttata [common monkey flower]
gb|EYU21439.1|  hypothetical protein MIMGU_mgv1a009146mg                223   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_006298028.1|  hypothetical protein CARUB_v10014074mg             222   4e-68   Capsella rubella
gb|KHG15938.1|  GDSL esterase/lipase APG -like protein                  222   6e-68   Gossypium arboreum [tree cotton]
gb|KDP40834.1|  hypothetical protein JCGZ_24833                         222   6e-68   Jatropha curcas
ref|XP_010504217.1|  PREDICTED: GDSL esterase/lipase APG-like           222   6e-68   Camelina sativa [gold-of-pleasure]
ref|XP_004964566.1|  PREDICTED: GDSL esterase/lipase APG-like           222   8e-68   Setaria italica
ref|XP_010487495.1|  PREDICTED: GDSL esterase/lipase APG-like           222   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010465660.1|  PREDICTED: GDSL esterase/lipase APG                221   1e-67   Camelina sativa [gold-of-pleasure]
ref|NP_001136705.1|  hypothetical protein precursor                     221   1e-67   Zea mays [maize]
ref|XP_009388555.1|  PREDICTED: GDSL esterase/lipase APG-like           221   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56732.1|  hypothetical protein B456_009G138200                    218   1e-67   Gossypium raimondii
ref|XP_008654481.1|  PREDICTED: uncharacterized protein LOC100216...    223   2e-67   Zea mays [maize]
gb|KJB70369.1|  hypothetical protein B456_011G070000                    221   2e-67   Gossypium raimondii
gb|KJB70371.1|  hypothetical protein B456_011G070000                    221   2e-67   Gossypium raimondii
ref|XP_009146144.1|  PREDICTED: GDSL esterase/lipase APG                221   2e-67   Brassica rapa
ref|XP_011008871.1|  PREDICTED: GDSL esterase/lipase APG                220   2e-67   Populus euphratica
ref|NP_188258.1|  GDSL esterase/lipase                                  220   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447571.1|  PREDICTED: GDSL esterase/lipase APG-like           220   4e-67   Cucumis melo [Oriental melon]
gb|KJB70370.1|  hypothetical protein B456_011G070000                    221   5e-67   Gossypium raimondii
ref|XP_002883003.1|  GDSL-motif lipase/hydrolase family protein         219   6e-67   
ref|XP_002298249.2|  putative proline-rich protein APG isolog           219   6e-67   Populus trichocarpa [western balsam poplar]
gb|KJB56736.1|  hypothetical protein B456_009G138200                    218   8e-67   Gossypium raimondii
emb|CDY30167.1|  BnaC05g36950D                                          219   8e-67   Brassica napus [oilseed rape]
gb|KJB56734.1|  hypothetical protein B456_009G138200                    217   9e-67   Gossypium raimondii
ref|XP_008793255.1|  PREDICTED: GDSL esterase/lipase APG                218   2e-66   Phoenix dactylifera
gb|KHG07525.1|  GDSL esterase/lipase APG -like protein                  218   2e-66   Gossypium arboreum [tree cotton]
gb|KJB56735.1|  hypothetical protein B456_009G138200                    218   3e-66   Gossypium raimondii
gb|KJB56733.1|  hypothetical protein B456_009G138200                    218   4e-66   Gossypium raimondii
ref|XP_010545663.1|  PREDICTED: GDSL esterase/lipase APG                217   4e-66   Tarenaya hassleriana [spider flower]
ref|XP_004486795.1|  PREDICTED: GDSL esterase/lipase APG-like           216   9e-66   
emb|CAN65530.1|  hypothetical protein VITISV_039629                     216   1e-65   Vitis vinifera
ref|XP_004516916.1|  PREDICTED: GDSL esterase/lipase APG-like           216   2e-65   Cicer arietinum [garbanzo]
ref|XP_006426845.1|  hypothetical protein CICLE_v10025957mg             215   3e-65   Citrus clementina [clementine]
ref|XP_002277514.1|  PREDICTED: GDSL esterase/lipase APG                215   4e-65   Vitis vinifera
emb|CBI36031.3|  unnamed protein product                                215   4e-65   Vitis vinifera
ref|NP_001056808.1|  Os06g0148200                                       214   7e-65   
gb|EMS47165.1|  GDSL esterase/lipase APG                                214   1e-64   Triticum urartu
ref|XP_004149175.1|  PREDICTED: GDSL esterase/lipase APG-like           213   1e-64   
ref|XP_006655787.1|  PREDICTED: GDSL esterase/lipase APG-like           213   2e-64   Oryza brachyantha
gb|EPS71085.1|  hypothetical protein M569_03672                         211   4e-64   Genlisea aurea
gb|KJB56729.1|  hypothetical protein B456_009G138200                    212   4e-64   Gossypium raimondii
gb|AAB63641.1|  Proline-rich protein APG isolog                         210   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557194.1|  PREDICTED: GDSL esterase/lipase APG                211   1e-63   Brachypodium distachyon [annual false brome]
gb|KHN32662.1|  GDSL esterase/lipase APG                                207   4e-63   Glycine soja [wild soybean]
ref|XP_006465717.1|  PREDICTED: GDSL esterase/lipase APG-like iso...    208   2e-62   Citrus sinensis [apfelsine]
ref|XP_002515934.1|  zinc finger protein, putative                      205   2e-61   Ricinus communis
gb|KDO38512.1|  hypothetical protein CISIN_1g018227mg                   203   2e-61   Citrus sinensis [apfelsine]
gb|EMT10375.1|  GDSL esterase/lipase APG                                204   3e-61   
ref|XP_002313641.2|  GDSL-motif lipase family protein                   203   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_011044241.1|  PREDICTED: GDSL esterase/lipase At5g22810          202   2e-60   Populus euphratica
ref|XP_010242974.1|  PREDICTED: GDSL esterase/lipase At5g22810          201   5e-60   Nelumbo nucifera [Indian lotus]
ref|XP_006826756.1|  hypothetical protein AMTR_s00136p00069360          201   8e-60   
emb|CDO97958.1|  unnamed protein product                                200   3e-59   Coffea canephora [robusta coffee]
ref|XP_006369216.1|  hypothetical protein POPTR_0001s19240g             198   5e-59   
gb|KDP40835.1|  hypothetical protein JCGZ_24834                         199   7e-59   Jatropha curcas
ref|XP_002271400.1|  PREDICTED: GDSL esterase/lipase At5g22810          197   2e-58   Vitis vinifera
gb|KDO42514.1|  hypothetical protein CISIN_1g040658mg                   195   3e-58   Citrus sinensis [apfelsine]
ref|XP_006484945.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     196   1e-57   Citrus sinensis [apfelsine]
gb|KDP34349.1|  hypothetical protein JCGZ_11232                         196   1e-57   Jatropha curcas
ref|XP_006838752.1|  hypothetical protein AMTR_s00002p00255920          195   1e-57   Amborella trichopoda
ref|XP_010247794.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     194   2e-57   Nelumbo nucifera [Indian lotus]
ref|XP_009337386.1|  PREDICTED: GDSL esterase/lipase At5g22810          194   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_002527431.1|  zinc finger protein, putative                      194   3e-57   Ricinus communis
gb|KJB56728.1|  hypothetical protein B456_009G138200                    194   3e-57   Gossypium raimondii
ref|XP_011089987.1|  PREDICTED: GDSL esterase/lipase At5g22810          194   4e-57   
gb|KJB09007.1|  hypothetical protein B456_001G118700                    192   5e-57   Gossypium raimondii
ref|XP_008366379.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     193   7e-57   
ref|XP_009796088.1|  PREDICTED: GDSL esterase/lipase At5g22810          193   1e-56   Nicotiana sylvestris
ref|XP_007015991.1|  GDSL esterase/lipase isoform 1                     193   1e-56   Theobroma cacao [chocolate]
gb|KHG22657.1|  hypothetical protein F383_04802                         191   1e-56   Gossypium arboreum [tree cotton]
ref|XP_002436480.1|  hypothetical protein SORBIDRAFT_10g003420          192   2e-56   
gb|KJB09006.1|  hypothetical protein B456_001G118700                    192   2e-56   Gossypium raimondii
ref|XP_004964856.1|  PREDICTED: GDSL esterase/lipase APG-like           191   9e-56   Setaria italica
ref|XP_004295642.1|  PREDICTED: GDSL esterase/lipase At5g22810          190   1e-55   Fragaria vesca subsp. vesca
gb|KDO38511.1|  hypothetical protein CISIN_1g018227mg                   190   1e-55   Citrus sinensis [apfelsine]
ref|XP_010689974.1|  PREDICTED: GDSL esterase/lipase At5g22810          190   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006349065.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     190   1e-55   Solanum tuberosum [potatoes]
ref|XP_008226994.1|  PREDICTED: GDSL esterase/lipase At5g22810          189   2e-55   Prunus mume [ume]
ref|XP_003540212.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     189   2e-55   Glycine max [soybeans]
ref|XP_007132365.1|  hypothetical protein PHAVU_011G088700g             189   3e-55   Phaseolus vulgaris [French bean]
ref|XP_009625753.1|  PREDICTED: GDSL esterase/lipase At5g22810 is...    189   3e-55   Nicotiana tomentosiformis
ref|XP_003551088.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     189   3e-55   Glycine max [soybeans]
ref|XP_004251004.1|  PREDICTED: GDSL esterase/lipase At5g22810          189   3e-55   
gb|KHN21470.1|  GDSL esterase/lipase                                    189   4e-55   Glycine soja [wild soybean]
emb|CBI17099.3|  unnamed protein product                                197   4e-55   Vitis vinifera
gb|AFK42211.1|  unknown                                                 188   6e-55   Lotus japonicus
ref|XP_007150122.1|  hypothetical protein PHAVU_005G128600g             188   9e-55   Phaseolus vulgaris [French bean]
ref|XP_006424380.1|  hypothetical protein CICLE_v10027727mg             196   1e-54   
gb|KHN27690.1|  GDSL esterase/lipase                                    187   1e-54   Glycine soja [wild soybean]
ref|XP_002515937.1|  zinc finger protein, putative                      188   2e-54   Ricinus communis
ref|XP_009397028.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     186   3e-54   
ref|XP_002873116.1|  GDSL-motif lipase/hydrolase family protein         186   4e-54   
ref|XP_002872020.1|  predicted protein                                  185   7e-54   
ref|XP_004156262.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     185   1e-53   
ref|XP_004143292.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     185   1e-53   Cucumis sativus [cucumbers]
ref|XP_006482367.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     185   1e-53   Citrus sinensis [apfelsine]
ref|NP_197672.1|  GDSL esterase/lipase                                  184   1e-53   
ref|XP_010558217.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     185   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_009625752.1|  PREDICTED: GDSL esterase/lipase At5g22810 is...    184   2e-53   Nicotiana tomentosiformis
gb|KDO60993.1|  hypothetical protein CISIN_1g036829mg                   184   2e-53   Citrus sinensis [apfelsine]
sp|Q9FFC6.3|GDL78_ARATH  RecName: Full=GDSL esterase/lipase At5g2...    185   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006430343.1|  hypothetical protein CICLE_v10013829mg             184   2e-53   Citrus clementina [clementine]
gb|KFK27616.1|  hypothetical protein AALP_AA8G406700                    184   2e-53   Arabis alpina [alpine rockcress]
ref|XP_010098864.1|  GDSL esterase/lipase                               184   3e-53   Morus notabilis
ref|XP_010558978.1|  PREDICTED: GDSL esterase/lipase At3g53100          184   3e-53   Tarenaya hassleriana [spider flower]
ref|XP_010493379.1|  PREDICTED: GDSL esterase/lipase At5g22810          184   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008462518.1|  PREDICTED: GDSL esterase/lipase At5g03820          184   4e-53   
gb|KCW89297.1|  hypothetical protein EUGRSUZ_A01587                     183   4e-53   Eucalyptus grandis [rose gum]
ref|XP_007207052.1|  hypothetical protein PRUPE_ppa007967mg             183   7e-53   
ref|XP_010050200.1|  PREDICTED: GDSL esterase/lipase At5g03820          183   7e-53   Eucalyptus grandis [rose gum]
ref|XP_006289497.1|  hypothetical protein CARUB_v10003031mg             182   8e-53   
ref|XP_010045272.1|  PREDICTED: GDSL esterase/lipase At5g22810          183   1e-52   Eucalyptus grandis [rose gum]
ref|XP_009340968.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     182   1e-52   Pyrus x bretschneideri [bai li]
emb|CDY09169.1|  BnaA02g05950D                                          182   1e-52   Brassica napus [oilseed rape]
ref|XP_007027551.1|  GDSL-like Lipase/Acylhydrolase family protein      184   2e-52   
emb|CDY50286.1|  BnaC02g45410D                                          182   2e-52   Brassica napus [oilseed rape]
ref|XP_002284087.2|  PREDICTED: GDSL esterase/lipase At5g03820-like     182   2e-52   Vitis vinifera
ref|NP_196002.1|  GDSL esterase/lipase                                  181   3e-52   
ref|XP_004487544.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     181   3e-52   Cicer arietinum [garbanzo]
emb|CBI30208.3|  unnamed protein product                                182   3e-52   Vitis vinifera
ref|XP_004303055.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     181   4e-52   Fragaria vesca subsp. vesca
gb|KHG27777.1|  hypothetical protein F383_16365                         181   5e-52   Gossypium arboreum [tree cotton]
ref|XP_006400789.1|  hypothetical protein EUTSA_v10015700mg             180   5e-52   
gb|KEH38918.1|  GDSL-like lipase/acylhydrolase                          181   6e-52   Medicago truncatula
ref|XP_010495383.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     176   6e-52   
ref|XP_006338923.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     180   7e-52   Solanum tuberosum [potatoes]
ref|XP_006398840.1|  hypothetical protein EUTSA_v10013969mg             180   9e-52   
ref|XP_009126566.1|  PREDICTED: GDSL esterase/lipase At5g22810          180   1e-51   Brassica rapa
ref|XP_003561180.2|  PREDICTED: GDSL esterase/lipase APG-like           181   2e-51   
ref|XP_004155946.1|  PREDICTED: GDSL esterase/lipase APG-like           179   3e-51   
ref|XP_006286643.1|  hypothetical protein CARUB_v10002513mg             179   3e-51   Capsella rubella
gb|AFW83670.1|  hypothetical protein ZEAMMB73_889110                    174   3e-51   
ref|XP_010683957.1|  PREDICTED: GDSL esterase/lipase At5g03820          179   4e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004145774.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     178   5e-51   Cucumis sativus [cucumbers]
ref|XP_009780981.1|  PREDICTED: GDSL esterase/lipase At5g03820          174   7e-51   Nicotiana sylvestris
ref|XP_010933399.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     178   7e-51   Elaeis guineensis
ref|XP_009593509.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    177   7e-51   Nicotiana tomentosiformis
ref|XP_006366788.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     177   7e-51   Solanum tuberosum [potatoes]
ref|XP_004249641.1|  PREDICTED: GDSL esterase/lipase At5g03820          177   8e-51   Solanum lycopersicum
ref|XP_008458651.1|  PREDICTED: GDSL esterase/lipase At5g22810          177   9e-51   Cucumis melo [Oriental melon]
ref|XP_010923281.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     177   1e-50   Elaeis guineensis
ref|XP_011094449.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     177   1e-50   Sesamum indicum [beniseed]
ref|XP_009776666.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     176   2e-50   Nicotiana sylvestris
gb|EMT26145.1|  GDSL esterase/lipase APG                                176   2e-50   
ref|XP_002528628.1|  zinc finger protein, putative                      176   2e-50   Ricinus communis
ref|XP_004246904.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     176   3e-50   Solanum lycopersicum
ref|NP_001140661.1|  hypothetical protein precursor                     176   3e-50   Zea mays [maize]
ref|XP_006656639.1|  PREDICTED: GDSL esterase/lipase APG-like           176   3e-50   
ref|XP_010092821.1|  GDSL esterase/lipase                               174   5e-50   
gb|ACG42669.1|  hypothetical protein                                    175   9e-50   Zea mays [maize]
ref|XP_010100155.1|  GDSL esterase/lipase                               175   9e-50   Morus notabilis
ref|NP_196001.2|  GDSL esterase/lipase                                  174   1e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80889.1|  BnaC03g01430D                                          174   1e-49   
gb|KDP29224.1|  hypothetical protein JCGZ_16613                         174   2e-49   Jatropha curcas
ref|XP_003538180.1|  PREDICTED: GDSL esterase/lipase At5g22810          174   2e-49   Glycine max [soybeans]
gb|EMT28018.1|  GDSL esterase/lipase APG                                171   2e-49   
ref|XP_010490874.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     174   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009125521.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     175   2e-49   Brassica rapa
ref|XP_009130784.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    174   2e-49   Brassica rapa
ref|XP_009130783.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    174   2e-49   Brassica rapa
gb|EMS52953.1|  GDSL esterase/lipase APG                                174   3e-49   Triticum urartu
ref|XP_011101470.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     173   3e-49   Sesamum indicum [beniseed]
ref|XP_003561182.1|  PREDICTED: GDSL esterase/lipase APG-like           174   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_009589481.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     173   3e-49   
ref|XP_009389038.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    174   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB16733.1|  hypothetical protein B456_002G245100                    172   4e-49   Gossypium raimondii
ref|XP_008794047.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     173   4e-49   Phoenix dactylifera
ref|XP_011018853.1|  PREDICTED: GDSL esterase/lipase At5g03820          173   4e-49   Populus euphratica
ref|XP_009389037.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    174   5e-49   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY04898.1|  BnaAnng00800D                                          172   7e-49   
emb|CDY11271.1|  BnaA03g01070D                                          173   8e-49   Brassica napus [oilseed rape]
gb|KJB16732.1|  hypothetical protein B456_002G245100                    172   9e-49   Gossypium raimondii
gb|KHN38683.1|  GDSL esterase/lipase                                    171   1e-48   Glycine soja [wild soybean]
ref|XP_010452277.1|  PREDICTED: GDSL esterase/lipase At5g03820          172   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006381340.1|  hypothetical protein POPTR_0006s11970g             172   1e-48   Populus trichocarpa [western balsam poplar]
emb|CDP15327.1|  unnamed protein product                                172   1e-48   Coffea canephora [robusta coffee]
ref|XP_008387479.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     172   1e-48   
ref|XP_010493512.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     171   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008462404.1|  PREDICTED: GDSL esterase/lipase APG isoform X5     171   2e-47   
dbj|BAJ89672.1|  predicted protein                                      169   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP14394.1|  unnamed protein product                                168   3e-47   Coffea canephora [robusta coffee]
emb|CDP17381.1|  unnamed protein product                                166   1e-46   Coffea canephora [robusta coffee]
ref|XP_006403725.1|  hypothetical protein EUTSA_v10010500mg             166   3e-46   
gb|ABK21582.1|  unknown                                                 165   5e-46   Picea sitchensis
gb|ABZ85654.1|  truncated At5g03810                                     159   6e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CAB85501.1|  putative protein                                       164   8e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382055.1|  hypothetical protein POPTR_0006s256601g            157   9e-46   
ref|XP_004982165.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    164   1e-45   Setaria italica
ref|XP_006650413.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     164   1e-45   Oryza brachyantha
gb|EYU41566.1|  hypothetical protein MIMGU_mgv1a008897mg                164   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_002466664.1|  hypothetical protein SORBIDRAFT_01g011850          164   2e-45   Sorghum bicolor [broomcorn]
ref|XP_004141668.1|  PREDICTED: GDSL esterase/lipase APG-like           164   2e-45   Cucumis sativus [cucumbers]
ref|XP_004506128.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     163   3e-45   Cicer arietinum [garbanzo]
ref|XP_008462399.1|  PREDICTED: probable LRR receptor-like serine...    170   3e-45   
ref|XP_008462402.1|  PREDICTED: probable LRR receptor-like serine...    170   3e-45   
ref|XP_008462401.1|  PREDICTED: probable LRR receptor-like serine...    170   3e-45   
ref|XP_008462403.1|  PREDICTED: probable LRR receptor-like serine...    170   3e-45   Cucumis melo [Oriental melon]
gb|KJB26682.1|  hypothetical protein B456_004G254700                    163   3e-45   Gossypium raimondii
ref|XP_009139436.1|  PREDICTED: GDSL esterase/lipase At3g53100 is...    162   1e-44   Brassica rapa
gb|EMT10908.1|  GDSL esterase/lipase                                    162   1e-44   
emb|CDX76226.1|  BnaA04g04900D                                          161   1e-44   
ref|XP_004982164.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    163   2e-44   
ref|NP_001241778.1|  anther-specific proline-rich protein APG pre...    161   2e-44   
gb|ABZ85648.1|  At5g03810                                               158   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ85655.1|  At5g03810                                               158   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109948.1|  GDSL esterase/lipase                               160   3e-44   Morus notabilis
emb|CDX95394.1|  BnaC04g27640D                                          160   4e-44   
gb|ABZ85657.1|  At5g03810                                               157   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515794.1|  PREDICTED: GDSL esterase/lipase At3g53100-li...    156   4e-44   Camelina sativa [gold-of-pleasure]
ref|NP_001142139.1|  uncharacterized protein LOC100274304 precursor     160   6e-44   Zea mays [maize]
gb|ABZ85649.1|  At5g03810                                               157   7e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007015992.1|  GDSL esterase/lipase isoform 2                     157   9e-44   
ref|XP_002877901.1|  GDSL-motif lipase/hydrolase family protein         158   2e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_006291405.1|  hypothetical protein CARUB_v10017544mg             158   2e-43   Capsella rubella
ref|XP_006852535.1|  hypothetical protein AMTR_s00021p00183530          156   3e-43   
ref|XP_010515793.1|  PREDICTED: GDSL esterase/lipase At3g53100-li...    156   5e-43   Camelina sativa [gold-of-pleasure]
gb|KEH29406.1|  GDSL-like lipase/acylhydrolase                          153   5e-43   Medicago truncatula
gb|ABK26273.1|  unknown                                                 157   5e-43   Picea sitchensis
gb|KFK34547.1|  hypothetical protein AALP_AA5G160400                    157   8e-43   Arabis alpina [alpine rockcress]
gb|KEH29917.1|  GDSL-like lipase/acylhydrolase                          156   1e-42   Medicago truncatula
ref|XP_010426939.1|  PREDICTED: GDSL esterase/lipase At3g53100-like     155   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_003561212.2|  PREDICTED: GDSL esterase/lipase At5g03810-like     154   8e-42   Brachypodium distachyon [annual false brome]
emb|CAB64213.1|  putative protein                                       152   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190878.2|  GDSL esterase/lipase                                  152   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139435.1|  PREDICTED: GDSL esterase/lipase At3g53100 is...    152   5e-41   Brassica rapa
ref|XP_004506129.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     152   5e-41   Cicer arietinum [garbanzo]
emb|CDY55498.1|  BnaA05g34360D                                          151   7e-41   
ref|XP_009385218.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     151   7e-41   
ref|XP_004499293.1|  PREDICTED: GDSL esterase/lipase EXL3-like          151   9e-41   
ref|XP_010052242.1|  PREDICTED: GDSL esterase/lipase At5g45950          151   1e-40   
ref|XP_009142896.1|  PREDICTED: GDSL esterase/lipase At2g42990          150   1e-40   
emb|CDY53653.1|  BnaC04g52870D                                          150   2e-40   
gb|KEH29925.1|  GDSL-like lipase/acylhydrolase                          150   2e-40   
ref|XP_006298032.1|  hypothetical protein CARUB_v10014077mg             150   3e-40   
gb|AFK46089.1|  unknown                                                 147   4e-40   
ref|XP_003528475.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     150   4e-40   
ref|XP_010100153.1|  GDSL esterase/lipase                               145   6e-40   
ref|XP_004488333.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     149   6e-40   
ref|XP_009796437.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     149   7e-40   
ref|XP_004305968.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     149   8e-40   
ref|XP_009589386.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     149   9e-40   
ref|XP_009398920.1|  PREDICTED: GDSL esterase/lipase EXL3-like          149   1e-39   
ref|XP_006411572.1|  hypothetical protein EUTSA_v10016869mg             148   1e-39   
ref|XP_010517851.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     148   2e-39   
ref|XP_003545614.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     147   2e-39   
ref|XP_006357972.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     147   2e-39   
ref|XP_010488704.1|  PREDICTED: GDSL esterase/lipase At2g04570          147   3e-39   
ref|XP_010494752.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    144   3e-39   
gb|ABK26503.1|  unknown                                                 147   3e-39   
emb|CDP05715.1|  unnamed protein product                                147   4e-39   
ref|XP_010252591.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    146   4e-39   
ref|XP_010467017.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     147   4e-39   
gb|KFK37141.1|  hypothetical protein AALP_AA4G218400                    147   5e-39   
gb|KFK31786.1|  hypothetical protein AALP_AA6G158100                    146   6e-39   
ref|XP_003589534.1|  GDSL esterase/lipase                               147   6e-39   
ref|XP_010508487.1|  PREDICTED: GDSL esterase/lipase At2g42990          146   6e-39   
ref|NP_001239864.1|  uncharacterized protein LOC100809260 precursor     146   7e-39   
ref|XP_009395858.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     146   7e-39   
ref|XP_010111929.1|  GDSL esterase/lipase                               143   8e-39   
gb|AAM65485.1|  putative GDSL-motif lipase/hydrolase                    146   8e-39   
ref|XP_010518560.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     146   8e-39   
ref|XP_010252590.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    146   8e-39   
ref|XP_010943280.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     145   8e-39   
ref|XP_009793062.1|  PREDICTED: GDSL esterase/lipase At5g45950 is...    146   9e-39   
ref|XP_003601542.1|  GDSL esterase/lipase                               146   1e-38   
ref|XP_006293493.1|  hypothetical protein CARUB_v10023509mg             146   1e-38   
ref|XP_002883649.1|  GDSL-motif lipase/hydrolase family protein         146   1e-38   
ref|XP_010532997.1|  PREDICTED: GDSL esterase/lipase At2g04570          145   1e-38   
ref|XP_010524116.1|  PREDICTED: GDSL esterase/lipase At2g42990          145   1e-38   
ref|XP_009615525.1|  PREDICTED: GDSL esterase/lipase At5g45950          145   1e-38   
ref|XP_008799468.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     145   2e-38   
ref|XP_009776386.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    142   2e-38   
gb|KHG19996.1|  hypothetical protein F383_02890                         145   2e-38   
gb|KJB57454.1|  hypothetical protein B456_009G165200                    145   2e-38   
ref|XP_004243510.2|  PREDICTED: GDSL esterase/lipase At2g42990-like     145   2e-38   
ref|XP_007215624.1|  hypothetical protein PRUPE_ppa007979mg             145   3e-38   
ref|NP_178536.1|  GDSL esterase/lipase                                  145   3e-38   
ref|XP_004240155.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     145   3e-38   
dbj|BAD43087.1|  putative GDSL-motif lipase/hydrolase                   144   3e-38   
ref|XP_001775976.1|  predicted protein                                  145   3e-38   
ref|XP_007049207.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    144   3e-38   
ref|XP_002880015.1|  GDSL-motif lipase/hydrolase family protein         144   3e-38   
ref|XP_006377451.1|  GDSL-motif lipase/hydrolase family protein         145   4e-38   
ref|XP_009784175.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     141   4e-38   
ref|XP_009804685.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     144   4e-38   
ref|XP_004243509.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     144   5e-38   
ref|NP_181827.2|  GDSL esterase/lipase                                  144   5e-38   
gb|KCW88729.1|  hypothetical protein EUGRSUZ_A01084                     143   5e-38   
gb|KDP30830.1|  hypothetical protein JCGZ_13773                         144   5e-38   
gb|KJB19562.1|  hypothetical protein B456_003G108700                    143   5e-38   
gb|KHG15434.1|  hypothetical protein F383_19515                         144   6e-38   
ref|XP_009606234.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     144   6e-38   
ref|XP_006342261.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     144   6e-38   
ref|XP_008229570.1|  PREDICTED: GDSL esterase/lipase At2g42990          144   6e-38   
gb|KHG24677.1|  hypothetical protein F383_10020                         144   7e-38   
ref|XP_010279185.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     144   8e-38   
ref|XP_006602262.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    143   8e-38   
gb|EPS67060.1|  hypothetical protein M569_07715                         143   9e-38   
ref|XP_004505116.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     144   9e-38   
ref|XP_006602261.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    143   9e-38   
ref|XP_010067942.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     143   9e-38   
ref|XP_006852534.1|  hypothetical protein AMTR_s00021p00182700          143   1e-37   
ref|XP_011096387.1|  PREDICTED: GDSL esterase/lipase At5g45950          143   1e-37   
ref|XP_004305967.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     143   1e-37   
ref|XP_010494751.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    143   1e-37   
ref|XP_009136143.1|  PREDICTED: GDSL esterase/lipase At2g04570          143   1e-37   
ref|XP_007160639.1|  hypothetical protein PHAVU_001G004300g             143   1e-37   
ref|XP_003616833.1|  GDSL esterase/lipase                               143   1e-37   
gb|KJB10712.1|  hypothetical protein B456_001G217800                    143   1e-37   
ref|XP_003551930.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    143   1e-37   
gb|KHN12627.1|  GDSL esterase/lipase EXL3                               142   2e-37   
ref|XP_006357973.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     142   2e-37   
ref|XP_010110233.1|  GDSL esterase/lipase                               143   2e-37   
gb|EMT17148.1|  GDSL esterase/lipase                                    140   2e-37   
gb|KHN39410.1|  GDSL esterase/lipase EXL3                               142   2e-37   
ref|XP_007049209.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    144   2e-37   
gb|KJB19560.1|  hypothetical protein B456_003G108700                    143   2e-37   
gb|KHG19347.1|  hypothetical protein F383_26236                         142   2e-37   
ref|XP_003545022.1|  PREDICTED: GDSL esterase/lipase EXL3               142   2e-37   
emb|CDY15057.1|  BnaC03g44180D                                          142   2e-37   
gb|ACU19367.1|  unknown                                                 142   2e-37   
ref|XP_003550433.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    142   2e-37   
ref|XP_009392112.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     142   2e-37   
gb|EEC80013.1|  hypothetical protein OsI_21681                          142   2e-37   
gb|KDP39193.1|  hypothetical protein JCGZ_00950                         142   2e-37   
gb|KJB10713.1|  hypothetical protein B456_001G218000                    142   2e-37   
ref|XP_008807138.1|  PREDICTED: GDSL esterase/lipase EXL3               142   3e-37   
gb|KHG24676.1|  hypothetical protein F383_10019                         142   3e-37   
ref|XP_004305842.1|  PREDICTED: GDSL esterase/lipase At2g42990          142   3e-37   
ref|XP_010101540.1|  GDSL esterase/lipase                               142   3e-37   
ref|XP_007141675.1|  hypothetical protein PHAVU_008G215600g             142   3e-37   
ref|XP_009408725.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     142   3e-37   
ref|XP_004140129.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     142   4e-37   
gb|KJB57456.1|  hypothetical protein B456_009G165300                    142   4e-37   
ref|XP_004502157.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     142   4e-37   
ref|XP_009802938.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     142   4e-37   
ref|XP_007017007.1|  GDSL-like Lipase/Acylhydrolase family protei...    144   4e-37   
gb|KJB76243.1|  hypothetical protein B456_012G079700                    142   4e-37   
ref|XP_008449490.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     141   4e-37   
ref|XP_010473948.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     138   4e-37   
ref|XP_007048967.1|  GDSL Lipase/Acylhydrolase superfamily protein      140   5e-37   
ref|XP_002277279.1|  PREDICTED: GDSL esterase/lipase At5g45950          142   5e-37   
gb|KHN47206.1|  GDSL esterase/lipase                                    142   5e-37   
ref|XP_009618392.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    140   5e-37   
gb|EAY91425.1|  hypothetical protein OsI_13052                          141   5e-37   
gb|KJB42834.1|  hypothetical protein B456_007G169400                    140   6e-37   
ref|NP_001050914.1|  Os03g0683800                                       141   6e-37   
ref|XP_009620415.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     141   6e-37   
ref|XP_006418560.1|  hypothetical protein EUTSA_v10002592mg             141   6e-37   
gb|EAZ28161.1|  hypothetical protein OsJ_12134                          141   6e-37   
ref|XP_010686363.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    141   6e-37   
ref|XP_003542710.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     141   6e-37   
ref|XP_009776385.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    140   6e-37   
ref|XP_002301596.1|  GDSL-motif lipase/hydrolase family protein         141   6e-37   
ref|XP_010441648.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     141   7e-37   
ref|XP_002528958.1|  zinc finger protein, putative                      141   7e-37   
ref|XP_002305097.1|  GDSL-motif lipase/hydrolase family protein         141   7e-37   
ref|XP_011080712.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     141   8e-37   
ref|XP_009618391.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    141   9e-37   
ref|XP_010928403.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     140   9e-37   
ref|XP_008229820.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     140   9e-37   
ref|XP_011086020.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     141   1e-36   
emb|CDO96723.1|  unnamed protein product                                141   1e-36   
ref|XP_009776384.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    140   1e-36   
ref|XP_006342286.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     140   1e-36   
gb|KJB42833.1|  hypothetical protein B456_007G169400                    140   1e-36   
ref|XP_002321156.2|  hypothetical protein POPTR_0014s15840g             139   1e-36   
ref|XP_011003480.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     140   1e-36   
ref|XP_009776383.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    140   1e-36   
gb|EEE65090.1|  hypothetical protein OsJ_20133                          140   1e-36   
gb|ABK25847.1|  unknown                                                 140   1e-36   
ref|XP_011085484.1|  PREDICTED: GDSL esterase/lipase At2g04570          140   1e-36   
ref|XP_004499972.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     140   1e-36   
emb|CAN59818.1|  hypothetical protein VITISV_020322                     140   1e-36   
ref|XP_002528324.1|  zinc finger protein, putative                      140   1e-36   
ref|XP_009356602.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     140   1e-36   
ref|XP_002277615.2|  PREDICTED: GDSL esterase/lipase At1g58430          140   2e-36   
ref|XP_006361071.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     140   2e-36   
ref|XP_009365141.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    139   2e-36   
ref|XP_010933356.1|  PREDICTED: GDSL esterase/lipase EXL3-like          140   2e-36   
ref|XP_004240156.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     140   2e-36   
ref|XP_010511070.1|  PREDICTED: GDSL esterase/lipase At1g58430          140   2e-36   
ref|XP_003616835.1|  GDSL esterase/lipase                               140   2e-36   
ref|XP_007146228.1|  hypothetical protein PHAVU_006G0230001g            138   3e-36   
ref|XP_009365140.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    139   3e-36   
gb|KEH30938.1|  GDSL-like lipase/acylhydrolase                          140   3e-36   
ref|XP_008806091.1|  PREDICTED: GDSL esterase/lipase At4g26790          139   3e-36   
ref|XP_010539839.1|  PREDICTED: GDSL esterase/lipase EXL3-like          140   3e-36   
ref|XP_007148085.1|  hypothetical protein PHAVU_006G179500g             139   3e-36   
gb|AFK45979.1|  unknown                                                 139   3e-36   
ref|XP_006342238.1|  PREDICTED: uncharacterized protein LOC102603803    143   3e-36   
ref|XP_002459883.1|  hypothetical protein SORBIDRAFT_02g012990          139   3e-36   
gb|KHG13393.1|  hypothetical protein F383_18050                         139   4e-36   
ref|XP_004491083.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     139   4e-36   
ref|XP_008379703.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    138   4e-36   
ref|XP_006367195.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     139   4e-36   
dbj|BAG87330.1|  unnamed protein product                                137   4e-36   
ref|XP_008357836.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     139   4e-36   
ref|XP_009400370.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     139   4e-36   
gb|KHM99646.1|  GDSL esterase/lipase                                    139   5e-36   
ref|XP_010943227.1|  PREDICTED: GDSL esterase/lipase At4g26790          139   5e-36   
ref|XP_007215622.1|  hypothetical protein PRUPE_ppa007953mg             139   5e-36   
gb|KHN18936.1|  GDSL esterase/lipase                                    138   5e-36   
ref|XP_008379702.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    139   6e-36   
ref|XP_009784878.1|  PREDICTED: GDSL esterase/lipase At1g58430-like     139   6e-36   
ref|XP_011027739.1|  PREDICTED: GDSL esterase/lipase At5g45950          139   6e-36   
ref|XP_004491082.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     139   6e-36   
ref|XP_006377450.1|  hypothetical protein POPTR_0011s06030g             139   7e-36   
ref|NP_001242159.1|  uncharacterized protein LOC100812614 precursor     138   7e-36   
gb|KJB10613.1|  hypothetical protein B456_001G211300                    138   7e-36   
ref|XP_009600532.1|  PREDICTED: GDSL esterase/lipase At2g30220-like     138   7e-36   
ref|XP_002276681.1|  PREDICTED: GDSL esterase/lipase At2g04570          138   7e-36   
gb|EYU27381.1|  hypothetical protein MIMGU_mgv1a025165mg                138   7e-36   
ref|XP_009783679.1|  PREDICTED: GDSL esterase/lipase At2g30220-like     138   8e-36   
ref|XP_008449488.1|  PREDICTED: GDSL esterase/lipase At2g04570          138   8e-36   
ref|XP_002879261.1|  GDSL-motif lipase/hydrolase family protein         138   8e-36   
gb|EYU28037.1|  hypothetical protein MIMGU_mgv1a008421mg                139   8e-36   
ref|XP_011021005.1|  PREDICTED: GDSL esterase/lipase At2g31550-like     139   8e-36   
ref|XP_006484904.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     138   1e-35   
gb|KHG24596.1|  GDSL esterase/lipase EXL3 -like protein                 138   1e-35   
ref|XP_002964035.1|  hypothetical protein SELMODRAFT_438768             138   1e-35   
ref|XP_007153690.1|  hypothetical protein PHAVU_003G056700g             138   1e-35   
ref|XP_007153177.1|  hypothetical protein PHAVU_003G013500g             138   1e-35   
ref|XP_002306752.2|  GDSL-motif lipase/hydrolase family protein         138   1e-35   
ref|XP_006437131.1|  hypothetical protein CICLE_v10031968mg             138   1e-35   
gb|KDO51878.1|  hypothetical protein CISIN_1g018844mg                   137   1e-35   
ref|XP_009600712.1|  PREDICTED: GDSL esterase/lipase At2g24560-like     138   1e-35   
gb|EPS60516.1|  hypothetical protein M569_14287                         134   1e-35   
gb|ACN40345.1|  unknown                                                 138   1e-35   
ref|XP_010320539.1|  PREDICTED: GDSL esterase/lipase EXL3-like          140   1e-35   
ref|XP_010052243.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    138   1e-35   
ref|XP_009793232.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     138   1e-35   
ref|XP_011045879.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    138   1e-35   
ref|XP_004248462.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     138   1e-35   
ref|XP_010920106.1|  PREDICTED: GDSL esterase/lipase EXL3-like          138   1e-35   
ref|XP_004134939.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     138   1e-35   
ref|XP_010529179.1|  PREDICTED: GDSL esterase/lipase At5g45960 is...    138   1e-35   
gb|ACG41936.1|  hypothetical protein                                    138   1e-35   
gb|KJB63492.1|  hypothetical protein B456_010G002300                    138   1e-35   
ref|XP_002531196.1|  zinc finger protein, putative                      140   1e-35   
ref|NP_001062626.1|  Os09g0132200                                       137   1e-35   
ref|XP_007141674.1|  hypothetical protein PHAVU_008G215500g             137   1e-35   
ref|NP_001130165.1|  uncharacterized protein LOC100191259 precursor     138   1e-35   
ref|XP_011003477.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     137   2e-35   
ref|XP_011083479.1|  PREDICTED: uncharacterized protein LOC105166004    141   2e-35   
ref|XP_011100466.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     137   2e-35   
gb|KDP21040.1|  hypothetical protein JCGZ_21511                         137   2e-35   



>ref|XP_010690130.1| PREDICTED: GDSL esterase/lipase APG-like [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   244 bits (624),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVPAII FGDS+VDVGNN+YV T+FKADYPPYGRDFA+H+PTGRFCNGKLATDITADT
Sbjct  26   QSLVPAIITFGDSTVDVGNNDYVATLFKADYPPYGRDFANHKPTGRFCNGKLATDITADT  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLSPQA+G+NLLIGANFASAASGYD+KTALLS+AI LSQQ+EYYKEYQGKL
Sbjct  86   LGFTSYPPAYLSPQASGQNLLIGANFASAASGYDDKTALLSHAISLSQQLEYYKEYQGKL  145

Query  461  AGVAGSKKAASIIKDALYI  517
              VAGS KA SIIKDALYI
Sbjct  146  TKVAGSSKAKSIIKDALYI  164



>dbj|BAM08277.1| zinc finger protein [Malus domestica]
Length=358

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  44   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  223
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  11   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  70

Query  224  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  403
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L+
Sbjct  71   QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  130

Query  404  NAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYI  517
            +AIPLSQQ++YYKEYQ KLA VAGSKKAASIIKDALY+
Sbjct  131  HAIPLSQQLQYYKEYQTKLAKVAGSKKAASIIKDALYL  168



>ref|XP_009344493.1| PREDICTED: GDSL esterase/lipase APG-like [Pyrus x bretschneideri]
Length=358

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  44   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  223
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  11   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  70

Query  224  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  403
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L+
Sbjct  71   QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  130

Query  404  NAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYI  517
            +AIPLSQQ++YYKEYQ KLA VAGSKKAASIIKDALY+
Sbjct  131  HAIPLSQQLQYYKEYQKKLAKVAGSKKAASIIKDALYL  168



>ref|XP_008380836.1| PREDICTED: GDSL esterase/lipase APG-like [Malus domestica]
Length=388

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  44   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  223
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  41   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  100

Query  224  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  403
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L+
Sbjct  101  QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  160

Query  404  NAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYI  517
            +AIPLSQQ++YYKEYQ KLA VAGSKKAASIIKDALY+
Sbjct  161  HAIPLSQQLQYYKEYQTKLAKVAGSKKAASIIKDALYL  198



>ref|XP_008358081.1| PREDICTED: GDSL esterase/lipase APG-like [Malus domestica]
Length=388

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  44   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  223
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  41   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  100

Query  224  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  403
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L+
Sbjct  101  QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  160

Query  404  NAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYI  517
            +AIPLSQQ++YYKEYQ KLA VAGSKKAASIIKDALY+
Sbjct  161  HAIPLSQQLQYYKEYQTKLAKVAGSKKAASIIKDALYL  198



>ref|XP_008375835.1| PREDICTED: GDSL esterase/lipase APG-like [Malus domestica]
Length=357

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  32   MGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRD  211
            +   FG VL   FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKADYPPYGRD
Sbjct  6    LSAAFGLVLVFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKADYPPYGRD  65

Query  212  FASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKT  391
            F +HQPTGRFCNGKLATDITADTLGFS+YP AYLSPQA+GKNLLIGANFASAASGYD+K 
Sbjct  66   FVNHQPTGRFCNGKLATDITADTLGFSTYPPAYLSPQASGKNLLIGANFASAASGYDDKA  125

Query  392  ALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYI  517
            A LS+AIPLSQQ++YYKEYQ KLA VAGS KAASIIKDALY+
Sbjct  126  ATLSHAIPLSQQLQYYKEYQTKLAKVAGSMKAASIIKDALYL  167



>ref|XP_008228396.1| PREDICTED: GDSL esterase/lipase APG [Prunus mume]
Length=360

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITADTLG
Sbjct  34   LVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVNHQPTGRFCNGKLATDITADTLG  93

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L++AIPLSQQ++Y++EYQGKLA 
Sbjct  94   FTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLNHAIPLSQQLQYFREYQGKLAK  153

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASI+KDALY+
Sbjct  154  VAGSKKAASIVKDALYL  170



>ref|XP_010654595.1| PREDICTED: GDSL esterase/lipase APG-like [Vitis vinifera]
 emb|CAN65529.1| hypothetical protein VITISV_039628 [Vitis vinifera]
 emb|CBI36030.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITADTLG
Sbjct  30   LVPAIITFGDSAVDVGNNDYLLTIFKANYPPYGRDFINHQPTGRFCNGKLATDITADTLG  89

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +YP AYLSP+A+GKNLLIGANFASA SGYD+KTA+LS+AIPLSQQ+EYYKEYQ KLA 
Sbjct  90   FKTYPPAYLSPKASGKNLLIGANFASAGSGYDDKTAILSHAIPLSQQLEYYKEYQAKLAK  149

Query  467  VAGSKKAASIIKDALYI  517
            VAGS+KAA+IIKDALY+
Sbjct  150  VAGSQKAATIIKDALYV  166



>ref|XP_009337919.1| PREDICTED: GDSL esterase/lipase APG-like [Pyrus x bretschneideri]
Length=357

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  32   MGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRD  211
            +   FG VLA  FV        +  LVPAI+ FGDS+VDVGNNN++ TIFKADYPPYGRD
Sbjct  6    LSAAFGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNNFLPTIFKADYPPYGRD  65

Query  212  FASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKT  391
            F +HQPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYD+K 
Sbjct  66   FVNHQPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDDKA  125

Query  392  ALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYI  517
            A LS+AIPLSQQ+ YYKEYQ KLA VAGS KAASIIKDALY+
Sbjct  126  ATLSHAIPLSQQLHYYKEYQTKLATVAGSMKAASIIKDALYL  167



>ref|XP_007215590.1| hypothetical protein PRUPE_ppa007650mg [Prunus persica]
 gb|EMJ16789.1| hypothetical protein PRUPE_ppa007650mg [Prunus persica]
Length=360

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITADTLG
Sbjct  34   LVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVNHQPTGRFCNGKLATDITADTLG  93

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSPQA+G NLLIGANFASAASGYDEK A L++AIPLSQQ++Y++EYQGKLA 
Sbjct  94   FTTYPPAYLSPQASGNNLLIGANFASAASGYDEKAATLNHAIPLSQQLQYFREYQGKLAE  153

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKDALY+
Sbjct  154  VAGSKKAASIIKDALYL  170



>gb|KHN39266.1| GDSL esterase/lipase APG [Glycine soja]
Length=353

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDFA+HQPTGRFCNGKLATD TADTLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFANHQPTGRFCNGKLATDFTADTLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +Y  AYLSPQA+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  87   FKTYAPAYLSPQASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  146

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKDALY+
Sbjct  147  VAGSKKAASIIKDALYV  163



>ref|NP_001242561.1| uncharacterized protein LOC100815273 precursor [Glycine max]
 gb|ACU20309.1| unknown [Glycine max]
Length=353

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDFA+HQPTGRFCNGKLATD TADTLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFANHQPTGRFCNGKLATDFTADTLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +Y  AYLSPQA+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  87   FKTYAPAYLSPQASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  146

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKDALY+
Sbjct  147  VAGSKKAASIIKDALYV  163



>ref|XP_009343018.1| PREDICTED: GDSL esterase/lipase APG-like [Pyrus x bretschneideri]
Length=357

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  44   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  223
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNNN++ TIFKA+YPPYGRDF +H
Sbjct  10   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNNFLPTIFKANYPPYGRDFVNH  69

Query  224  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  403
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLL+GANFASAASGYD+K A LS
Sbjct  70   QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLMGANFASAASGYDDKAATLS  129

Query  404  NAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYI  517
            +AIPLSQQ+ YYKEYQ KLA VAGS KAASIIKDALY+
Sbjct  130  HAIPLSQQLHYYKEYQTKLATVAGSTKAASIIKDALYL  167



>ref|XP_011072453.1| PREDICTED: GDSL esterase/lipase APG [Sesamum indicum]
Length=350

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 137/171 (80%), Gaps = 14/171 (8%)
 Frame = +2

Query  5    IISHTIS*KMGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFK  184
            ++++T++  + C FG                   LVPAII FGDS VDVGNN+Y+HTIFK
Sbjct  4    VLAYTLAVALFCSFGNAQVT--------------LVPAIITFGDSVVDVGNNDYIHTIFK  49

Query  185  ADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFAS  364
            A+YPPYGRDF + + TGRFCNGKLATDITA+ LGF+SYP AYLSPQA+GKNLL+G+NFAS
Sbjct  50   ANYPPYGRDFKNQEATGRFCNGKLATDITAENLGFTSYPPAYLSPQASGKNLLLGSNFAS  109

Query  365  AASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYI  517
            A +GYDE T+LLS+ IPLSQQ+EYYKEYQGKLA VAGSKKAASIIKDALY+
Sbjct  110  AGAGYDEHTSLLSHVIPLSQQLEYYKEYQGKLAKVAGSKKAASIIKDALYL  160



>gb|ACJ84797.1| unknown [Medicago truncatula]
 gb|AFK43797.1| unknown [Medicago truncatula]
Length=236

 Score =   231 bits (588),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATD TA+TLG
Sbjct  29   LVPAIMTFGDSAVDVGNNDYLPTLFKANYPPYGRDFTNKQPTGRFCNGKLATDFTAETLG  88

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+S+  AYLSPQA+GKNLL+GANFASAASGYDEK A L++AIPLSQQ+EY+KEYQGKLA 
Sbjct  89   FTSFAPAYLSPQASGKNLLLGANFASAASGYDEKAATLNHAIPLSQQLEYFKEYQGKLAQ  148

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKD+LY+
Sbjct  149  VAGSKKAASIIKDSLYV  165



>ref|XP_009759976.1| PREDICTED: GDSL esterase/lipase APG [Nicotiana sylvestris]
Length=354

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVNRQPTGRFCNGKLATDITADTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSPQA+GKNLLIG NFASAA+GYD+KTA+L++AIPLS Q++YYKEYQ KL  
Sbjct  88   FTTYPPAYLSPQASGKNLLIGTNFASAAAGYDDKTAVLNHAIPLSIQMQYYKEYQAKLTK  147

Query  467  VAGSKKAASIIKDALYI  517
            VAGS+KAASI+KDALYI
Sbjct  148  VAGSQKAASILKDALYI  164



>ref|XP_009612468.1| PREDICTED: GDSL esterase/lipase APG [Nicotiana tomentosiformis]
Length=354

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVNRQPTGRFCNGKLATDITADTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSPQA+GKNLLIG NFASAA+GYD+KTA+L++AIPLS Q++YYKEYQ KL  
Sbjct  88   FTTYPSAYLSPQASGKNLLIGTNFASAAAGYDDKTAILNHAIPLSIQMQYYKEYQAKLTK  147

Query  467  VAGSKKAASIIKDALYI  517
            VAGS+KAASI+KDALY+
Sbjct  148  VAGSQKAASILKDALYL  164



>gb|KDO38517.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=219

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  464  GVAGSKKAASIIKDALYI  517
             VAGSK++ASIIKDA+YI
Sbjct  153  KVAGSKQSASIIKDAIYI  170



>ref|XP_010267093.1| PREDICTED: GDSL esterase/lipase APG-like [Nelumbo nucifera]
Length=354

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKADYPPYGRDF +H+ TGRFCNGKLATDITA+TLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLATIFKADYPPYGRDFVNHEATGRFCNGKLATDITAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            FS+YP AYLSP+A+GKNLLIGANFASA SGYD+KT+LLS+AIPLSQQ+EYYKEYQGKLA 
Sbjct  88   FSTYPPAYLSPKASGKNLLIGANFASAGSGYDDKTSLLSHAIPLSQQLEYYKEYQGKLAE  147

Query  467  VAGSKKAASIIKDALYI  517
            VAG+ KA SI+KD+LYI
Sbjct  148  VAGNSKATSILKDSLYI  164



>gb|KDO38518.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=220

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  464  GVAGSKKAASIIKDALYI  517
             VAGSK++ASIIKDA+YI
Sbjct  153  KVAGSKQSASIIKDAIYI  170



>ref|XP_006343026.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum tuberosum]
Length=359

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  33   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVTRQPTGRFCNGKLATDITADTLG  92

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLLIG NFASAA+G+D+KTA+L++AIP S Q++YYKEYQ KLA 
Sbjct  93   FTTYPAAYLSPEASGKNLLIGTNFASAAAGFDDKTAILNHAIPFSTQMQYYKEYQSKLAK  152

Query  467  VAGSKKAASIIKDALYI  517
            VAGS+KAASI+KDALYI
Sbjct  153  VAGSQKAASILKDALYI  169



>emb|CAB81548.2| putative proline-rich protein APG isolog [Cicer arietinum]
Length=350

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  24   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNKQPTGRFCNGKLATDITAETLG  83

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+S+  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++A+PLSQQ+EYYKEYQ KLA 
Sbjct  84   FTSFAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHALPLSQQLEYYKEYQSKLAK  143

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKDALY+
Sbjct  144  VAGSKKAASIIKDALYL  160



>ref|XP_004235632.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum lycopersicum]
Length=359

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  33   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVTRQPTGRFCNGKLATDITADTLG  92

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLLIG NFASAA+G+D+KTA+L++AIP S Q++YYKEYQ KLA 
Sbjct  93   FTTYPAAYLSPEASGKNLLIGTNFASAAAGFDDKTAILNHAIPFSTQMQYYKEYQSKLAK  152

Query  467  VAGSKKAASIIKDALYI  517
            VAGS+KAASI+KDALYI
Sbjct  153  VAGSQKAASILKDALYI  169



>ref|XP_004510325.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=356

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  30   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNKQPTGRFCNGKLATDITAETLG  89

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+S+  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++A+PLSQQ+EYYKEYQ KLA 
Sbjct  90   FTSFAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHALPLSQQLEYYKEYQSKLAK  149

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKDALY+
Sbjct  150  VAGSKKAASIIKDALYL  166



>gb|KDO38516.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=273

 Score =   230 bits (586),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  464  GVAGSKKAASIIKDALYI  517
             VAGSK++ASIIKDA+YI
Sbjct  153  KVAGSKQSASIIKDAIYI  170



>ref|XP_003543615.1| PREDICTED: GDSL esterase/lipase APG-like [Glycine max]
Length=353

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFINHQPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SY  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++AIPLSQQ++YYKEY+GKLA 
Sbjct  87   FKSYAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHAIPLSQQLKYYKEYRGKLAK  146

Query  467  VAGSKKAASIIKDALYI  517
            V GSKKAA IIK+ALYI
Sbjct  147  VVGSKKAALIIKNALYI  163



>gb|KHN30020.1| GDSL esterase/lipase APG [Glycine soja]
Length=353

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFINHQPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SY  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++AIPLSQQ++YYKEY+GKLA 
Sbjct  87   FKSYAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHAIPLSQQLKYYKEYRGKLAK  146

Query  467  VAGSKKAASIIKDALYI  517
            V GSKKAA IIK+ALYI
Sbjct  147  VVGSKKAALIIKNALYI  163



>ref|XP_010062556.1| PREDICTED: GDSL esterase/lipase APG [Eucalyptus grandis]
 gb|KCW69695.1| hypothetical protein EUGRSUZ_F03090 [Eucalyptus grandis]
Length=356

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNNNY+ TIF+A+YPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSAVDVGNNNYLPTIFRANYPPYGRDFANHKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ +P AYLSP+A+GKNLLIGANFASAASGYDEK ALL++AI L QQ+EY+KEYQGKLA 
Sbjct  91   FTKFPPAYLSPEASGKNLLIGANFASAASGYDEKAALLNHAIALPQQLEYFKEYQGKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+AASI+K ALYI
Sbjct  151  VAGSKQAASIVKGALYI  167



>gb|KHN05319.1| GDSL esterase/lipase APG [Glycine soja]
Length=354

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDF +HQPTGRFCNGKLATD TADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +Y  AYLSP A+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  88   FKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  147

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKDALY+
Sbjct  148  VAGSKKAASIIKDALYV  164



>gb|ACU24285.1| unknown [Glycine max]
Length=354

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDF +HQPTGRFCNGKLATD TADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +Y  AYLSP A+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  88   FKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  147

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKDALY+
Sbjct  148  VAGSKKAASIIKDALYV  164



>ref|XP_007150584.1| hypothetical protein PHAVU_005G164800g [Phaseolus vulgaris]
 gb|ESW22578.1| hypothetical protein PHAVU_005G164800g [Phaseolus vulgaris]
Length=353

 Score =   232 bits (591),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNHQPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F S+  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++AIPLSQQ++YYKEYQ KLA 
Sbjct  87   FKSFAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHAIPLSQQLKYYKEYQCKLAK  146

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKA+ IIKDALYI
Sbjct  147  VAGSKKASLIIKDALYI  163



>ref|XP_003597654.1| GDSL esterase/lipase APG [Medicago truncatula]
 gb|AES67905.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=354

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPAI+ FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF SH+PTGRFCNGKLATDITA+TLG
Sbjct  28   VVPAIVTFGDSAVDVGNNDYLFTLFKANYPPYGRDFVSHKPTGRFCNGKLATDITAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SY  AYLSPQATGKNLLIGANFASAASGYDEK A+L++AIPLSQQ++YYKEYQ KL+ 
Sbjct  88   FKSYAPAYLSPQATGKNLLIGANFASAASGYDEKAAILNHAIPLSQQLKYYKEYQSKLSK  147

Query  467  VAGSKKAASIIKDALYI  517
            +AGSKKAASIIK ALY+
Sbjct  148  IAGSKKAASIIKGALYL  164



>ref|XP_003531641.2| PREDICTED: GDSL esterase/lipase APG-like [Glycine max]
Length=393

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDF +HQPTGRFCNGKLATD TADTLG
Sbjct  67   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLG  126

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +Y  AYLSP A+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  127  FKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  186

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKDALY+
Sbjct  187  VAGSKKAASIIKDALYV  203



>gb|KDO38513.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=319

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  464  GVAGSKKAASIIKDALYI  517
             VAGSK++ASIIKDA+YI
Sbjct  153  KVAGSKQSASIIKDAIYI  170



>ref|XP_003627082.1| GDSL esterase/lipase APG [Medicago truncatula]
 gb|AET01558.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=355

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATD TA+TLG
Sbjct  29   LVPAIMTFGDSAVDVGNNDYLPTLFKANYPPYGRDFTNKQPTGRFCNGKLATDFTAETLG  88

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+S+  AYLSPQA+GKNLL+GANFASAASGYDEK A L++AIPLSQQ+EY+KEYQGKLA 
Sbjct  89   FTSFAPAYLSPQASGKNLLLGANFASAASGYDEKAATLNHAIPLSQQLEYFKEYQGKLAQ  148

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAASIIKD+LY+
Sbjct  149  VAGSKKAASIIKDSLYV  165



>ref|XP_006465718.1| PREDICTED: GDSL esterase/lipase APG-like [Citrus sinensis]
Length=357

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  31   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  90

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  91   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  150

Query  464  GVAGSKKAASIIKDALYI  517
             VAGSK++ASIIKDA+YI
Sbjct  151  KVAGSKQSASIIKDAIYI  168



>ref|XP_006426844.1| hypothetical protein CICLE_v10025938mg [Citrus clementina]
 gb|ESR40084.1| hypothetical protein CICLE_v10025938mg [Citrus clementina]
 gb|KDO38514.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=359

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  464  GVAGSKKAASIIKDALYI  517
             VAGSK++ASIIKDA+YI
Sbjct  153  KVAGSKQSASIIKDAIYI  170



>ref|XP_007135613.1| hypothetical protein PHAVU_010G143600g [Phaseolus vulgaris]
 gb|ESW07607.1| hypothetical protein PHAVU_010G143600g [Phaseolus vulgaris]
Length=384

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNNNY+ T FKADYPPYGRDF++HQPTGRFCNGKLATDITA+TLG
Sbjct  58   LVPAIITFGDSVVDVGNNNYLPTFFKADYPPYGRDFSNHQPTGRFCNGKLATDITAETLG  117

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +Y  AYLSPQA+GKNLLIGANFASAASGYDE  A L++AI LSQQ+ Y+KEYQGKLA 
Sbjct  118  FKTYAPAYLSPQASGKNLLIGANFASAASGYDENAATLNHAITLSQQLSYFKEYQGKLAK  177

Query  467  VAGSKKAASIIKDALYI  517
            VAGS+KA+SIIKDALY+
Sbjct  178  VAGSQKASSIIKDALYV  194



>ref|XP_010244385.1| PREDICTED: GDSL esterase/lipase APG-like [Nelumbo nucifera]
Length=358

 Score =   227 bits (578),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDSSVDVGNN+YV T FKA+YPPYGRDF + +PTGRFCNGKLATDITA+TLG
Sbjct  32   LVPAIITFGDSSVDVGNNDYVTTFFKANYPPYGRDFINRKPTGRFCNGKLATDITAETLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSPQA+GKNLLIGANFASA SGYD+KTALLS+ IPLSQQ+EY+KEY+ KL  
Sbjct  92   FTTYPPAYLSPQASGKNLLIGANFASAGSGYDDKTALLSHVIPLSQQLEYFKEYRRKLTK  151

Query  467  VAGSKKAASIIKDALYI  517
            VAG +KAASI KDALY+
Sbjct  152  VAGIRKAASITKDALYL  168



>ref|XP_006343027.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum tuberosum]
Length=387

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+ DVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKL TD+TAD LG
Sbjct  61   LVPAIITFGDSASDVGNNDYIITLFKANYPPYGRDFVTHQPTGRFCNGKLVTDMTADALG  120

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLLIG NFASAA+GYD+KTA+L++AIPLS+Q++YYKEY+ KLA 
Sbjct  121  FTTYPAAYLSPEASGKNLLIGTNFASAAAGYDDKTAILNHAIPLSKQMQYYKEYKTKLAK  180

Query  467  VAGSKKAASIIKDALYI  517
            VAGS+KA SIIKDALYI
Sbjct  181  VAGSQKAESIIKDALYI  197



>ref|XP_004486794.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=353

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +H+ TGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNHKSTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SY  AYLSPQATGKNLLIGANFASAASGYDEK ++L++AIPLSQQ++YYKEYQ KL  
Sbjct  87   FKSYAPAYLSPQATGKNLLIGANFASAASGYDEKASILNHAIPLSQQLKYYKEYQSKLIK  146

Query  467  VAGSKKAASIIKDALYI  517
            +AG KKAASIIK ALYI
Sbjct  147  IAGRKKAASIIKGALYI  163



>ref|XP_006406840.1| hypothetical protein EUTSA_v10021008mg [Eutrema salsugineum]
 dbj|BAJ33787.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48293.1| hypothetical protein EUTSA_v10021008mg [Eutrema salsugineum]
Length=358

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  32   LVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  
Sbjct  92   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIK  151

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKK+ SIIK A+Y+
Sbjct  152  VAGSKKSDSIIKGAIYL  168



>emb|CDO97957.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDIT---  271
            QPLVPA+I FGDS+VDVGNNNY+ T+FKADYPPYGRDF +HQPTGRFCNGKLATDIT   
Sbjct  28   QPLVPALITFGDSAVDVGNNNYLPTLFKADYPPYGRDFINHQPTGRFCNGKLATDITGKY  87

Query  272  ADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  451
             DTLGF++YP AYLSPQA+GKNLLIGANFASAASGYD+KTA LS+AIPLSQQ++Y+KEY+
Sbjct  88   TDTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDDKTAYLSHAIPLSQQLQYFKEYR  147

Query  452  GKLAGVAGSKKAASIIKDALYI  517
             KL  VAG+ +AASI   ALYI
Sbjct  148  SKLEQVAGTSQAASITGSALYI  169



>ref|XP_002515932.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF46352.1| zinc finger protein, putative [Ricinus communis]
Length=353

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TI+KA+YPPYGRDF +H+PTGRFCNGKLATDITA+TLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLPTIYKANYPPYGRDFVNHKPTGRFCNGKLATDITAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +Y  AYLSP A+GKNLLIGANFASAASGYDEK A+L++AIPLSQQ++Y++EYQ KLA 
Sbjct  88   FKTYAPAYLSPDASGKNLLIGANFASAASGYDEKAAMLNHAIPLSQQLQYFREYQSKLAK  147

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASI+KDALY+
Sbjct  148  VAGSSKSASIVKDALYL  164



>ref|XP_010098171.1| GDSL esterase/lipase APG [Morus notabilis]
 gb|EXB74608.1| GDSL esterase/lipase APG [Morus notabilis]
Length=353

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPA+IAFGDSSVDVGNNNY  T+FKA+YPPYGRDF +HQ TGRFCNGKLATD+TA+TLG
Sbjct  28   LVPAVIAFGDSSVDVGNNNYRPTLFKANYPPYGRDFINHQATGRFCNGKLATDLTAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F  YP AYLSP+A+GKNLLIGANFASAA+GYDEK ++L++AIPLSQQ++Y+KEY+ KLA 
Sbjct  88   FKKYPAAYLSPEASGKNLLIGANFASAAAGYDEKASVLNHAIPLSQQLDYFKEYKTKLAK  147

Query  467  VAGSKKAASIIKDALYI  517
            VAG KKA SIIK+ALY+
Sbjct  148  VAGQKKADSIIKEALYV  164



>ref|XP_009408845.1| PREDICTED: GDSL esterase/lipase APG-like [Musa acuminata subsp. 
malaccensis]
Length=359

 Score =   224 bits (572),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKAD+PPYGRDF +H+PTGRFCNGKLATDITADTLG
Sbjct  33   LVPAIITFGDSTVDVGNNDYLKTIFKADFPPYGRDFKNHKPTGRFCNGKLATDITADTLG  92

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            FSSYP AYLSP+A+GKNLLIGANFASAASGY + TA L +AIPLSQQ+E+YKEYQ KL+ 
Sbjct  93   FSSYPSAYLSPEASGKNLLIGANFASAASGYYDDTAYLYHAIPLSQQLEFYKEYQHKLSR  152

Query  467  VAGSKKAASIIKDALYI  517
            VAG+ KA+SII  ALYI
Sbjct  153  VAGTSKASSIISGALYI  169



>gb|KFK38989.1| hypothetical protein AALP_AA3G185500 [Arabis alpina]
Length=352

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPAII FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  26   VVPAIITFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKATGRFCNGKLATDITAETLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  
Sbjct  86   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIK  145

Query  467  VAGSKKAASIIKDALYI  517
            +AGSK++ASIIK A+Y+
Sbjct  146  IAGSKQSASIIKGAIYL  162



>ref|XP_004302841.1| PREDICTED: GDSL esterase/lipase APG [Fragaria vesca subsp. vesca]
Length=357

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI  FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +H+ TGRFCNGKLATDITADTLG
Sbjct  31   LVPAIFTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVNHKATGRFCNGKLATDITADTLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F  YP AYLSPQA+GKNLLIGANFASAASGYDEK A L++AI L QQ+EY+KEYQGKL  
Sbjct  91   FKLYPAAYLSPQASGKNLLIGANFASAASGYDEKAAYLNHAISLPQQLEYFKEYQGKLNK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGSKKAA+IIK ALY+
Sbjct  151  VAGSKKAATIIKGALYL  167



>ref|XP_002436473.1| hypothetical protein SORBIDRAFT_10g003340 [Sorghum bicolor]
 gb|EER87840.1| hypothetical protein SORBIDRAFT_10g003340 [Sorghum bicolor]
Length=360

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDS+VDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  32   QPLVPAVLTFGDSTVDVGNNDYLHTILKANFPPYGRDFANHVATGRFCNGKLATDITADT  91

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLSQQ+EY+KEYQ KL
Sbjct  92   LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLSQQLEYFKEYQSKL  151

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAG+ +A SII  ALYI
Sbjct  152  AAVAGAGQAHSIITGALYI  170



>ref|XP_004235633.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum lycopersicum]
Length=417

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+ DVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKL TD+TAD LG
Sbjct  91   LVPAIITFGDSASDVGNNDYIITLFKANYPPYGRDFVTHQPTGRFCNGKLVTDMTADALG  150

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLLIG NFASAA+GYD+KTA+L++AIPLS+Q++YYKEY+ KL  
Sbjct  151  FTTYPAAYLSPEASGKNLLIGTNFASAAAGYDDKTAILNHAIPLSKQMQYYKEYKSKLVK  210

Query  467  VAGSKKAASIIKDALYI  517
            VAGS+KA SI+KDALYI
Sbjct  211  VAGSQKAESILKDALYI  227



>ref|XP_007024353.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY26975.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=354

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITA TLG
Sbjct  29   VVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFDNHQPTGRFCNGKLATDITAKTLG  88

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLLIGANFASA SGYD+  A L++AI L+QQVEY+KEYQ KLA 
Sbjct  89   FTTYPPAYLSPEASGKNLLIGANFASAGSGYDDNAATLNHAITLTQQVEYFKEYQAKLAK  148

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASIIKDALY+
Sbjct  149  VAGSSKSASIIKDALYV  165



>ref|XP_010925408.1| PREDICTED: GDSL esterase/lipase APG [Elaeis guineensis]
Length=365

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HTIFKA+YPPYGRDF +HQ TGRFCNGKLATDITA+TLG
Sbjct  39   LVPAIITFGDSTVDVGNNDYIHTIFKANYPPYGRDFVNHQATGRFCNGKLATDITANTLG  98

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+SYP AYLSPQA+G NLL+G NFASAASGY + TA L++AIPLSQQ++YYKEYQ KLA 
Sbjct  99   FTSYPPAYLSPQASGNNLLMGVNFASAASGYYDGTAYLNHAIPLSQQLKYYKEYQSKLAK  158

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+A+SI+  ALYI
Sbjct  159  VAGSKQASSILSGALYI  175



>gb|EYU21440.1| hypothetical protein MIMGU_mgv1a009146mg [Erythranthe guttata]
Length=342

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKADYPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  25   LVPAIITFGDSVVDVGNNDYIPTIFKADYPPYGRDFKNKQPTGRFCNGKLATDITAETLG  84

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+S+   YLSPQA+GKNLL+GANFASA +GYD+ T+LLS+ IPLSQQ++YYKEYQ  LA 
Sbjct  85   FTSFAPPYLSPQASGKNLLLGANFASAGAGYDDHTSLLSHVIPLSQQLKYYKEYQVNLAK  144

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+AASIIKDALY+
Sbjct  145  VAGSKQAASIIKDALYL  161



>gb|EYU21439.1| hypothetical protein MIMGU_mgv1a009146mg [Erythranthe guttata]
Length=351

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKADYPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  25   LVPAIITFGDSVVDVGNNDYIPTIFKADYPPYGRDFKNKQPTGRFCNGKLATDITAETLG  84

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+S+   YLSPQA+GKNLL+GANFASA +GYD+ T+LLS+ IPLSQQ++YYKEYQ  LA 
Sbjct  85   FTSFAPPYLSPQASGKNLLLGANFASAGAGYDDHTSLLSHVIPLSQQLKYYKEYQVNLAK  144

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+AASIIKDALY+
Sbjct  145  VAGSKQAASIIKDALYL  161



>ref|XP_006298028.1| hypothetical protein CARUB_v10014074mg [Capsella rubella]
 gb|EOA30926.1| hypothetical protein CARUB_v10014074mg [Capsella rubella]
Length=353

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIK  146

Query  467  VAGSKKAASIIKDALYI  517
            +AGSKKA SII  A+ +
Sbjct  147  IAGSKKADSIISGAICL  163



>gb|KHG15938.1| GDSL esterase/lipase APG -like protein [Gossypium arboreum]
Length=356

 Score =   222 bits (566),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLLIGANFASA SGYD+K +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLIGANFASAGSGYDDKASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASIIKDALY+
Sbjct  151  VAGSTKSASIIKDALYV  167



>gb|KDP40834.1| hypothetical protein JCGZ_24833 [Jatropha curcas]
Length=352

 Score =   222 bits (565),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPAII FGDS+VDVGNN+Y+ TI+KA+YPPYGRDF +HQPTGRFCNGKLATDITA++LG
Sbjct  27   VVPAIITFGDSAVDVGNNDYLPTIYKANYPPYGRDFVNHQPTGRFCNGKLATDITAESLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +YP AYLSP A+GKNLLIGANFASAASGYD+K A +++AIPL QQ++Y++EY+G+LA 
Sbjct  87   FKTYPPAYLSPDASGKNLLIGANFASAASGYDDKAATVNHAIPLPQQLQYFREYKGRLAK  146

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASIIKDALYI
Sbjct  147  VAGSAKSASIIKDALYI  163



>ref|XP_010504217.1| PREDICTED: GDSL esterase/lipase APG-like [Camelina sativa]
Length=353

 Score =   222 bits (565),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPLYQQVEYFKEYKSKLIK  146

Query  467  VAGSKKAASIIKDALYI  517
            +AGSKKA SII  A+ +
Sbjct  147  IAGSKKADSIISGAICL  163



>ref|XP_004964566.1| PREDICTED: GDSL esterase/lipase APG-like [Setaria italica]
Length=357

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  29   QPLVPAVMTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  88

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLSQQ++Y++EYQ KL
Sbjct  89   LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLSQQLQYFREYQSKL  148

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAG  +A SII  ALYI
Sbjct  149  AAVAGGAQAHSIISGALYI  167



>ref|XP_010487495.1| PREDICTED: GDSL esterase/lipase APG-like [Camelina sativa]
Length=366

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  40   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  99

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+++AIPL QQVEY+KEY+ KL  
Sbjct  100  FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPLYQQVEYFKEYKSKLIK  159

Query  467  VAGSKKAASIIKDALYI  517
            +AGSKKA SII  A+ +
Sbjct  160  IAGSKKADSIISGAICL  176



>ref|XP_010465660.1| PREDICTED: GDSL esterase/lipase APG [Camelina sativa]
Length=354

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPLYQQVEYFKEYKSKLIK  146

Query  467  VAGSKKAASIIKDALYI  517
            +AGSKKA SII  A+ +
Sbjct  147  IAGSKKADSIISGAICL  163



>ref|NP_001136705.1| hypothetical protein precursor [Zea mays]
 gb|ACF82439.1| unknown [Zea mays]
Length=341

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  29   QPLVPALFTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  88

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLSQQ+EY++EYQ KL
Sbjct  89   LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLSQQLEYFREYQTKL  148

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAG+ +A SI+  ALYI
Sbjct  149  AAVAGAGQARSILSGALYI  167



>ref|XP_009388555.1| PREDICTED: GDSL esterase/lipase APG-like [Musa acuminata subsp. 
malaccensis]
Length=358

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPA+I FGDS+VDVGNN+Y+ T+F+AD+PPYGRDF +H+PTGRFCNGKLATD+TADTLG
Sbjct  32   LVPALITFGDSTVDVGNNDYLKTVFRADFPPYGRDFKNHEPTGRFCNGKLATDLTADTLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSPQA+GKNLLIGANFASA SG  ++T+ LS+AIPL+QQ+EYYKEYQ KLA 
Sbjct  92   FTTYPPAYLSPQASGKNLLIGANFASAGSGLYDETSYLSHAIPLTQQLEYYKEYQSKLAH  151

Query  467  VAGSKKAASIIKDALYI  517
            VAGS +A +II DALYI
Sbjct  152  VAGSSQAKAIISDALYI  168



>gb|KJB56732.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=237

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASI KDALY+
Sbjct  151  VAGSTKSASITKDALYV  167



>ref|XP_008654481.1| PREDICTED: uncharacterized protein LOC100216840 isoform X1 [Zea 
mays]
 gb|AFW83669.1| hypothetical protein ZEAMMB73_889110 [Zea mays]
Length=420

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  92   QPLVPALFTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  151

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLSQQ+EY++EYQ KL
Sbjct  152  LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLSQQLEYFREYQTKL  211

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAG+ +A SI+  ALYI
Sbjct  212  AAVAGAGQARSILSGALYI  230



>gb|KJB70369.1| hypothetical protein B456_011G070000 [Gossypium raimondii]
Length=356

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L++AI LSQQVEY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGNNLLIGANFASAGSGYDDRAASLNHAITLSQQVEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASIIKDALY+
Sbjct  151  VAGSSKSASIIKDALYV  167



>gb|KJB70371.1| hypothetical protein B456_011G070000 [Gossypium raimondii]
Length=353

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L++AI LSQQVEY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGNNLLIGANFASAGSGYDDRAASLNHAITLSQQVEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASIIKDALY+
Sbjct  151  VAGSSKSASIIKDALYV  167



>ref|XP_009146144.1| PREDICTED: GDSL esterase/lipase APG [Brassica rapa]
 emb|CDY56196.1| BnaA05g36890D [Brassica napus]
Length=358

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            L P +I FGDS VDVGNNNY+ T+F+ADYPPYGRDFA H+PTGRFCNGKLATDITA+TLG
Sbjct  32   LFPGMIIFGDSVVDVGNNNYLPTLFRADYPPYGRDFAGHKPTGRFCNGKLATDITAETLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEYYKEY+ KL  
Sbjct  92   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYYKEYKSKLIK  151

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+A +IIK ++Y+
Sbjct  152  VAGSKQADTIIKGSIYL  168



>ref|XP_011008871.1| PREDICTED: GDSL esterase/lipase APG [Populus euphratica]
Length=352

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF  H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTIFKANYPPYGRDFVDHKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SY  AYLSP+A+GKNLLIG+NFASAASGYDE+ A L++AIPLSQQ+EY+KEYQ KLA 
Sbjct  87   FKSYAPAYLSPEASGKNLLIGSNFASAASGYDERAAALNHAIPLSQQLEYFKEYQSKLAK  146

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASIIK ALYI
Sbjct  147  VAGS-KSASIIKGALYI  162



>ref|NP_188258.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LU14.1|APG2_ARATH RecName: Full=GDSL esterase/lipase APG; AltName: Full=Extracellular 
lipase APG; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01276.1| proline-rich protein APG-like; GDSL-motif lipase/hydrolase-like 
protein [Arabidopsis thaliana]
 gb|AAL77704.1| AT3g16370/MYA6_18 [Arabidopsis thaliana]
 gb|AAO11525.1| At3g16370/MYA6_18 [Arabidopsis thaliana]
 gb|AEE75804.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=353

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIK  146

Query  467  VAGSKKAASIIKDALYI  517
            +AGSKKA SIIK A+ +
Sbjct  147  IAGSKKADSIIKGAICL  163



>ref|XP_008447571.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis melo]
Length=354

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNNNY++TI+KA+YPPYG+DF +HQPTGRFCNGKLATD TA TLG
Sbjct  28   LVPAIITFGDSAVDVGNNNYLYTIYKANYPPYGKDFVNHQPTGRFCNGKLATDFTAQTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F ++P+ YLSP+A+GKNLLIG NFASAASGYDE  ALL++A+ L QQV ++KEYQ KLA 
Sbjct  88   FKTFPLPYLSPEASGKNLLIGVNFASAASGYDENAALLNHALSLPQQVGFFKEYQAKLAK  147

Query  467  VAGSKKAASIIKDALYI  517
            VAG++KAASIIKDALY+
Sbjct  148  VAGNEKAASIIKDALYL  164



>gb|KJB70370.1| hypothetical protein B456_011G070000 [Gossypium raimondii]
Length=394

 Score =   221 bits (562),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L++AI LSQQVEY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGNNLLIGANFASAGSGYDDRAASLNHAITLSQQVEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASIIKDALY+
Sbjct  151  VAGSSKSASIIKDALYV  167



>ref|XP_002883003.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59262.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=353

 Score =   219 bits (559),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPLYQQVEYFKEYKSKLIK  146

Query  467  VAGSKKAASIIKDALYI  517
            +AGSKKA SIIK A+ +
Sbjct  147  IAGSKKADSIIKGAICL  163



>ref|XP_002298249.2| putative proline-rich protein APG isolog [Populus trichocarpa]
 gb|ABK95990.1| unknown [Populus trichocarpa]
 gb|EEE83054.2| putative proline-rich protein APG isolog [Populus trichocarpa]
Length=352

 Score =   219 bits (558),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF   +PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTIFKANYPPYGRDFVDQKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SY  AYLSP A+GKNLLIG+NFASAASGYDEK A L++AIPLSQQ+EY+KEYQGKLA 
Sbjct  87   FKSYAPAYLSPDASGKNLLIGSNFASAASGYDEKAAALNHAIPLSQQLEYFKEYQGKLAK  146

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASIIK ALYI
Sbjct  147  VAGS-KSASIIKGALYI  162



>gb|KJB56736.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=300

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASI KDALY+
Sbjct  151  VAGSTKSASITKDALYV  167



>emb|CDY30167.1| BnaC05g36950D [Brassica napus]
Length=354

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            L P ++ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA H+PTGRFCNGKLATDITA+TLG
Sbjct  28   LFPGMMIFGDSVVDVGNNNYLPTLFRADYPPYGRDFAGHKPTGRFCNGKLATDITAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEYYKEY+ KL  
Sbjct  88   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYYKEYKRKLIK  147

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+A +IIK ++Y+
Sbjct  148  VAGSKQADTIIKGSIYL  164



>gb|KJB56734.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=296

 Score =   217 bits (553),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASI KDALY+
Sbjct  151  VAGSTKSASITKDALYV  167



>ref|XP_008793255.1| PREDICTED: GDSL esterase/lipase APG [Phoenix dactylifera]
Length=358

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT FKA+ PPYGRDF +HQ TGRFCNGKLATDITA+TLG
Sbjct  32   LVPAIITFGDSTVDVGNNDYIHTAFKANCPPYGRDFVNHQATGRFCNGKLATDITANTLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+SYP AYLSPQA+GKNLL+G NFASAASGY ++TA L++AIPL QQ++YYKEYQ KLA 
Sbjct  92   FTSYPPAYLSPQASGKNLLMGVNFASAASGYYDETAYLNHAIPLPQQLKYYKEYQSKLAM  151

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+A+SI+  ALYI
Sbjct  152  VAGSKQASSILSGALYI  168



>gb|KHG07525.1| GDSL esterase/lipase APG -like protein [Gossypium arboreum]
Length=357

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +P+GRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPSGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L++AI LSQQVEY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGSNLLIGANFASAGSGYDDRAASLNHAITLSQQVEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+A+IIKDALY+
Sbjct  151  VAGSSKSAAIIKDALYV  167



>gb|KJB56735.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=356

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASI KDALY+
Sbjct  151  VAGSTKSASITKDALYV  167



>gb|KJB56733.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=364

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASI KDALY+
Sbjct  151  VAGSTKSASITKDALYV  167



>ref|XP_010545663.1| PREDICTED: GDSL esterase/lipase APG [Tarenaya hassleriana]
Length=357

 Score =   217 bits (553),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNNNY+ TIF+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSAVDVGNNNYLPTIFRADYPPYGRDFANHEATGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSPQA+GKNLLIGANFASAASGYD K A++++AIPL QQVEY+KEY+ KL  
Sbjct  91   FTAYPPAYLSPQASGKNLLIGANFASAASGYDPKPAIINHAIPLYQQVEYFKEYKSKLVK  150

Query  467  VAGSKKAASIIKDALYI  517
            +AG  K+ SII+ A+ I
Sbjct  151  IAGKTKSESIIRGAICI  167



>ref|XP_004486795.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=352

 Score =   216 bits (551),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVPAII FGDS+VDVGNN+ + TIFK++YPPYGRDF + +PTGRFCNGKLATDITADT
Sbjct  24   QSLVPAIITFGDSTVDVGNNDNLSTIFKSNYPPYGRDFLNQEPTGRFCNGKLATDITADT  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF++Y  AYLS QATGKNLL+GANFASAASGYDE +A    AIPLSQQV+YYKEYQ KL
Sbjct  84   LGFTNYAPAYLSSQATGKNLLLGANFASAASGYDENSATFYGAIPLSQQVKYYKEYQSKL  143

Query  461  AGVAGSKKAASIIKDALYI  517
              +AGS+ A++IIK+ALYI
Sbjct  144  VQIAGSENASAIIKNALYI  162



>emb|CAN65530.1| hypothetical protein VITISV_039629 [Vitis vinifera]
Length=355

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS+VD GNNNY  T FKA+Y PYG+DF SHQPTGRFCNGKLATDITAD LG
Sbjct  30   IVPALILFGDSAVDSGNNNYFPTAFKANYLPYGKDFISHQPTGRFCNGKLATDITADILG  89

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +YP AYLSPQATGKNLL+GANF SAA+GYD+ TA++++AIPLSQQ+EYYKEY+ KLA 
Sbjct  90   FKTYPPAYLSPQATGKNLLVGANFGSAAAGYDDNTAIINHAIPLSQQLEYYKEYRVKLAK  149

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+AA+I+K ALY+
Sbjct  150  VAGSKRAAAILKGALYL  166



>ref|XP_004516916.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=352

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVPAII FGDS+VDVGNN+ + T+FK+++PPYGRDF + +PTGRFCNGKLATDITADT
Sbjct  24   QTLVPAIITFGDSAVDVGNNDNLPTLFKSNHPPYGRDFLNQEPTGRFCNGKLATDITADT  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SY  AYLS QATGKNLL+GANFASAASGYDE +A  + AIPLSQQV YYKEYQ KL
Sbjct  84   LGFTSYAPAYLSSQATGKNLLLGANFASAASGYDENSATFNGAIPLSQQVIYYKEYQSKL  143

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAGS+ A++IIK+ALYI
Sbjct  144  AQVAGSENASAIIKNALYI  162



>ref|XP_006426845.1| hypothetical protein CICLE_v10025957mg [Citrus clementina]
 gb|ESR40085.1| hypothetical protein CICLE_v10025957mg [Citrus clementina]
Length=355

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII+FGDSSVDVGNNN++ T FKA+YPPYGRDF +HQPTGRFC+GKL TD TADTL
Sbjct  29   PLVPAIISFGDSSVDVGNNNHLLTYFKANYPPYGRDFINHQPTGRFCDGKLVTDFTADTL  88

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +Y  AYLSPQAT KNLLIGANFASA SGYD  T+++++AI L+ Q++YY+EYQ KLA
Sbjct  89   GFKTYAPAYLSPQATRKNLLIGANFASAGSGYDGNTSIINHAISLTHQLQYYREYQSKLA  148

Query  464  GVAGSKKAASIIKDALYI  517
             +AG K++ASIIKDA+YI
Sbjct  149  KLAGRKQSASIIKDAIYI  166



>ref|XP_002277514.1| PREDICTED: GDSL esterase/lipase APG [Vitis vinifera]
Length=355

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PA+I FGDS+VD GNNNY  T FKA+Y PYG+DF SHQPTGRFCNGKLATDITAD LG
Sbjct  30   IAPAMILFGDSAVDSGNNNYFPTAFKANYLPYGKDFISHQPTGRFCNGKLATDITADILG  89

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +YP AYLSPQATGKNLL+GANF SAA+GYD+ TA++++AIPLSQQ+EYYKEY+ KLA 
Sbjct  90   FETYPPAYLSPQATGKNLLVGANFGSAAAGYDDNTAIINHAIPLSQQLEYYKEYRVKLAK  149

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+AA+I+K ALY+
Sbjct  150  VAGSKRAAAILKGALYL  166



>emb|CBI36031.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PA+I FGDS+VD GNNNY  T FKA+Y PYG+DF SHQPTGRFCNGKLATDITAD LG
Sbjct  38   IAPAMILFGDSAVDSGNNNYFPTAFKANYLPYGKDFISHQPTGRFCNGKLATDITADILG  97

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +YP AYLSPQATGKNLL+GANF SAA+GYD+ TA++++AIPLSQQ+EYYKEY+ KLA 
Sbjct  98   FETYPPAYLSPQATGKNLLVGANFGSAAAGYDDNTAIINHAIPLSQQLEYYKEYRVKLAK  157

Query  467  VAGSKKAASIIKDALYI  517
            VAGSK+AA+I+K ALY+
Sbjct  158  VAGSKRAAAILKGALYL  174



>ref|NP_001056808.1| Os06g0148200 [Oryza sativa Japonica Group]
 gb|AAP33477.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAD68619.1| putative nodulin [Oryza sativa Japonica Group]
 dbj|BAD68792.1| putative nodulin [Oryza sativa Japonica Group]
 dbj|BAF18722.1| Os06g0148200 [Oryza sativa Japonica Group]
 gb|EAY99692.1| hypothetical protein OsI_21674 [Oryza sativa Indica Group]
 dbj|BAG87362.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98734.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65086.1| hypothetical protein OsJ_20126 [Oryza sativa Japonica Group]
Length=351

 Score =   214 bits (545),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDSSVDVGNN+Y+ TI KA++PPYGRDF +  PTGRFCNGKLATDITA+T
Sbjct  23   QPLVPAVMTFGDSSVDVGNNDYLKTIIKANFPPYGRDFKNQVPTGRFCNGKLATDITAET  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF SY  AYLSP A+GKNLLIGANFASA SGY + TALL +AIPLSQQ+EY+KEYQ KL
Sbjct  83   LGFESYAPAYLSPDASGKNLLIGANFASAGSGYYDHTALLYHAIPLSQQLEYFKEYQSKL  142

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAGS +A SII  +LYI
Sbjct  143  AAVAGSSQAQSIINGSLYI  161



>gb|EMS47165.1| GDSL esterase/lipase APG [Triticum urartu]
Length=351

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP +  FGDSSVD+GNN+Y+HT+ KAD+PPYGRDF +   TGRFCNGKLATDITADT
Sbjct  23   QPLVPGVFTFGDSSVDIGNNDYLHTLIKADFPPYGRDFPNRVATGRFCNGKLATDITADT  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLSPQA+GKNLLIGANFASA SGY + TAL+ +AIP SQQ+EY++EYQ KL
Sbjct  83   LGFTSYPPAYLSPQASGKNLLIGANFASAGSGYYDHTALMYHAIPFSQQLEYFREYQSKL  142

Query  461  AGVAGSKKAASIIKDALYI  517
               AGS +A SII  +LYI
Sbjct  143  TAFAGSSQAKSIISGSLYI  161



>ref|XP_004149175.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
 ref|XP_004170192.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
 gb|KGN58016.1| hypothetical protein Csa_3G434970 [Cucumis sativus]
Length=354

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNNNY++T+FKA++ PYG+DF +HQPTGRFCNGKLATD TA TLG
Sbjct  28   LVPAIMTFGDSAVDVGNNNYLYTVFKANHLPYGKDFVNHQPTGRFCNGKLATDFTAQTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F ++P+ YLSP+A+GKNLLIG NFASAASGYDE  ALL++A+ L QQV ++KEYQ KLA 
Sbjct  88   FKTFPLPYLSPEASGKNLLIGVNFASAASGYDENAALLNHALSLPQQVGFFKEYQVKLAK  147

Query  467  VAGSKKAASIIKDALYI  517
            VAG++KAASIIKDALY+
Sbjct  148  VAGNEKAASIIKDALYL  164



>ref|XP_006655787.1| PREDICTED: GDSL esterase/lipase APG-like [Oryza brachyantha]
Length=351

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP ++ FGDSSVDVGNN+Y+HTI KA++PPYGRDF +   TGRFCNGKLATDITA+T
Sbjct  23   QPLVPGVMTFGDSSVDVGNNDYLHTIIKANFPPYGRDFKNGAATGRFCNGKLATDITAET  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF SY  AYLSP+A+GKNLLIGANFASA SGY + TALL +AIPLSQQ+EY+KEYQ KL
Sbjct  83   LGFESYAPAYLSPEASGKNLLIGANFASAGSGYYDHTALLYHAIPLSQQLEYFKEYQSKL  142

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAGS +A SII  +LYI
Sbjct  143  AAVAGSSQAQSIINGSLYI  161



>gb|EPS71085.1| hypothetical protein M569_03672, partial [Genlisea aurea]
Length=327

 Score =   211 bits (538),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VD GNN+Y+ T+F+AD+PPYGRDF +  PTGRF NGKL TD+TADTLG
Sbjct  1    LVPAIIIFGDSAVDTGNNDYIPTVFRADHPPYGRDFKNKLPTGRFSNGKLVTDLTADTLG  60

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+SYP AYL P+A+GK LL+GANFASA SGYDE+TALLS+ IPL+QQ+EY+KEY+GKLA 
Sbjct  61   FTSYPAAYLGPEASGKRLLVGANFASAGSGYDERTALLSSVIPLNQQLEYFKEYKGKLAS  120

Query  467  VAGSKKAA-SIIKDALYI  517
            VAG +KAA  IIK ALYI
Sbjct  121  VAGGEKAAGDIIKSALYI  138



>gb|KJB56729.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=354

 Score =   212 bits (540),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 123/137 (90%), Gaps = 2/137 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ ++  +AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASM--HAITLTQQLEYFKEYQAKLAK  148

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASI KDALY+
Sbjct  149  VAGSTKSASITKDALYV  165



>gb|AAB63641.1| Proline-rich protein APG isolog [Arabidopsis thaliana]
Length=322

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  122  IAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYP  301
            + FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLGF+ YP
Sbjct  1    MTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDITAETLGFTKYP  60

Query  302  VAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSK  481
             AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  +AGSK
Sbjct  61   PAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIKIAGSK  120

Query  482  KAASIIKDALYI  517
            KA SIIK A+ +
Sbjct  121  KADSIIKGAICL  132



>ref|XP_003557194.1| PREDICTED: GDSL esterase/lipase APG [Brachypodium distachyon]
Length=352

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP +  FGDSSVDVGNN+Y+HT+ KAD+PPYGRDF     TGRFCNGKLATDITADT
Sbjct  24   QPLVPGLFTFGDSSVDVGNNDYLHTLIKADFPPYGRDFQGRVATGRFCNGKLATDITADT  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLSP+A+G+NLLIGANFASA SGY + TAL+ +AI  +QQ+EY+KEYQ KL
Sbjct  84   LGFTSYPPAYLSPEASGQNLLIGANFASAGSGYYDHTALMYHAISFTQQLEYFKEYQSKL  143

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAGS +A SI+  +LYI
Sbjct  144  AAVAGSSQAKSIVTGSLYI  162



>gb|KHN32662.1| GDSL esterase/lipase APG [Glycine soja]
Length=295

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VD+GNN+Y+ T+FKA+YPPYGRDF++HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDIGNNDYLPTLFKANYPPYGRDFSNHQPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F S+  AYLSPQA+GKNLLIG NFASAASG DEK A+L++AIPLSQQ++YYKEYQGKLA 
Sbjct  87   FKSFAPAYLSPQASGKNLLIGGNFASAASGNDEKAAILNHAIPLSQQLKYYKEYQGKLAK  146

Query  467  VAGSKKA  487
            V G  +A
Sbjct  147  VVGHFQA  153



>ref|XP_006465717.1| PREDICTED: GDSL esterase/lipase APG-like isoform X1 [Citrus sinensis]
Length=355

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAI++FGDSSVDVGNNN++ T FKA+YPPYGR+F  HQPTGRF +GKL TD TADTL
Sbjct  29   PLVPAIVSFGDSSVDVGNNNHLLTYFKANYPPYGREFIDHQPTGRFSDGKLVTDFTADTL  88

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +Y  AYLS QATGKNLLIGANFASA SGYD  T+++++AI L+ Q++YY+EYQ KLA
Sbjct  89   GFKTYAPAYLSSQATGKNLLIGANFASAGSGYDGNTSIINHAISLTHQLQYYREYQSKLA  148

Query  464  GVAGSKKAASIIKDALYI  517
             +AG K++ASIIKDA+YI
Sbjct  149  KLAGRKQSASIIKDAIYI  166



>ref|XP_002515934.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF46354.1| zinc finger protein, putative [Ricinus communis]
Length=354

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PAI  FGDS++DVGNNNY+ T +KA+YPPYGRDFASH+PTGRFC+GKL +DITA+TLG
Sbjct  27   IFPAIFTFGDSAMDVGNNNYLSTFYKANYPPYGRDFASHEPTGRFCDGKLVSDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +Y  AYLSP A+G+NLLIGA+FASAASGYD+K+++ ++AI L QQ++Y+KEYQ +LA 
Sbjct  87   FKTYAPAYLSPDASGENLLIGASFASAASGYDDKSSIRNDAITLPQQLQYFKEYQSRLAK  146

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+A+IIKDALY+
Sbjct  147  VAGSNKSATIIKDALYL  163



>gb|KDO38512.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=302

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152



>gb|EMT10375.1| GDSL esterase/lipase APG [Aegilops tauschii]
Length=351

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP +  FGDSSVD+GNN+ +H + KAD+PPYGR F +   TGRFCNGKLATDITADT
Sbjct  23   QPLVPGVFTFGDSSVDIGNNDSLHPLIKADFPPYGRAFPNRVATGRFCNGKLATDITADT  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLSPQA+GKNLLIGANFASA SGY + TAL+ +AIP SQQ+EY++EYQ KL
Sbjct  83   LGFTSYPPAYLSPQASGKNLLIGANFASAGSGYYDHTALMYHAIPFSQQLEYFREYQSKL  142

Query  461  AGVAGSKKAASIIKDALYI  517
               AGS +A SII  +LYI
Sbjct  143  TAFAGSSQAKSIISGSLYI  161



>ref|XP_002313641.2| GDSL-motif lipase family protein [Populus trichocarpa]
 gb|EEE87596.2| GDSL-motif lipase family protein [Populus trichocarpa]
Length=352

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLA+D+TA+ 
Sbjct  25   QPLVPAMFIFGDSVVDAGNNNHLYTIIKANFPPYGRDFVNHKPTGRFCNGKLASDLTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANFASAASGY E TA L +AIPLSQQ+  YKEYQ K+
Sbjct  85   LGFTSYPPAYLSKKARGKNLLIGANFASAASGYYETTAKLYHAIPLSQQLGNYKEYQNKI  144

Query  461  AGVAGSKKAASIIKDALYI  517
             G+AG   A+SII  ALY+
Sbjct  145  VGIAGKSNASSIISGALYL  163



>ref|XP_011044241.1| PREDICTED: GDSL esterase/lipase At5g22810 [Populus euphratica]
Length=352

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLA+D+TA+ 
Sbjct  25   QPLVPAMFIFGDSVVDAGNNNHLYTIVKANFPPYGRDFVNHKPTGRFCNGKLASDLTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANFASAASGY E TA L +AIPLSQQ+  YKEYQ K+
Sbjct  85   LGFTSYPPAYLSKKARGKNLLIGANFASAASGYYETTAKLYHAIPLSQQLGNYKEYQNKI  144

Query  461  AGVAGSKKAASIIKDALYI  517
             G+AG   A+SII  ALY+
Sbjct  145  VGIAGKSNASSIISGALYL  163



>ref|XP_010242974.1| PREDICTED: GDSL esterase/lipase At5g22810 [Nelumbo nucifera]
Length=352

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++T+ KA++PPYGRDF  H+PTGRFCNGKLA+D TA+ 
Sbjct  25   QPLVPALCIFGDSVVDVGNNNNLYTLVKANFPPYGRDFTKHRPTGRFCNGKLASDFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF++YP AYLSP+A G NLLIGANFASA+SGY ++TA L +AIPL+QQ+EYYKEYQ K+
Sbjct  85   LGFTTYPPAYLSPEARGNNLLIGANFASASSGYYDRTAQLYDAIPLTQQLEYYKEYQKKV  144

Query  461  AGVAGSKKAASIIKDALYI  517
            A +AG   A+SI   A+Y+
Sbjct  145  ANIAGKSNASSIFSGAIYL  163



>ref|XP_006826756.1| hypothetical protein AMTR_s00136p00069360 [Amborella trichopoda]
 gb|ERM93993.1| hypothetical protein AMTR_s00136p00069360 [Amborella trichopoda]
Length=349

 Score =   201 bits (511),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVPAII FGDS+VDVGNN+Y+ TIFKAD+PPYGRDF +  PTGRFCNGKLATDITA+T
Sbjct  22   QALVPAIITFGDSAVDVGNNDYLPTIFKADFPPYGRDFVNRSPTGRFCNGKLATDITAET  81

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+S+P AYLS QA+GKNLLIGANFAS ASGY +KTA L +AI LSQQ+EYYKEYQGKL
Sbjct  82   LGFTSFPPAYLSSQASGKNLLIGANFASGASGYYDKTAYLYHAISLSQQLEYYKEYQGKL  141

Query  461  AGVAGSKKAASIIKDALYI  517
            A +AG+ KA SI+ +ALYI
Sbjct  142  AKIAGAAKAKSILSNALYI  160



>emb|CDO97958.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 116/148 (78%), Gaps = 9/148 (6%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDIT---  271
            +PLVPA+I FGDS VDVGNNN++ T FKA++ PYGRDFASHQ TGRFCNGKL TD T   
Sbjct  25   KPLVPALIIFGDSDVDVGNNNHLSTFFKANFAPYGRDFASHQATGRFCNGKLVTDFTGKL  84

Query  272  ------ADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVE  433
                  ADTLGF+ YP AYLSP A+GK+LLIGANF SA SGYDEKTA ++ AI L +Q +
Sbjct  85   QFKNPTADTLGFTFYPPAYLSPHASGKSLLIGANFGSAGSGYDEKTASINQAISLRRQFQ  144

Query  434  YYKEYQGKLAGVAGSKKAASIIKDALYI  517
            Y+KEY+ KL   AG++KAASII DALYI
Sbjct  145  YFKEYKSKLEKSAGTRKAASIIGDALYI  172



>ref|XP_006369216.1| hypothetical protein POPTR_0001s19240g [Populus trichocarpa]
 gb|ERP65785.1| hypothetical protein POPTR_0001s19240g [Populus trichocarpa]
Length=329

 Score =   198 bits (504),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            L PAII+FGDSSVDVGNNN++ TIFKA+YPPYGRDFA+H+PTGRFCNGKL  DITA+ LG
Sbjct  27   LFPAIISFGDSSVDVGNNNHLSTIFKANYPPYGRDFANHKPTGRFCNGKLTIDITAEALG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +Y  AYLSP+A+GKNLLIG NFASAASGYD+KTA L+NAIPLS Q++++KEYQ KL  
Sbjct  87   FKTYAPAYLSPEASGKNLLIGVNFASAASGYDDKTAFLNNAIPLSLQLKHFKEYQTKLVK  146

Query  467  VAG  475
            VAG
Sbjct  147  VAG  149



>gb|KDP40835.1| hypothetical protein JCGZ_24834 [Jatropha curcas]
Length=359

 Score =   199 bits (505),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            + LVPAII FGDS +DVGNN+Y+ T FKA+Y PYG+DF +H+PTGRFCNGKL +DI A+T
Sbjct  28   ETLVPAIITFGDSGLDVGNNDYLPTKFKANYSPYGKDFLNHRPTGRFCNGKLISDIIAET  87

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF +YP AYLS  A+G+NLLIGA+FASAASG+D+K  + +NAIPL QQ++Y+KEY+ KL
Sbjct  88   MGFKTYPPAYLSRDASGENLLIGASFASAASGFDDKIVIANNAIPLHQQLQYFKEYKSKL  147

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAGS K+ SIIKDALY+
Sbjct  148  AKVAGSNKSMSIIKDALYL  166



>ref|XP_002271400.1| PREDICTED: GDSL esterase/lipase At5g22810 [Vitis vinifera]
Length=351

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS+VD GNNN++ TI KA++PPYGRDF SH+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSAVDAGNNNHLDTIVKANFPPYGRDFISHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SYP AYLS +A G NLLIGANFASAASGY   TA LSNAI LS+Q+EY+KEYQ ++
Sbjct  84   IGFTSYPPAYLSKEAKGNNLLIGANFASAASGYYHTTAKLSNAISLSKQLEYFKEYQERV  143

Query  461  AGVAGSKKAASIIKDALYI  517
            A + G   A+SII  A+Y+
Sbjct  144  AKIVGKSNASSIISGAVYL  162



>gb|KDO42514.1| hypothetical protein CISIN_1g040658mg, partial [Citrus sinensis]
Length=287

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY++TI KA++ PYGRDF  H+PTGRFCNGKLA D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDAGNNNYIYTIVKANFRPYGRDFVHHKPTGRFCNGKLAADFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SYP AYLS +A GKNLLIGANFAS ASGY E TA L +AIPLSQQ+E++K+YQ KL
Sbjct  84   IGFTSYPPAYLSEEAKGKNLLIGANFASGASGYYETTAKLYHAIPLSQQLEHFKDYQRKL  143

Query  461  AGVAGSKKAASIIKDAL  511
             G+AG   A+SII   L
Sbjct  144  EGIAGKTNASSIISGGL  160



>ref|XP_006484945.1| PREDICTED: GDSL esterase/lipase At5g22810-like, partial [Citrus 
sinensis]
Length=351

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY++TI KA++ PYGRDF  H+PTGRFCNGKLA D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDAGNNNYIYTIVKANFRPYGRDFVHHKPTGRFCNGKLAADFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SYP AYLS +A GKNLLIGANFAS ASGY E TA L +AIPLSQQ+E++K+YQ KL
Sbjct  84   IGFTSYPPAYLSEEAKGKNLLIGANFASGASGYYETTAKLYHAIPLSQQLEHFKDYQRKL  143

Query  461  AGVAGSKKAASIIKDALYI  517
             G+AG   A+SII   L +
Sbjct  144  EGIAGKTNASSIISGGLCL  162



>gb|KDP34349.1| hypothetical protein JCGZ_11232 [Jatropha curcas]
Length=351

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS +D GNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVIDAGNNNHLYTIVKANFPPYGRDFINHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SYP AYLS +A G NLLIGANFASAASG+ + TA L +AIPLS+Q+EYYK+YQ K+
Sbjct  84   IGFTSYPPAYLSKEAHGTNLLIGANFASAASGFYDTTAKLYHAIPLSKQLEYYKDYQKKI  143

Query  461  AGVAGSKKAASIIKDALYI  517
             G+AG   A+SII  ++Y+
Sbjct  144  VGIAGKSNASSIISGSVYL  162



>ref|XP_006838752.1| hypothetical protein AMTR_s00002p00255920 [Amborella trichopoda]
 gb|ERN01321.1| hypothetical protein AMTR_s00002p00255920 [Amborella trichopoda]
Length=348

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDS+ D GNNN ++T+ KA++PPYGRDF  H PTGRFCNGKLATDITADT
Sbjct  21   QPLVPAMMIFGDSTADCGNNNGLYTLVKANFPPYGRDFVDHSPTGRFCNGKLATDITADT  80

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP  YL  Q   KN LIGANFASAASGY ++TA L +AIPLS+Q++YYKEYQ K+
Sbjct  81   LGFTSYPPPYLGSQPAPKNFLIGANFASAASGYYDRTAQLYHAIPLSKQMQYYKEYQSKV  140

Query  461  AGVAGSKKAASIIKDALYI  517
              + G  KA +I  DALY+
Sbjct  141  IKMVGKAKAETIFSDALYV  159



>ref|XP_010247794.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Nelumbo nucifera]
Length=351

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF + + TGRFCNGKLATD  A+T
Sbjct  24   QPLVPALCIFGDSVVDVGNNNNLLTLVKANFPPYGRDFTTQRATGRFCNGKLATDFAAET  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF++Y  AYLS +ATG NLLIGANFASAASGY ++TA L +AIPL+QQ+EYY+EYQ K+
Sbjct  84   LGFTTYQPAYLSQEATGSNLLIGANFASAASGYYDRTAQLYDAIPLTQQLEYYREYQKKV  143

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   AASI  DA+Y+
Sbjct  144  VKIAGRSNAASIFSDAIYL  162



>ref|XP_009337386.1| PREDICTED: GDSL esterase/lipase At5g22810 [Pyrus x bretschneideri]
Length=350

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 114/141 (81%), Gaps = 2/141 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++T+ KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  21   QPLVPAMFVFGDSVVDAGNNNHLYTLIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  80

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANF SA SGY E TA L NAI L+QQ++YYKEYQ K+
Sbjct  81   LGFTSYPPAYLSKEANGKNLLIGANFGSAGSGYYEYTAKLYNAISLNQQLKYYKEYQNKV  140

Query  461  AGVAGSKKA--ASIIKDALYI  517
              +A + KA   SII DA+Y+
Sbjct  141  VRIAAANKANFTSIISDAIYL  161



>ref|XP_002527431.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34923.1| zinc finger protein, putative [Ricinus communis]
Length=359

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++TI KA++PPYGRDFA+H+ TGRFCNGKLA+D TA+ 
Sbjct  32   QPLVPAMFIFGDSVVDAGNNNHLYTIVKANFPPYGRDFANHKSTGRFCNGKLASDFTAEN  91

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SYP AYLS +A G NLLIGANFAS ASG+ + TA L +AI L+QQ+EYYKEYQ K+
Sbjct  92   IGFTSYPPAYLSKEAEGTNLLIGANFASGASGFYDSTAKLYHAISLTQQLEYYKEYQRKI  151

Query  461  AGVAGSKKAASIIKDALYI  517
             G+AG   A+SII  A+Y+
Sbjct  152  VGIAGKSNASSIISGAIYL  170



>gb|KJB56728.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=345

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 11/137 (8%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA    
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITA----  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
                   YLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  87   -------YLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  139

Query  467  VAGSKKAASIIKDALYI  517
            VAGS K+ASI KDALY+
Sbjct  140  VAGSTKSASITKDALYV  156



>ref|XP_011089987.1| PREDICTED: GDSL esterase/lipase At5g22810 [Sesamum indicum]
Length=338

 Score =   194 bits (492),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDS VDVGNNN + TI KA++PPYGRDF  H+PTGRFCNGKLA+D TA+ 
Sbjct  11   QPLVPALLIFGDSVVDVGNNNNLETIVKANFPPYGRDFIKHKPTGRFCNGKLASDFTAEN  70

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS QA GKNLLIGANFAS +SGY + TA + N IPLS+QVE YKEYQ KL
Sbjct  71   LGFTSYPPAYLSKQARGKNLLIGANFASGSSGYYDTTAKIYNTIPLSKQVELYKEYQKKL  130

Query  461  AGVAGSKKAASIIKDALY  514
              + G   A+SI+  +++
Sbjct  131  VALVGQSNASSIVNGSVH  148



>gb|KJB09007.1| hypothetical protein B456_001G118700 [Gossypium raimondii]
Length=293

 Score =   192 bits (488),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++TI KAD+PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDVGNNNNLYTIIKADFPPYGRDFLNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+ YP AYLS +A G NLLIGANFASA+SGY E TA L + + LS+Q+E YK+YQ KL
Sbjct  84   IGFTDYPPAYLSKKAKGNNLLIGANFASASSGYYETTAKLYHTLSLSKQLENYKQYQNKL  143

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A+SI+ D +Y+
Sbjct  144  VAIAGKSNASSIVSDGIYL  162



>ref|XP_008366379.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Malus domestica]
Length=350

 Score =   193 bits (491),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++T+ KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  21   QPLVPAMFIFGDSVVDAGNNNHLYTVIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  80

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A G NLLIGANF SA SGY E TA L + I L+QQ+EYYKEYQ K+
Sbjct  81   LGFTSYPPAYLSKEANGTNLLIGANFGSAGSGYYEYTAKLYDVISLNQQLEYYKEYQNKV  140

Query  461  AGVAGSKKA--ASIIKDALYI  517
             G+A   KA   SII DA+Y+
Sbjct  141  VGIAARNKANFTSIISDAVYL  161



>ref|XP_009796088.1| PREDICTED: GDSL esterase/lipase At5g22810 [Nicotiana sylvestris]
Length=352

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY+ TI KA++PPYGRDF  H PTGRFCNGKLA+D TA+ 
Sbjct  25   QPLVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKHTPTGRFCNGKLASDFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + TA L +AIPLS+Q+E+YKEYQ K+
Sbjct  85   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTARLYDAIPLSKQLEFYKEYQKKV  144

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A SII  ++++
Sbjct  145  VVIAGKVNATSIINGSIHL  163



>ref|XP_007015991.1| GDSL esterase/lipase isoform 1 [Theobroma cacao]
 gb|EOY33610.1| GDSL esterase/lipase isoform 1 [Theobroma cacao]
Length=355

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  28   QPLVPAMFIFGDSVVDAGNNNNLYTIIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  87

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SYP AYLS QA GKNLLIGANFASA+SGY E TA L + + LS+Q+E YKEYQ KL
Sbjct  88   IGFTSYPPAYLSKQAEGKNLLIGANFASASSGYYETTAKLYHTLSLSKQLENYKEYQNKL  147

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A+SII   +Y+
Sbjct  148  VAIAGKSNASSIISGGIYL  166



>gb|KHG22657.1| hypothetical protein F383_04802 [Gossypium arboreum]
Length=307

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++TI KAD+PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDVGNNNNLYTIIKADFPPYGRDFLNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+ YP AYLS +A G NLLIGANFASA+SGY E TA L + + LS+Q+E YK+YQ KL
Sbjct  84   IGFTDYPPAYLSKKAKGNNLLIGANFASASSGYYETTAKLYHTLSLSKQLENYKQYQNKL  143

Query  461  AGVAGSKKAASIIKDALYI  517
              + G   A+SII D +Y+
Sbjct  144  VAIVGKSNASSIISDGIYL  162



>ref|XP_002436480.1| hypothetical protein SORBIDRAFT_10g003420 [Sorghum bicolor]
 gb|EER87847.1| hypothetical protein SORBIDRAFT_10g003420 [Sorghum bicolor]
Length=346

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QP+VPA+I+FGDS++DVGNNNY+   +FKADY PYG+DF SH+ TGRF +GK+ TDITA+
Sbjct  17   QPIVPAVISFGDSTIDVGNNNYLPGAVFKADYAPYGQDFVSHEATGRFSDGKIVTDITAE  76

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            TLGF SY   YLSPQA+GKNLLIGANFASAAS Y + TA + +AI L+QQ++YYKEYQ K
Sbjct  77   TLGFESYAPPYLSPQASGKNLLIGANFASAASSYYDDTAAMYDAITLTQQLKYYKEYQSK  136

Query  458  LAGVAGSKKAASIIKDALYI  517
            L  VAG  KA +I+ DALY+
Sbjct  137  LGAVAGRAKAGAILADALYV  156



>gb|KJB09006.1| hypothetical protein B456_001G118700 [Gossypium raimondii]
Length=351

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++TI KAD+PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDVGNNNNLYTIIKADFPPYGRDFLNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+ YP AYLS +A G NLLIGANFASA+SGY E TA L + + LS+Q+E YK+YQ KL
Sbjct  84   IGFTDYPPAYLSKKAKGNNLLIGANFASASSGYYETTAKLYHTLSLSKQLENYKQYQNKL  143

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A+SI+ D +Y+
Sbjct  144  VAIAGKSNASSIVSDGIYL  162



>ref|XP_004964856.1| PREDICTED: GDSL esterase/lipase APG-like [Setaria italica]
Length=357

 Score =   191 bits (484),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QPLVPA+I+FGDS++DVGNNNY+   +FKADY PYG +F   +PTGRF +GK+ TDITA+
Sbjct  28   QPLVPAVISFGDSTIDVGNNNYLPRAVFKADYAPYGENFVRQEPTGRFSDGKIVTDITAE  87

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            TLGF SY   YLSPQA+GKNLLIGANFASAAS Y + TA + +AI L+QQ++YYKEYQ K
Sbjct  88   TLGFESYAPPYLSPQASGKNLLIGANFASAASSYYDDTAAVYDAITLTQQLKYYKEYQSK  147

Query  458  LAGVAGSKKAASIIKDALYI  517
            LA VAG  KA SI+  ALY+
Sbjct  148  LAAVAGRAKARSILTGALYV  167



>ref|XP_004295642.1| PREDICTED: GDSL esterase/lipase At5g22810 [Fragaria vesca subsp. 
vesca]
Length=353

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN + T+ K+++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  26   QPLVPAMFIFGDSVVDVGNNNDLLTLVKSNFPPYGRDFINHNPTGRFCNGKLASDFTAEN  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SY  AYLS +ATGKNLLIGANFASA SGY E TA L  AI LSQQV+YYKEYQ K+
Sbjct  86   LGFTSYQPAYLSGEATGKNLLIGANFASAGSGYYEATAKLFGAISLSQQVQYYKEYQNKV  145

Query  461  AGVAGSKKAASIIKDALYI  517
             G+ G   A  II  A+Y+
Sbjct  146  RGIGGKVNATLIISGAIYL  164



>gb|KDO38511.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=340

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 110/138 (80%), Gaps = 19/138 (14%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD      
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDF-----  87

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
                          TGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  88   --------------TGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  133

Query  464  GVAGSKKAASIIKDALYI  517
             VAGSK++ASIIKDA+YI
Sbjct  134  KVAGSKQSASIIKDAIYI  151



>ref|XP_010689974.1| PREDICTED: GDSL esterase/lipase At5g22810 [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QP+VPA+  FGDS VDVGNNN +HTI K+D+ PYGRDF+ HQPTGRFCNGKLATD TA+T
Sbjct  27   QPIVPALFIFGDSVVDVGNNNNLHTIVKSDFLPYGRDFSYHQPTGRFCNGKLATDFTAET  86

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SY  AYLS +ATG+NLLIGANFASA+SGY   T  + N IPLS+Q+E+Y +YQ KL
Sbjct  87   IGFTSYQPAYLSTEATGENLLIGANFASASSGYHASTPKIYNTIPLSEQLEHYMDYQKKL  146

Query  461  AGVAGSKKAASIIKDALYI  517
              VAG   A  II   +Y+
Sbjct  147  ELVAGQDNATLIITQGIYL  165



>ref|XP_006349065.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Solanum tuberosum]
Length=353

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY+ TI KA++PPYGRDF    PTGRFCNGKLA+D TA+ 
Sbjct  26   QPLVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKQIPTGRFCNGKLASDFTAEN  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + T+ L +AIPLS+Q+EYYKEYQ KL
Sbjct  86   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTSRLYDAIPLSKQLEYYKEYQKKL  145

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A SII  ++++
Sbjct  146  VVIAGKLNATSIINGSIHL  164



>ref|XP_008226994.1| PREDICTED: GDSL esterase/lipase At5g22810 [Prunus mume]
Length=351

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN V TI KA++ PYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPALFLFGDSVVDAGNNNNVETIIKANFNPYGRDFVNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANFASA SGY + TA L + I L+QQ+E YKEYQ K+
Sbjct  84   LGFTSYPPAYLSKEAAGKNLLIGANFASAGSGYYDSTAKLYHTISLNQQLENYKEYQNKV  143

Query  461  AGVAGSKKAASIIKDALYI  517
             G+AG     SII  A+Y+
Sbjct  144  LGIAGKANLTSIISGAIYL  162



>ref|XP_003540212.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Glycine max]
Length=350

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTIVKANFPPYGRDFKNHNPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKECQNIL  142

Query  461  AGVAGSKKAASIIKDALYI  517
             G  G   A+SII  ++Y+
Sbjct  143  VGTVGQSNASSIISGSIYL  161



>ref|XP_007132365.1| hypothetical protein PHAVU_011G088700g [Phaseolus vulgaris]
 gb|ESW04359.1| hypothetical protein PHAVU_011G088700g [Phaseolus vulgaris]
Length=365

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+  T+ KA++PPYGRD+ +H PTGRFCNGKLATD TA+ 
Sbjct  38   QPLVPALFIFGDSVVDVGNNNHQITVIKANFPPYGRDYENHDPTGRFCNGKLATDFTAEV  97

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+S P AYL+    G NLL GANFASA+SGY E TA L N IPLSQQ+EYYKE Q KL
Sbjct  98   LGFTSSPPAYLNLNTKGNNLLNGANFASASSGYYEPTAKLYNTIPLSQQLEYYKECQNKL  157

Query  461  AGVAGSKKAASIIKDALYI  517
               AG   A+SII DA+Y+
Sbjct  158  VEAAGKSNASSIISDAIYL  176



>ref|XP_009625753.1| PREDICTED: GDSL esterase/lipase At5g22810 isoform X2 [Nicotiana 
tomentosiformis]
Length=352

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QP VPA+  FGDS VD GNNNY+ TI KA++PPYGRDF  H PTGRFCNGKLA+D TA+ 
Sbjct  25   QPSVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKHIPTGRFCNGKLASDFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + T+ L +AIPLS+Q+E+YKEYQ KL
Sbjct  85   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTSRLYDAIPLSKQLEFYKEYQKKL  144

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A SII  ++++
Sbjct  145  VVIAGKVNATSIINGSIHL  163



>ref|XP_003551088.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Glycine max]
Length=350

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+++T+ KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTVVKANFPPYGRDFKNHNPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKECQNIL  142

Query  461  AGVAGSKKAASIIKDALYI  517
             G  G   A+SII  A+Y+
Sbjct  143  VGTVGQPNASSIISGAIYL  161



>ref|XP_004251004.1| PREDICTED: GDSL esterase/lipase At5g22810 [Solanum lycopersicum]
Length=355

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY+ TI KA++PPYGRDF    PTGRFCNGKLA+D TA+ 
Sbjct  28   QPLVPALFIFGDSVVDAGNNNYLKTIIKANFPPYGRDFPKKIPTGRFCNGKLASDFTAEN  87

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + TA L +AIPLS+Q+EYYKEYQ KL
Sbjct  88   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTARLYDAIPLSKQLEYYKEYQKKL  147

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A+SI   ++++
Sbjct  148  VVIAGKLNASSITNASIHL  166



>gb|KHN21470.1| GDSL esterase/lipase [Glycine soja]
Length=359

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+++T+ KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTVVKANFPPYGRDFKNHNPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKECQNIL  142

Query  461  AGVAGSKKAASIIKDALYI  517
             G  G   A+SII  A+Y+
Sbjct  143  VGTVGQPNASSIISGAIYL  161



>emb|CBI17099.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS+VD GNNN++ TI KA++PPYGRDF SH+PTGRFCNGKLA+D TA+ 
Sbjct  699  QPLVPAMFIFGDSAVDAGNNNHLDTIVKANFPPYGRDFISHKPTGRFCNGKLASDFTAEN  758

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SYP AYLS +A G NLLIGANFASAASGY   TA LSNAI LS+Q+EY+KEYQ ++
Sbjct  759  IGFTSYPPAYLSKEAKGNNLLIGANFASAASGYYHTTAKLSNAISLSKQLEYFKEYQERV  818

Query  461  AGVAGSKKAASIIKDALYI  517
            A + G   A+SII  A+Y+
Sbjct  819  AKIVGKSNASSIISGAVYL  837



>gb|AFK42211.1| unknown [Lotus japonicus]
Length=350

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN + TI K+++ PYGRDF +HQPTGRFCNGKLATD+TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNQLPTIVKSNFLPYGRDFQNHQPTGRFCNGKLATDLTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AY++ +  G NLL GANFAS ASGY E TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYMNLKTKGNNLLNGANFASGASGYYEPTAKLYHAIPLSQQLEHYKESQNIL  142

Query  461  AGVAGSKKAASIIKDALYI  517
             GVAG   A+SII  A+Y+
Sbjct  143  VGVAGKSNASSIISGAIYL  161



>ref|XP_007150122.1| hypothetical protein PHAVU_005G128600g [Phaseolus vulgaris]
 gb|ESW22116.1| hypothetical protein PHAVU_005G128600g [Phaseolus vulgaris]
Length=350

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS  DVGNNN + TI KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVFDVGNNNQLSTIVKANFPPYGRDFNNHTPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYL+ +  GKNLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKVKGKNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKESQNIL  142

Query  461  AGVAGSKKAASIIKDALYI  517
             G+AG   A+SII  A+Y+
Sbjct  143  MGIAGQSNASSIISGAIYL  161



>ref|XP_006424380.1| hypothetical protein CICLE_v10027727mg [Citrus clementina]
 gb|ESR37620.1| hypothetical protein CICLE_v10027727mg [Citrus clementina]
Length=1058

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY++TI KA++ PYGRDF  H+PTGRFCNGKLA D TA+ 
Sbjct  731  QPLVPAMFIFGDSVVDAGNNNYIYTIVKANFRPYGRDFVHHKPTGRFCNGKLAADFTAEN  790

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SYP AYLS +A GKNLLIGANFAS ASGY E TA L +AIPLSQQ+E++K+YQ KL
Sbjct  791  IGFTSYPPAYLSEEAKGKNLLIGANFASGASGYYETTAKLYHAIPLSQQLEHFKDYQRKL  850

Query  461  AGVAGSKKAASIIKDALYI  517
             G+AG   A+SII   L +
Sbjct  851  EGIAGKTNASSIISGGLCL  869



>gb|KHN27690.1| GDSL esterase/lipase [Glycine soja]
Length=345

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+++TI KA++PPYGRD  +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTIVKANFPPYGRDLKNHNPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKECQNIL  142

Query  461  AGVAGSKKAASIIKDALYI  517
             G  G   A+SII  ++Y+
Sbjct  143  VGTVGQSNASSIISGSIYL  161



>ref|XP_002515937.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF46357.1| zinc finger protein, putative [Ricinus communis]
Length=369

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 118/151 (78%), Gaps = 14/151 (9%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATD-------  265
            + PAI  FGDS++DVGNNNY+ T +KA+YPPYGRDFASH+PTGRFC+GK           
Sbjct  28   IFPAIFTFGDSAMDVGNNNYLSTFYKANYPPYGRDFASHEPTGRFCDGKXDLLDRSYLFC  87

Query  266  -------ITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQ  424
                   + A+TLGF +Y  AYLSP A+G+NLLIGA+FASAASGYD+K+++ ++AI L Q
Sbjct  88   SCMNQFLLAAETLGFKTYAPAYLSPDASGENLLIGASFASAASGYDDKSSIRNHAITLPQ  147

Query  425  QVEYYKEYQGKLAGVAGSKKAASIIKDALYI  517
            Q++Y+KEYQ KLA VAGSKK+A+IIKDALY+
Sbjct  148  QLQYFKEYQSKLAKVAGSKKSATIIKDALYL  178



>ref|XP_009397028.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Musa acuminata 
subsp. malaccensis]
Length=347

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP +I FGDS VD GNNN++ T+ +A++PPYGRDFA H PTGRFCNGKLATD T + 
Sbjct  20   QGLVPGVIIFGDSVVDAGNNNHLSTLVRANFPPYGRDFAQHSPTGRFCNGKLATDFTVEN  79

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS  ATG NLL GANFASAASGY + TA L  AI L+QQ++YYKEYQ K+
Sbjct  80   LGFTSYPPAYLSQDATGNNLLHGANFASAASGYLDSTANLYQAISLTQQLQYYKEYQSKV  139

Query  461  AGVAGSKKAASIIKDALYI  517
              VAG  KAA++   A+Y+
Sbjct  140  ERVAGKPKAAALFAGAIYL  158



>ref|XP_002873116.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49375.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=343

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN+++T+ KA++PPYGRDF +H  TGRF NGKLATD TA++
Sbjct  15   QPLVPALIIMGDSVVDAGNNNHLNTLVKANFPPYGRDFFAHNATGRFSNGKLATDFTAES  74

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYPVAYLS +A G NLL GANFAS ASG+D+ TAL  NAI L+QQ+E YKEYQ K+
Sbjct  75   LGFTSYPVAYLSQEANGTNLLTGANFASGASGFDDGTALFYNAITLNQQLENYKEYQNKV  134

Query  461  AGVAGSKKAASIIKDALYI  517
              + G ++A  I   A+++
Sbjct  135  TNIVGRERANEIFSGAIHL  153



>ref|XP_002872020.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48279.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=337

 Score =   185 bits (470),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ 
Sbjct  7    QPLVPAMFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAEN  66

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  67   LGFTSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  126

Query  461  AGVAGSK---KAASIIKDALYI  517
              +A S     A+SII + +YI
Sbjct  127  QEIATSNNNANASSIISNGIYI  148



>ref|XP_004156262.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Cucumis sativus]
Length=351

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H PTGRFCNGKLATDITA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLLTVVKANFPPYGRDFVTHAPTGRFCNGKLATDITAELL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GFSSYP AYLS  ATG  LL GANFASAASG+ + TA L +A+ L+QQ+ YYKEYQ K+ 
Sbjct  86   GFSSYPPAYLSQDATGNKLLTGANFASAASGFYDGTAQLYHAVSLTQQLNYYKEYQSKVV  145

Query  464  GVAGSKKAASIIKDALYI  517
             + G++KA +I   A+++
Sbjct  146  NMVGTEKANAIFSGAIHL  163



>ref|XP_004143292.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Cucumis sativus]
 gb|KGN48218.1| hypothetical protein Csa_6G449250 [Cucumis sativus]
Length=351

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H PTGRFCNGKLATDITA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLLTVVKANFPPYGRDFVTHAPTGRFCNGKLATDITAELL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GFSSYP AYLS  ATG  LL GANFASAASG+ + TA L +A+ L+QQ+ YYKEYQ K+ 
Sbjct  86   GFSSYPPAYLSQDATGNKLLTGANFASAASGFYDGTAQLYHAVSLTQQLNYYKEYQSKVV  145

Query  464  GVAGSKKAASIIKDALYI  517
             + G++KA +I   A+++
Sbjct  146  NMVGTEKANAIFSGAIHL  163



>ref|XP_006482367.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Citrus sinensis]
Length=347

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  20   QPLVPALIIFGDSIVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  79

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A G  LL G NFASAASG  ++TA L  AIPL+QQ+ YYKEYQ K+
Sbjct  80   LGFTSYPPAYLSQEAKGNILLTGVNFASAASGLYDRTAQLYRAIPLTQQLNYYKEYQNKV  139

Query  461  AGVAGSKKAASIIKDALYI  517
              + G +KA +I    +++
Sbjct  140  VSMVGKEKANAIFSGGVHL  158



>ref|NP_197672.1| GDSL esterase/lipase [Arabidopsis thaliana]
 dbj|BAB10602.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
 gb|AED93082.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=337

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPAI  FGDS VDVGNNN ++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ 
Sbjct  7    QPLVPAIFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAEN  66

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  67   LGFKSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  126

Query  461  AGVAGSK---KAASIIKDALYI  517
              +A S     A++II + +YI
Sbjct  127  QEIATSNNNSNASAIISNGIYI  148



>ref|XP_010558217.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Tarenaya hassleriana]
Length=354

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VDVGNNN ++T+ KA++PPYGRDFASH PTGRFCNGKLATD TAD 
Sbjct  26   QPLVPALIIMGDSVVDVGNNNNLNTLVKANFPPYGRDFASHIPTGRFCNGKLATDFTADF  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF SYP AYLS +A GKNLL GANFAS ASG D+ TA + NAI L+QQ+  YKEYQ K+
Sbjct  86   LGFPSYPPAYLSREARGKNLLTGANFASGASGLDDGTARIYNAISLNQQLNNYKEYQSKV  145

Query  461  AGVAGSKKAASIIKDALYI  517
              + G  +A  I    +++
Sbjct  146  TSMVGRARANEIFAGGIHL  164



>ref|XP_009625752.1| PREDICTED: GDSL esterase/lipase At5g22810 isoform X1 [Nicotiana 
tomentosiformis]
Length=353

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITA-D  277
            QP VPA+  FGDS VD GNNNY+ TI KA++PPYGRDF  H PTGRFCNGKLA+D TA +
Sbjct  25   QPSVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKHIPTGRFCNGKLASDFTAAE  84

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
             LGF+SYP AYLS +A GKNLLIGANFAS +SGY + T+ L +AIPLS+Q+E+YKEYQ K
Sbjct  85   NLGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTSRLYDAIPLSKQLEFYKEYQKK  144

Query  458  LAGVAGSKKAASIIKDALYI  517
            L  +AG   A SII  ++++
Sbjct  145  LVVIAGKVNATSIINGSIHL  164



>gb|KDO60993.1| hypothetical protein CISIN_1g036829mg [Citrus sinensis]
Length=347

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  20   QPLVPALIIFGDSIVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  79

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A G  LL G NFASAASG  ++TA L  AIPL+QQ+ YYKEYQ K+
Sbjct  80   LGFTSYPPAYLSQEAKGNILLTGVNFASAASGLYDRTAQLYRAIPLTQQLNYYKEYQNKV  139

Query  461  AGVAGSKKAASIIKDALYI  517
              + G +KA +I    +++
Sbjct  140  VSMVGKEKANAIFSGGVHL  158



>sp|Q9FFC6.3|GDL78_ARATH RecName: Full=GDSL esterase/lipase At5g22810; AltName: Full=Extracellular 
lipase At5g22810; Flags: Precursor [Arabidopsis 
thaliana]
Length=362

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPAI  FGDS VDVGNNN ++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ 
Sbjct  32   QPLVPAIFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAEN  91

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  92   LGFKSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  151

Query  461  AGVAGSK---KAASIIKDALYI  517
              +A S     A++II + +YI
Sbjct  152  QEIATSNNNSNASAIISNGIYI  173



>ref|XP_006430343.1| hypothetical protein CICLE_v10013829mg [Citrus clementina]
 gb|ESR43583.1| hypothetical protein CICLE_v10013829mg [Citrus clementina]
Length=347

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  20   QPLVPALIIFGDSIVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  79

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A G  LL G NFASAASG  ++TA L  AIPL+QQ+ YYKEYQ K+
Sbjct  80   LGFTSYPPAYLSQEAKGNILLSGVNFASAASGLYDRTAQLYRAIPLTQQLNYYKEYQNKV  139

Query  461  AGVAGSKKAASIIKDALYI  517
              + G +KA +I    +++
Sbjct  140  VSMVGKEKANAIFSGGVHL  158



>gb|KFK27616.1| hypothetical protein AALP_AA8G406700 [Arabis alpina]
Length=364

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP++  FGDS VDVGNNN ++TI KA++PPYGRDF  HQPTGRFCNGKLATD TA+ 
Sbjct  34   QSLVPSMFIFGDSVVDVGNNNNIYTIVKANFPPYGRDFTRHQPTGRFCNGKLATDFTAEN  93

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L+QQ+E+YK+Y  ++
Sbjct  94   LGFTSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLAQQLEHYKDYTNRI  153

Query  461  AGVAGSK---KAASIIKDALYI  517
              +A S     A SII + +YI
Sbjct  154  QEMAISNNTINATSIISNGIYI  175



>ref|XP_010098864.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB75952.1| GDSL esterase/lipase [Morus notabilis]
Length=353

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVP ++ FGDS VD GNNNY++T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  28   PLVPGLMIFGDSVVDTGNNNYLYTLVKANFPPYGRDFVTHKPTGRFCNGKLATDFTAEYL  87

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLSP+A GK LL GANFAS ASGY ++TA L  AI L+QQ+ YYK YQ K+ 
Sbjct  88   GFTSYPPAYLSPEAKGKKLLTGANFASGASGYYDRTAQLYRAISLTQQLNYYKAYQDKVV  147

Query  464  GVAGSKKAASIIKDALYI  517
             + G  KA  +   A+++
Sbjct  148  NMVGQAKANDLFSGAIHL  165



>ref|XP_010558978.1| PREDICTED: GDSL esterase/lipase At3g53100 [Tarenaya hassleriana]
Length=351

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q +VPAII FGDS VDVGNNN++ TI K+++PPYGRDF +  PTGRFCNGKLA D +A+ 
Sbjct  24   QSIVPAIIIFGDSIVDVGNNNFLLTIVKSNFPPYGRDFINRTPTGRFCNGKLAVDFSAEY  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
             GFSSYP AYLSPQATG+NLLIGANFASA+SGY + TA L  +IPL++Q+ YYKEYQ K+
Sbjct  84   TGFSSYPPAYLSPQATGQNLLIGANFASASSGYYDATAALFGSIPLTRQLNYYKEYQHKV  143

Query  461  AGVAGSKKAASIIKDALYI  517
              + G+ +A ++   A+++
Sbjct  144  TNMIGTNRAHNLFSKAIHL  162



>ref|XP_010493379.1| PREDICTED: GDSL esterase/lipase At5g22810 [Camelina sativa]
Length=361

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VDVGNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  31   QPLVPSMFIFGDSVVDVGNNNEIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLL GANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  91   LGFTSYPQAYLSKKAKGKNLLTGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  150

Query  461  AGVAGSK---KAASIIKDALYI  517
              +A S     A++II D +YI
Sbjct  151  QEIAVSNNNANASAIISDGIYI  172



>ref|XP_008462518.1| PREDICTED: GDSL esterase/lipase At5g03820 [Cucumis melo]
Length=351

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLLTVVKANFPPYGRDFVTHTPTGRFCNGKLATDFTAENL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GFSSYP AYLS  ATG  LL GANFASAASG+ + TA L +A+ L+QQ+ YYKEYQ K+ 
Sbjct  86   GFSSYPPAYLSQDATGNKLLTGANFASAASGFYDGTAQLYHAVSLTQQLNYYKEYQSKVV  145

Query  464  GVAGSKKAASIIKDALYI  517
             + G++KA +I   A+++
Sbjct  146  NMVGTEKANAIFSGAIHL  163



>gb|KCW89297.1| hypothetical protein EUGRSUZ_A01587, partial [Eucalyptus grandis]
Length=331

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN ++T+ KA++PPYGRDFASH PTGRFCNGKLATD TA+ L
Sbjct  5    PLVPALCIFGDSVVDAGNNNDLYTLVKANFPPYGRDFASHNPTGRFCNGKLATDFTAENL  64

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SY  AYLS +ATGKNLLIGANFASAASGY ++TA L  +I L QQ+  YK++Q K+ 
Sbjct  65   GFTSYQPAYLSREATGKNLLIGANFASAASGYLDRTAQLYQSISLPQQLNNYKDWQSKVV  124

Query  464  GVAGSKKAASIIKDALYI  517
             + G +KA +I   A+++
Sbjct  125  SMVGRRKANAIFSGAIHL  142



>ref|XP_007207052.1| hypothetical protein PRUPE_ppa007967mg [Prunus persica]
 gb|EMJ08251.1| hypothetical protein PRUPE_ppa007967mg [Prunus persica]
Length=350

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN V TI KA++PPYGRDF++H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPALFLFGDSVVDAGNNNNVKTIIKANFPPYGRDFSNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LG   YP AYLS +A GKNLLIGANFASA SGY + TA L + I L+QQ+E YKEYQ K+
Sbjct  84   LGL-YYPPAYLSKEAAGKNLLIGANFASAGSGYYDSTAKLYHTISLNQQLENYKEYQNKV  142

Query  461  AGVAGSKKAASIIKDALYI  517
             G+AG     SII  A+Y+
Sbjct  143  VGIAGKANLTSIISGAVYL  161



>ref|XP_010050200.1| PREDICTED: GDSL esterase/lipase At5g03820 [Eucalyptus grandis]
Length=351

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN ++T+ KA++PPYGRDFASH PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNDLYTLVKANFPPYGRDFASHNPTGRFCNGKLATDFTAENL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SY  AYLS +ATGKNLLIGANFASAASGY ++TA L  +I L QQ+  YK++Q K+ 
Sbjct  85   GFTSYQPAYLSREATGKNLLIGANFASAASGYLDRTAQLYQSISLPQQLNNYKDWQSKVV  144

Query  464  GVAGSKKAASIIKDALYI  517
             + G +KA +I   A+++
Sbjct  145  SMVGRRKANAIFSGAIHL  162



>ref|XP_006289497.1| hypothetical protein CARUB_v10003031mg [Capsella rubella]
 gb|EOA22395.1| hypothetical protein CARUB_v10003031mg [Capsella rubella]
Length=337

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS  DVGNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  7    QPLVPSMFIFGDSVADVGNNNDIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  66

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A G+NLLIGANFASAASGY + TA L  AI L QQ+E+YK+Y  ++
Sbjct  67   LGFTSYPQAYLSKKAKGRNLLIGANFASAASGYYDDTAKLYGAISLPQQLEHYKDYTSRI  126

Query  461  AGVAGSK---KAASIIKDALYI  517
              +A S     A+SII + +YI
Sbjct  127  QDLATSNNNVNASSIISNGIYI  148



>ref|XP_010045272.1| PREDICTED: GDSL esterase/lipase At5g22810 [Eucalyptus grandis]
 gb|KCW87433.1| hypothetical protein EUGRSUZ_B03904 [Eucalyptus grandis]
Length=361

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VD GNNN+++TI KA++PPYGRDF  HQPTGRFCNGK A D TA+ 
Sbjct  28   QPLVPSMFVFGDSVVDTGNNNHLYTIVKANFPPYGRDFIKHQPTGRFCNGKTAADFTAEN  87

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            +GF+SYP AYLS +A GK+LLIGANFASA+SGY + TA L + I L++Q++YYKEYQ K+
Sbjct  88   IGFTSYPPAYLSQKAKGKHLLIGANFASASSGYYDSTAKLYHTISLTEQLKYYKEYQNKI  147

Query  461  AGVAGSKKA--ASIIKDALYI  517
              +A   KA   +II D LY+
Sbjct  148  IRIAAKYKANVTAIISDGLYL  168



>ref|XP_009340968.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Pyrus x bretschneideri]
Length=350

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            +PLVPA+I FGDS  DVGNNN + T  KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  24   EPLVPALIIFGDSVADVGNNNNLTTPIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLSP+A G+NLL G NFASAASGY + T  L NA+ L+QQ+ YY++YQ  +
Sbjct  84   LGFTSYPPAYLSPEAKGQNLLTGVNFASAASGYWDYTPFLYNALSLTQQLNYYRQYQNAV  143

Query  461  AGVAGSKKAASIIKDALYI  517
              + GS  A++I   A+++
Sbjct  144  VSMVGSDNASAIFSGAIHL  162



>emb|CDY09169.1| BnaA02g05950D [Brassica napus]
Length=361

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ LG
Sbjct  34   LVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAENLG  93

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+SYP AYLS +A G+NLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++  
Sbjct  94   FTSYPQAYLSKKAKGRNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYINRIQE  153

Query  467  VAGSK--KAASIIKDALYI  517
            +A S    A SII D +Y+
Sbjct  154  IATSNNANATSIISDGIYV  172



>ref|XP_007027551.1| GDSL-like Lipase/Acylhydrolase family protein [Theobroma cacao]
 gb|EOY08053.1| GDSL-like Lipase/Acylhydrolase family protein [Theobroma cacao]
Length=465

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN ++T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  139  PLVPAVIIFGDSVVDVGNNNNLNTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  198

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS  A G +LL GANFASAASG  ++TA L  AIPL+QQ+ YYKEYQ K+ 
Sbjct  199  GFTSYPPAYLSRDARGNDLLTGANFASAASGLYDRTANLYRAIPLTQQLNYYKEYQTKVV  258

Query  464  GVAGSKKAASIIKDALYI  517
               G  KA  I   A+++
Sbjct  259  NTVGKAKANDIFAGAIHL  276



>emb|CDY50286.1| BnaC02g45410D [Brassica napus]
Length=360

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ LG
Sbjct  33   LVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAENLG  92

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+SYP AYLS +A G+NLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++  
Sbjct  93   FTSYPQAYLSKKAKGRNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYINRIQE  152

Query  467  VAGSK--KAASIIKDALYI  517
            +A S    A SII D +Y+
Sbjct  153  IATSSNANATSIISDGIYV  171



>ref|XP_002284087.2| PREDICTED: GDSL esterase/lipase At5g03820-like [Vitis vinifera]
Length=351

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNNLATLVKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP  YLS +A GKNLL GANFASA+SGY ++TA L  AI L+QQVEYYKEYQ K+ 
Sbjct  85   GFTSYPPPYLSQEAQGKNLLQGANFASASSGYYDRTAQLYRAISLTQQVEYYKEYQAKVV  144

Query  464  GVAGSKKAASIIKDALYI  517
             + G  +A  I    +++
Sbjct  145  RLVGKARAHDIFSGGIHL  162



>ref|NP_196002.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LZC5.1|GDL73_ARATH RecName: Full=GDSL esterase/lipase At5g03820; AltName: Full=Extracellular 
lipase At5g03820; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB85502.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08608.1| proline-rich protein APG-like [Arabidopsis thaliana]
 gb|AED90658.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=354

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            +PLVPA+I  GDS VD GNNN ++T+ KA++PPYGRDF +H  TGRF NGKLATD TA++
Sbjct  25   EPLVPALIIMGDSVVDAGNNNRLNTLIKANFPPYGRDFLAHNATGRFSNGKLATDFTAES  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYPV YLS +A G NLL GANFAS ASGYD+ TA+  NAI L+QQ++ YKEYQ K+
Sbjct  85   LGFTSYPVPYLSQEANGTNLLTGANFASGASGYDDGTAIFYNAITLNQQLKNYKEYQNKV  144

Query  461  AGVAGSKKAASIIKDALYI  517
              + GS++A  I   A+++
Sbjct  145  TNIVGSERANKIFSGAIHL  163



>ref|XP_004487544.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cicer arietinum]
Length=351

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN ++T+ K+++PPYGRDF  H PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPALFIFGDSVVDAGNNNNLYTVVKSNFPPYGRDFKDHMPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF++YP AYL+ +  GKNLL GANFASAASGY + TA L +AI +++Q+E+YK+ Q  L
Sbjct  84   LGFTTYPPAYLNLEVKGKNLLNGANFASAASGYYDSTAKLYHAISMTEQLEHYKDCQNIL  143

Query  461  AGVAGSKKAASIIKDALYI  517
             GVAG   A+SII  A+Y+
Sbjct  144  VGVAGKSNASSIISGAVYL  162



>emb|CBI30208.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNNLATLVKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP  YLS +A GKNLL GANFASA+SGY ++TA L  AI L+QQVEYYKEYQ K+ 
Sbjct  85   GFTSYPPPYLSQEAQGKNLLQGANFASASSGYYDRTAQLYRAISLTQQVEYYKEYQAKVV  144

Query  464  GVAGSKKAASIIKDALYI  517
             + G  +A  I    +++
Sbjct  145  RLVGKARAHDIFSGGIHL  162



>ref|XP_004303055.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Fragaria vesca 
subsp. vesca]
Length=350

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALFIFGDSVVDVGNNNNLSTVIKANFPPYGRDFVNHKPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF++Y  AYLS +A+GKNLL GANFASAASG+ + TALL N+I L+QQ+  YKEYQ K+ 
Sbjct  86   GFTTYQPAYLSQEASGKNLLTGANFASAASGFYDPTALLYNSISLTQQLNNYKEYQSKVV  145

Query  464  GVAGSKKAASIIKDALYI  517
             + G  KA +I    +++
Sbjct  146  NLVGQTKANAIFSGGIHL  163



>gb|KHG27777.1| hypothetical protein F383_16365 [Gossypium arboreum]
Length=352

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN ++T+ K+++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALIIFGDSVVDVGNNNNLNTLIKSNFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS  A G  LL GANFASAASG  + TA L  AI L+QQ+ YY+EYQ KL 
Sbjct  86   GFTSYPPAYLSRDAIGNALLTGANFASAASGLYDSTANLYRAITLTQQLNYYREYQAKLV  145

Query  464  GVAGSKKAASIIKDALYI  517
             +AG+  A++I+  A+++
Sbjct  146  NMAGNDGASNIVSGAIHL  163



>ref|XP_006400789.1| hypothetical protein EUTSA_v10015700mg [Eutrema salsugineum]
 gb|ESQ42242.1| hypothetical protein EUTSA_v10015700mg [Eutrema salsugineum]
Length=336

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  4    QPLVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  63

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A G+NLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  64   LGFTSYPQAYLSKKAKGRNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISQI  123

Query  461  AGV-----AGSKKAASIIKDALYI  517
              +     + +    SII D +YI
Sbjct  124  QELANSNNSKNANVTSIISDGIYI  147



>gb|KEH38918.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=352

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN ++TI K+++PPYGRDF +  PTGRFCNGKLA D TA+ 
Sbjct  25   QPLVPALFIFGDSVVDAGNNNNLYTIVKSNFPPYGRDFNNQMPTGRFCNGKLAADFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF++YP AYL+ Q  GKNLL GANFAS ASGY + TA L +AI L QQ+E+YKE Q  L
Sbjct  85   LGFTTYPPAYLNLQEKGKNLLNGANFASGASGYFDPTAKLYHAISLEQQLEHYKECQNIL  144

Query  461  AGVAGSKKAASIIKDALYI  517
             GVAG   A+SII  A+Y+
Sbjct  145  VGVAGKSNASSIISGAIYL  163



>ref|XP_010495383.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Camelina sativa]
Length=184

 Score =   176 bits (445),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VDVGNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  31   QPLVPSMFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A GKNLL GANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  91   LGFTSYPQAYLSKKAKGKNLLTGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  150

Query  461  AGV  469
              +
Sbjct  151  QEI  153



>ref|XP_006338923.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum tuberosum]
Length=348

 Score =   180 bits (457),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  22   PLVPALNIFGDSVVDVGNNNNLTTLIKANFLPYGRDFVTHRPTGRFCNGKLATDFTAEYL  81

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF++YP AYLSP+A G+N+L G NFASAASGY E+T  L  A+ L+QQ++YY+E+Q K+ 
Sbjct  82   GFTTYPPAYLSPEARGRNILTGVNFASAASGYYERTPQLYRALTLAQQLQYYREWQAKVV  141

Query  464  GVAGSKKAASIIKDALYI  517
             + G  +A SII   +++
Sbjct  142  NLVGRTQANSIISGGIHL  159



>ref|XP_006398840.1| hypothetical protein EUTSA_v10013969mg [Eutrema salsugineum]
 gb|ESQ40293.1| hypothetical protein EUTSA_v10013969mg [Eutrema salsugineum]
Length=352

 Score =   180 bits (457),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN+ +T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ 
Sbjct  24   QPLVPALIIMGDSVVDAGNNNHRNTLIKANFPPYGRDFFAHNATGRFSNGKLATDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYPVAYLS +A G NLL GANFAS ASG+ + TALL NAI L+QQ++ YKEYQ K+
Sbjct  84   LGFTSYPVAYLSQEANGTNLLTGANFASGASGFHDDTALLYNAITLNQQLKNYKEYQSKV  143

Query  461  AGVAGSKKAASIIKDALYI  517
              + G  +A  I   A+++
Sbjct  144  TSMVGRDRAKEIFAGAIHL  162



>ref|XP_009126566.1| PREDICTED: GDSL esterase/lipase At5g22810 [Brassica rapa]
Length=361

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ LG
Sbjct  34   LVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAENLG  93

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+SYP AYLS +A G+NLLIGANFASAAS Y + TA L +AI L QQ+E+YK+Y  ++  
Sbjct  94   FTSYPQAYLSKKAKGRNLLIGANFASAASAYYDGTAKLYSAISLPQQLEHYKDYINRIQE  153

Query  467  VAGSK--KAASIIKDALYI  517
            +A S    A SII D +Y+
Sbjct  154  IATSNNANATSIISDGIYV  172



>ref|XP_003561180.2| PREDICTED: GDSL esterase/lipase APG-like [Brachypodium distachyon]
Length=430

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QPLVPA+I FGDS++DVGNNNY+   +FKA+Y PYG +F  H+ TGRF +GK+ +DITA+
Sbjct  98   QPLVPAMILFGDSTIDVGNNNYLPGAVFKANYAPYGDNFRRHRATGRFSDGKIVSDITAE  157

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            +LGF SY   YLSP A+GKNLL GANF SAAS Y + TA + +AI LSQQ++YYKEYQ K
Sbjct  158  SLGFVSYAPPYLSPLASGKNLLAGANFGSAASSYADDTAAMYDAITLSQQLKYYKEYQTK  217

Query  458  LAGVAGSKKAASIIKDALYI  517
            LA VAG +KA SI+ DALY+
Sbjct  218  LAAVAGRRKARSILADALYV  237



>ref|XP_004155946.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
Length=366

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PAI  FGDS++D+GNNN   T+FKA+Y PYG+DF +H+PTGRFCNGKL +DITA+TLG
Sbjct  40   IFPAIFTFGDSALDMGNNNNRFTMFKANYLPYGQDFTNHKPTGRFCNGKLVSDITAETLG  99

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +YP  YLSP+A+G+NLLIG+ FASAA+GYDE+ ++ + AI LSQQ+  YKEYQ K+A 
Sbjct  100  FQTYPPPYLSPEASGRNLLIGSGFASAAAGYDEQASISNRAITLSQQLGNYKEYQRKVAM  159

Query  467  VAGSKKAASIIKDALYI  517
            V G ++A +I+ + L+I
Sbjct  160  VVGDEEAGAIVANGLHI  176



>ref|XP_006286643.1| hypothetical protein CARUB_v10002513mg [Capsella rubella]
 gb|EOA19541.1| hypothetical protein CARUB_v10002513mg [Capsella rubella]
Length=353

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN + T+ KA++PPYGRDF +H  TGRF NGKLATD TA++
Sbjct  25   QPLVPALIIMGDSVVDAGNNNRLGTLVKANFPPYGRDFFAHNATGRFSNGKLATDFTAES  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYPVAYLS  A G NLL GANFAS ASG+ + TALL NAI L+QQ++ YKEYQ K+
Sbjct  85   LGFTSYPVAYLSQDANGTNLLTGANFASGASGFHDGTALLYNAITLNQQLKNYKEYQNKV  144

Query  461  AGVAGSKKAASIIKDALYI  517
              + G ++A  I   A+++
Sbjct  145  TNMVGRERANEIFSGAVHL  163



>gb|AFW83670.1| hypothetical protein ZEAMMB73_889110 [Zea mays]
Length=211

 Score =   174 bits (442),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  92   QPLVPALFTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  151

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALL  400
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+
Sbjct  152  LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALM  191



>ref|XP_010683957.1| PREDICTED: GDSL esterase/lipase At5g03820 [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            +PLVP +  FGDS  D GNNN ++TI KA++PPYGRDF +H PTGRFCNGK+ATD TA+ 
Sbjct  27   EPLVPILCIFGDSVADTGNNNGLYTIIKANFPPYGRDFVTHTPTGRFCNGKIATDFTAEN  86

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGFS+YP +YL+  A G NLLIGANFASA SGY E TA L  AI L+QQ+ YYKEYQ K+
Sbjct  87   LGFSAYPPSYLTQAAQGNNLLIGANFASAGSGYSETTANLYRAISLTQQLGYYKEYQSKV  146

Query  461  AGVAGSKKAASIIKDALYI  517
              + GS++A  +    ++I
Sbjct  147  TKMVGSERANKMFSGGIHI  165



>ref|XP_004145774.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cucumis sativus]
 ref|XP_004160078.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cucumis sativus]
 gb|KGN46905.1| hypothetical protein Csa_6G149950 [Cucumis sativus]
Length=348

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS +DVG NN++ T+ KA++ PYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFTFGDSVLDVGINNHLKTLIKANFLPYGRDFITHKPTGRFCNGKLASDFTAEY  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYL     GK+LLIGA+FASAASGY + TA L NA+  +QQ+E+YKEYQ K+
Sbjct  83   LGFTSYPQAYLG--GGGKDLLIGASFASAASGYLDTTAELYNALSFTQQLEHYKEYQNKV  140

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAG   A+SII  A+Y+
Sbjct  141  AEVAGKSNASSIISGAIYL  159



>ref|XP_009780981.1| PREDICTED: GDSL esterase/lipase At5g03820 [Nicotiana sylvestris]
Length=210

 Score =   174 bits (440),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHKPTGRFCNGKLATDFTAEYL  83

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS +A GK +L G NFASA+SGY E+TA L  A+ L  Q++YY+ +Q K+ 
Sbjct  84   GFTSYPPAYLSREARGKRILTGVNFASASSGYYERTAKLYRALTLPHQLKYYRVWQRKVV  143

Query  464  GVAGSKKAASIIKDALYI  517
             + G  KA +I   ++++
Sbjct  144  NLVGRTKANNIFSGSIHL  161



>ref|XP_010933399.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Elaeis guineensis]
Length=358

 Score =   178 bits (451),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP ++ FGDS VDVGNNN   T+ KA++PPYGRDFA+H PTGRFCNGKLATD T + 
Sbjct  31   QGLVPGVMIFGDSVVDVGNNNNRLTLVKANFPPYGRDFANHIPTGRFCNGKLATDFTVEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS QATGKNLL GANFAS ASGY + T+ L  AI L+QQ+  YK+YQ K+
Sbjct  91   LGFTSYPPAYLSEQATGKNLLSGANFASGASGYLDSTSTLYGAISLNQQLRNYKDYQSKV  150

Query  461  AGVAGSKKAASIIKDALYI  517
              VAG   A ++   ++Y+
Sbjct  151  EKVAGRANATALFTGSIYV  169



>ref|XP_009593509.1| PREDICTED: GDSL esterase/lipase At5g03820-like isoform X1 [Nicotiana 
tomentosiformis]
Length=351

 Score =   177 bits (450),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALNIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AY SP+A GKN+L G NFASAASGY ++T  L  A+ L+QQ+  Y+E+QGK+ 
Sbjct  85   GFTSYPPAYFSPEARGKNILTGVNFASAASGYYDRTPQLYRALTLAQQLNNYREWQGKVV  144

Query  464  GVAGSKKAASIIKDALYI  517
             + G  +A +I    +++
Sbjct  145  NLVGRTQANNIFSGGIHL  162



>ref|XP_006366788.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum tuberosum]
Length=350

 Score =   177 bits (450),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TAD L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHKPTGRFCNGKLATDFTADYL  83

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS +A GK +L G NFASAASGY E+TA L  A+ L+ Q++YYK +Q K+ 
Sbjct  84   GFTSYPPAYLSREARGKRVLTGVNFASAASGYYERTARLFRALTLTHQLKYYKLWQRKVV  143

Query  464  GVAGSKKAASIIKDALYI  517
             + G   A +I    +++
Sbjct  144  NLVGRTNATNIFSRGIHL  161



>ref|XP_004249641.1| PREDICTED: GDSL esterase/lipase At5g03820 [Solanum lycopersicum]
Length=348

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  22   PLVPALNIFGDSVVDVGNNNNLTTLIKANFLPYGRDFVTHRPTGRFCNGKLATDFTAEYL  81

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF++YP AYLSP+A G+N+L G NFASAASGY E+T  +  A+ L+QQ++YY+E+Q K+ 
Sbjct  82   GFTTYPPAYLSPEARGRNILTGVNFASAASGYYERTPQIYRALTLAQQLQYYREWQAKVV  141

Query  464  GVAGSKKAASIIKDALYI  517
             + G  +A +II   +++
Sbjct  142  NLVGRTQANNIISGGIHL  159



>ref|XP_008458651.1| PREDICTED: GDSL esterase/lipase At5g22810 [Cucumis melo]
Length=348

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS +DVG NN++ T+ KA++ PYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFTFGDSVLDVGINNHLKTLIKANFLPYGRDFTTHKPTGRFCNGKLASDFTAEY  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYL     GK+ L+GA+FASAASGY + TA L NA+  +QQ+EYYKEYQ K+
Sbjct  83   LGFTSYPQAYLG--GGGKDFLVGASFASAASGYLDTTAELYNALSFTQQLEYYKEYQNKV  140

Query  461  AGVAGSKKAASIIKDALYI  517
            A VAG   A+SII  A+Y+
Sbjct  141  AEVAGKPNASSIISGAIYL  159



>ref|XP_010923281.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Elaeis guineensis]
Length=358

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 101/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP +I FGDS VDVGNNN+  T+ KAD+PPYGRDF  H PTGRFCNGKLATD T + 
Sbjct  31   QSLVPGVIIFGDSVVDVGNNNHRLTLVKADFPPYGRDFIHHTPTGRFCNGKLATDFTVEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS QA GKNLL G NF S ASGY E T++L N I L QQ+  YK+Y+ K+
Sbjct  91   LGFTSYPPAYLSEQARGKNLLSGVNFGSGASGYLESTSILYNVISLDQQLRNYKDYRSKV  150

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A ++   ++Y+
Sbjct  151  ERIAGRTNATALFTGSIYV  169



>ref|XP_011094449.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Sesamum indicum]
Length=351

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN + T+ KA++PPYGRDF SH+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNNLQTLIKANFPPYGRDFVSHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS +A G+N+L G NFASAASGY E T  L  A+ L++Q+EYYK++Q K+ 
Sbjct  85   GFNSYPPAYLSQEARGRNILNGVNFASAASGYYENTPQLYRALTLTRQLEYYKDWQSKVV  144

Query  464  GVAGSKKAASIIKDALYI  517
             + G  KA  I    +++
Sbjct  145  NLVGRTKANDIFSGGIHL  162



>ref|XP_009776666.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Nicotiana sylvestris]
Length=351

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALNIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AY SP+A GKN++ G NFASAASGY ++T  L  A+ L+QQ+  Y+E+QGK+ 
Sbjct  85   GFTSYPPAYFSPEARGKNIITGVNFASAASGYYDRTPQLYRALTLAQQLNNYREWQGKVV  144

Query  464  GVAGSKKAASIIKDALYI  517
             + G  +A +I    +++
Sbjct  145  NLVGRTQANNIFSGGIHL  162



>gb|EMT26145.1| GDSL esterase/lipase APG [Aegilops tauschii]
Length=353

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QP VP ++ FGDS V VGNN+Y+ T+ KA+  PYGRDF  H  TGRF NGKL +DI  + 
Sbjct  25   QPAVPGVMLFGDSLVGVGNNDYIATLVKANKAPYGRDFKDHVATGRFGNGKLLSDIIGEK  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+  P AYLSPQA+GKNLLIGANFASA SGY + T+ + + IPLS+Q+EY+KEYQ KL
Sbjct  85   LGFNGSPPAYLSPQASGKNLLIGANFASAGSGYYDPTSRMYHVIPLSRQLEYFKEYQSKL  144

Query  461  AGVAGSKKAASIIKDALYI  517
            + VAGS  A SII D+LYI
Sbjct  145  SVVAGSNHARSIISDSLYI  163



>ref|XP_002528628.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF33731.1| zinc finger protein, putative [Ricinus communis]
Length=352

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            P+VPA+I FGDS VDVGNNN ++T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PIVPALIIFGDSVVDVGNNNNLNTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS  A G+N+L G NFASAASG  + TA L +A+ L++Q+ YYKEYQ K+ 
Sbjct  86   GFTSYPPAYLSQDAQGRNILTGVNFASAASGLYDGTATLYSAVSLTRQLNYYKEYQTKVV  145

Query  464  GVAGSKKAASIIKDALYI  517
             + G  KA  I   A+++
Sbjct  146  IMVGQAKANDIFAGAIHL  163



>ref|XP_004246904.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum lycopersicum]
Length=350

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVNHKPTGRFCNGKLATDYTAEYL  83

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS +A GK +L G NFASAASGY E+TA L  A+ L++Q++YYK +Q K+ 
Sbjct  84   GFTSYPPAYLSREARGKKVLTGVNFASAASGYYERTARLFRALTLTRQLKYYKLWQRKVV  143

Query  464  GVAGSKKAASIIKDALYI  517
             + G   A +I    ++I
Sbjct  144  NLVGRTNATNIFSRGIHI  161



>ref|NP_001140661.1| hypothetical protein precursor [Zea mays]
 gb|ACF84312.1| unknown [Zea mays]
 gb|ACF84726.1| unknown [Zea mays]
 gb|AFW75507.1| hypothetical protein ZEAMMB73_189087 [Zea mays]
Length=359

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QP+VPA+I+FGDS+VDVGNNNY+   +FKADY PYG+ FA H+ TGRF +GK+ TDITA+
Sbjct  30   QPIVPAVISFGDSTVDVGNNNYLPGAVFKADYAPYGQGFARHKATGRFSDGKIVTDITAE  89

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            TLGF SY   YLSPQA+GKNLL GANFASAAS Y + TA + +AI L+QQ++YYKEYQ K
Sbjct  90   TLGFESYAPPYLSPQASGKNLLTGANFASAASSYYDDTAAMYDAITLTQQLKYYKEYQSK  149

Query  458  LAGVAGSKKAASIIKDALYI  517
            LA VAG  +A +I+ DALY+
Sbjct  150  LAAVAGRARARAILGDALYV  169



>ref|XP_006656639.1| PREDICTED: GDSL esterase/lipase APG-like [Oryza brachyantha]
Length=356

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            +VPA+ +FGDS++DVGNNNY+   +FKA+Y PYG +F   +PTGRF +GK+ TDITA+TL
Sbjct  29   IVPAVFSFGDSTIDVGNNNYLPGAVFKANYVPYGVNFHRRRPTGRFSDGKIVTDITAETL  88

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF SY   YLSPQA+GKNLL+GANFASAAS Y + TA + +AI L+QQ++YY+EYQ KLA
Sbjct  89   GFESYAPPYLSPQASGKNLLLGANFASAASSYHDDTAAMYDAITLTQQLKYYREYQSKLA  148

Query  464  GVAGSKKAASIIKDALYI  517
             + G + A++I+ DALY+
Sbjct  149  ALVGRENASAILSDALYV  166



>ref|XP_010092821.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB52561.1| GDSL esterase/lipase [Morus notabilis]
Length=303

 Score =   174 bits (441),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPA+  FGDS +DVGNNN++ T+ KA++PPYGRDF +H PTGRF NGK++ DI A+TLG
Sbjct  22   LVPALFIFGDSVMDVGNNNHLPTLIKANFPPYGRDFFNHTPTGRFSNGKISADIIAETLG  81

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+SY  AYLS +A G+NLLIGANFASAASGY E TA  + AIPLS+Q++ YKEYQGK+A 
Sbjct  82   FASYQPAYLSSEAKGENLLIGANFASAASGYYEPTANSNLAIPLSKQLDNYKEYQGKVAE  141

Query  467  VAGSKKAASIIKDALYI  517
            + G+  A S++   +Y+
Sbjct  142  IIGAANATSLLSSGIYL  158



>gb|ACG42669.1| hypothetical protein [Zea mays]
Length=358

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QP+VPAII+FGDS+VDVGNNNY+   +FKADY PYG+ FA H+ TGRF +GK+ TDITA+
Sbjct  28   QPIVPAIISFGDSTVDVGNNNYLPGAVFKADYAPYGQGFARHKATGRFSDGKIVTDITAE  87

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            TLGF SY   YLSPQA+GKNL  GANFASAAS Y + TA + +AI L+QQ++YYKEYQ K
Sbjct  88   TLGFESYAPPYLSPQASGKNLFTGANFASAASSYYDDTAAMYDAITLTQQLKYYKEYQSK  147

Query  458  LAGVAGSKKAASIIKDALYI  517
            LA VAG  +A +I+ DALY+
Sbjct  148  LAAVAGRARARAILGDALYV  167



>ref|XP_010100155.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB81606.1| GDSL esterase/lipase [Morus notabilis]
Length=353

 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPA+  FGDS VDVGNNN + TI KA++PPYGRDF +H+PTGRF NGKLATD  A+ L 
Sbjct  28   LVPAMFIFGDSVVDVGNNNQLATIIKANFPPYGRDFFNHRPTGRFTNGKLATDFVAEALS  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F+SY  AYLS QA G+NLLIGANFASA+SGY + TA L + +PLS+Q+  YKEYQG++ G
Sbjct  88   FTSYQPAYLSRQARGRNLLIGANFASASSGYLDATANLYHTVPLSRQLNNYKEYQGRVVG  147

Query  467  VAGSKKAASIIKDALYI  517
            + G+  A S+    +Y+
Sbjct  148  ILGAANATSLFSSGIYL  164



>ref|NP_196001.2| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FFN0.1|GDL72_ARATH RecName: Full=GDSL esterase/lipase At5g03810; AltName: Full=Extracellular 
lipase At5g03810; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08607.1| proline-rich protein APG-like [Arabidopsis thaliana]
 gb|AED90657.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=353

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            + LVPA+I  GDS VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ 
Sbjct  25   ETLVPALIIMGDSVVDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYPVAYLS +A   NLL GANFAS ASG+D+ TA+  NAI LSQQ++ YKEYQ K+
Sbjct  85   LGFTSYPVAYLSQEANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKV  144

Query  461  AGVAGSKKAASIIKDALYI  517
              + G ++A  I   A+++
Sbjct  145  TNIVGKERANEIFSGAIHL  163



>emb|CDX80889.1| BnaC03g01430D [Brassica napus]
Length=353

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+QQVE YKEYQ K
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLTQQVENYKEYQSK  141

Query  458  LAGVAGSKKAASIIKDALYI  517
            +  + G  KA  I K A+++
Sbjct  142  VTSIVGKDKANEIFKGAIHL  161



>gb|KDP29224.1| hypothetical protein JCGZ_16613 [Jatropha curcas]
Length=353

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            +P+VPA+I FGDS VDVGNNN ++T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  26   EPIVPALIIFGDSVVDVGNNNNLNTVVKANFLPYGRDFVTHRPTGRFCNGKLATDFTAEY  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS  A G N+L G NFASAASG+ + TA L  AI L+QQ+ YY+EY+ K+
Sbjct  86   LGFTSYPPAYLSQDAKGSNILTGVNFASAASGFYDGTARLYGAIALTQQLNYYREYKRKV  145

Query  461  AGVAGSKKAASIIKDALYI  517
              + G  KA  I   A+++
Sbjct  146  VDMVGQTKANDIFSGAIHL  164



>ref|XP_003538180.1| PREDICTED: GDSL esterase/lipase At5g22810 [Glycine max]
Length=353

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPAI  FGDS VDVGNNN+  TI KA++PPYGRDF +H PTGRFCNGKLATD  AD 
Sbjct  26   QPLVPAIFTFGDSIVDVGNNNHQLTIVKANFPPYGRDFENHFPTGRFCNGKLATDFIADI  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SY  AYL+ +  GKNLL GANFASA+SGY E T+ L ++IPLS+Q+EYYKE Q KL
Sbjct  86   LGFTSYQPAYLNLKTKGKNLLNGANFASASSGYFELTSKLYSSIPLSKQLEYYKECQTKL  145

Query  461  AGVAG  475
               AG
Sbjct  146  VEAAG  150



>gb|EMT28018.1| GDSL esterase/lipase APG [Aegilops tauschii]
Length=235

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            +VPA+I+FGDS++DVGNNNY+   +FKA+Y PYG +F  H+ TGR  +GK+ TDITA+TL
Sbjct  22   VVPAVISFGDSTIDVGNNNYLPGAVFKANYAPYGENFRRHRATGRVSDGKIVTDITAETL  81

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF  Y   YLSP A+GKNLL GANF SAAS Y + TA + +AI LSQQ++YYKEY+ KLA
Sbjct  82   GFEGYAPPYLSPLASGKNLLTGANFGSAASSYSDDTAAMYDAITLSQQLKYYKEYRSKLA  141

Query  464  GVAGSKKAASIIKDALYI  517
             VAG ++A +I+ +ALY+
Sbjct  142  AVAGRRQARTILAEALYV  159



>ref|XP_010490874.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Camelina sativa]
Length=350

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN + T+ KA++PPYGRDF  H  TGRF NGKLATD TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNRLTTLVKANFPPYGRDFFDHNATGRFTNGKLATDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYPV YLS  A G NLL GANFAS ASG+ + TALL NAI L+QQ++ YKEYQ K+
Sbjct  82   LGFTSYPVPYLSQDANGTNLLTGANFASGASGFLDATALLYNAITLNQQLKNYKEYQTKV  141

Query  461  AGVAGSKKAASIIKDALYI  517
              + G ++A      A+++
Sbjct  142  TNIVGRERANETFSRAIHL  160



>ref|XP_009125521.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Brassica rapa]
Length=406

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKL  D TA++
Sbjct  78   QPLVPALIIIGDSVVDAGNNNHRTTLIKANFPPYGRDFFAHNSTGRFSNGKLVIDFTAES  137

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYPVAYLS  A G NLL GANFAS ASG+D+ T+LL NAI L+QQ++ YKEY+ K+
Sbjct  138  LGFTSYPVAYLSQDANGTNLLTGANFASGASGFDDGTSLLYNAITLNQQLKNYKEYKIKV  197

Query  461  AGVAGSKKAASIIKDALYI  517
              + G  +A  I   A+Y+
Sbjct  198  TNMVGRDRANEIFSGAIYL  216



>ref|XP_009130784.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X2 [Brassica 
rapa]
Length=353

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+QQVE YKEYQ K
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLTQQVENYKEYQSK  141

Query  458  LAGVAGSKKAASIIKDALYI  517
            +  + G  KA  I K A+++
Sbjct  142  VTSMVGRDKANEIFKGAIHL  161



>ref|XP_009130783.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X1 [Brassica 
rapa]
Length=353

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+QQVE YKEYQ K
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLTQQVENYKEYQSK  141

Query  458  LAGVAGSKKAASIIKDALYI  517
            +  + G  KA  I K A+++
Sbjct  142  VTSMVGRDKANEIFKGAIHL  161



>gb|EMS52953.1| GDSL esterase/lipase APG [Triticum urartu]
Length=359

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QP VP ++ FGDS V VGNN+Y+ T+ KA+  PYGRDF  H  TGRF NGKL +DI  + 
Sbjct  31   QPAVPGVMLFGDSLVGVGNNDYLATLVKANMAPYGRDFKDHIATGRFGNGKLLSDIIGEK  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+  P AYLSPQA+G+NLLIGANFASA SGY + TA + + IPLS+Q+EY+KEYQ KL
Sbjct  91   LGFNGSPPAYLSPQASGQNLLIGANFASAGSGYYDPTARIYHVIPLSRQLEYFKEYQSKL  150

Query  461  AGVAGSKKAASIIKDALYI  517
              VAG+  A SII D+LYI
Sbjct  151  RVVAGNDHAQSIISDSLYI  169



>ref|XP_011101470.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Sesamum indicum]
Length=351

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA++ FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALLLFGDSVVDVGNNNNLQTLVKANFLPYGRDFVTHKPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SY  AYLS +A G+N+L G NFASAASGY E T  L  A+ L+QQ+EYY+++Q K+ 
Sbjct  86   GFTSYQPAYLSQEARGRNILTGVNFASAASGYYEPTGQLYRALTLAQQLEYYRDWQRKVV  145

Query  464  GVAGSKKAASIIKDALYI  517
             + G  KA +I    +++
Sbjct  146  SMVGRAKANAIFSGGIHL  163



>ref|XP_003561182.1| PREDICTED: GDSL esterase/lipase APG-like [Brachypodium distachyon]
Length=359

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 110/140 (79%), Gaps = 2/140 (1%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFAS-HQPTGRFCNGKLATDITADT  280
            P VPAI+ FGDS VDVGNN+Y++TI KA+  PYGRDF   H  TGRF NGKL +D   + 
Sbjct  30   PRVPAIMFFGDSLVDVGNNDYINTIVKANLSPYGRDFQEDHVATGRFGNGKLISDFIGEK  89

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGFS  P AYLSP+A+GKNLL+GANFASA SGY + TAL+ + IPLSQQ+E++KEY+ KL
Sbjct  90   LGFSVSPPAYLSPEASGKNLLLGANFASAGSGYYDPTALMYHVIPLSQQLEHFKEYRSKL  149

Query  461  AGVAGSK-KAASIIKDALYI  517
            A VAGS+ +A SI+ ++LYI
Sbjct  150  AAVAGSRQQAQSIVSNSLYI  169



>ref|XP_009589481.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Nicotiana tomentosiformis]
Length=350

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  83

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS +A GK +L G NFASA+SGY E+TA L  A+ L  Q++YY+ +Q K+ 
Sbjct  84   GFTSYPPAYLSREARGKRILTGINFASASSGYYERTANLYRALTLPHQLKYYRVWQRKVV  143

Query  464  GVAGSKKAASIIKDALYI  517
             + G  KA +I   ++++
Sbjct  144  NLVGRTKANNIFSGSIHL  161



>ref|XP_009389038.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=396

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP +I FGDS+VDVGNNN++ T+ KA++PPYGRDF  H PTGRFCNGKL TD   + 
Sbjct  66   QGLVPGVIIFGDSTVDVGNNNHLLTLVKANFPPYGRDFPHHSPTGRFCNGKLVTDFVVEV  125

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+++P AYLS +ATG NLL GANFASA+SGY + TA L  A+ L++Q+ Y+++YQ K+
Sbjct  126  LGFTTHPPAYLSKEATGNNLLNGANFASASSGYLDATASLYQAVSLTRQLRYFEQYQAKV  185

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A ++  D++Y+
Sbjct  186  KSIAGKATATALFADSIYV  204



>gb|KJB16733.1| hypothetical protein B456_002G245100 [Gossypium raimondii]
Length=295

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN ++T+ K+++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALIIFGDSVVDVGNNNNLNTLIKSNFPPYGRDFVNHRPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS  A G  LL GANFASAASG  + TA L  AI L+QQ+ YY+EYQ KL 
Sbjct  86   GFTSYPPAYLSRDAIGNALLTGANFASAASGLYDSTANLYRAITLTQQLNYYREYQTKLV  145

Query  464  GVAGSKKAASIIKDALYI  517
             +AG+  A +II  A+++
Sbjct  146  NMAGNNGANNIISGAIHL  163



>ref|XP_008794047.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Phoenix dactylifera]
Length=359

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP ++ FGDS VDVGNNN   T+ KA++PPYGRDF  H PTGRFCNGKLATD T + 
Sbjct  32   QGLVPGVVIFGDSVVDVGNNNNRLTLVKANFPPYGRDFVDHAPTGRFCNGKLATDFTVEN  91

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS QATGKNLL GANFAS  +GY + T+ L  AI L+QQ+  YK+YQ K+
Sbjct  92   LGFTSYPPAYLSEQATGKNLLSGANFASGGAGYLDSTSTLYGAISLNQQLRNYKDYQSKV  151

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A ++   ++Y+
Sbjct  152  ERIAGKANATALFAGSIYV  170



>ref|XP_011018853.1| PREDICTED: GDSL esterase/lipase At5g03820 [Populus euphratica]
Length=351

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN + T+ KA++ PYGRD+ +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALIIFGDSVVDVGNNNNLTTLIKANFLPYGRDYVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF++YP AYLSP A+G+N+L GANFASAASG  + TA   +AI L++Q+ YY++YQ K+ 
Sbjct  85   GFTTYPPAYLSPDASGRNILTGANFASAASGLYDGTAQSYSAISLTRQLSYYRDYQMKVV  144

Query  464  GVAGSKKAASIIKDALYI  517
             +AG  +A  I   A+++
Sbjct  145  NMAGQARANDIFSGAIHL  162



>ref|XP_009389037.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=401

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP +I FGDS+VDVGNNN++ T+ KA++PPYGRDF  H PTGRFCNGKL TD   + 
Sbjct  66   QGLVPGVIIFGDSTVDVGNNNHLLTLVKANFPPYGRDFPHHSPTGRFCNGKLVTDFVVEV  125

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+++P AYLS +ATG NLL GANFASA+SGY + TA L  A+ L++Q+ Y+++YQ K+
Sbjct  126  LGFTTHPPAYLSKEATGNNLLNGANFASASSGYLDATASLYQAVSLTRQLRYFEQYQAKV  185

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A ++  D++Y+
Sbjct  186  KSIAGKATATALFADSIYV  204



>emb|CDY04898.1| BnaAnng00800D [Brassica napus]
Length=350

 Score =   172 bits (437),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN+     KA++PPYGRDF +H  TGRF NGKL  D TA++
Sbjct  22   QPLVPALIIMGDSVVDAGNNNHRTIFIKANFPPYGRDFFAHNSTGRFSNGKLVIDFTAES  81

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYPVAYLS  A G NLL GANFAS ASG+D+ T+LL NAI L+QQ++ YKEY+ K+
Sbjct  82   LGFTSYPVAYLSQDANGTNLLTGANFASGASGFDDGTSLLYNAITLNQQLKNYKEYKIKV  141

Query  461  AGVAGSKKAASIIKDALYI  517
              + G  +A  I   A+Y+
Sbjct  142  TNMVGRDRANEIFSGAIYL  160



>emb|CDY11271.1| BnaA03g01070D [Brassica napus]
Length=367

 Score =   173 bits (438),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALLIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+QQVE YKEYQ K
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLTQQVENYKEYQSK  141

Query  458  LAGVAGSKKAASIIKDALYI  517
            +  + G  KA  I K A+++
Sbjct  142  VTSMVGRDKANEIFKGAIHL  161



>gb|KJB16732.1| hypothetical protein B456_002G245100 [Gossypium raimondii]
Length=352

 Score =   172 bits (436),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN ++T+ K+++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALIIFGDSVVDVGNNNNLNTLIKSNFPPYGRDFVNHRPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLS  A G  LL GANFASAASG  + TA L  AI L+QQ+ YY+EYQ KL 
Sbjct  86   GFTSYPPAYLSRDAIGNALLTGANFASAASGLYDSTANLYRAITLTQQLNYYREYQTKLV  145

Query  464  GVAGSKKAASIIKDALYI  517
             +AG+  A +II  A+++
Sbjct  146  NMAGNNGANNIISGAIHL  163



>gb|KHN38683.1| GDSL esterase/lipase [Glycine soja]
Length=318

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPAI  FGDS VDVGNNN+  TI KA++PPYGRDF +H PTGRFCNGKLATD  AD 
Sbjct  23   QPLVPAIFTFGDSIVDVGNNNHQLTIVKANFPPYGRDFENHFPTGRFCNGKLATDFIADI  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SY  AYL+ +  GKNLL GANFASA+SGY E T+ L ++IPLS+Q+E YKE Q KL
Sbjct  83   LGFTSYQPAYLNLKTKGKNLLNGANFASASSGYFELTSKLYSSIPLSKQLECYKECQTKL  142

Query  461  AGVAG  475
               AG
Sbjct  143  VEAAG  147



>ref|XP_010452277.1| PREDICTED: GDSL esterase/lipase At5g03820 [Camelina sativa]
Length=350

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN + T+ KA++PPYGRDF  H  TGRF NGK+ATD TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNRLTTLVKANFPPYGRDFFDHNATGRFTNGKIATDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SY V YLS  A G NLL GANFAS ASG+ + TALL NAI L+QQ++ YKEYQ K+
Sbjct  82   LGFTSYTVPYLSQDANGTNLLTGANFASGASGFLDATALLYNAITLNQQLKNYKEYQTKV  141

Query  461  AGVAGSKKAASIIKDALYI  517
              + G ++A  I   A+++
Sbjct  142  MNIVGRERANEIFSRAIHL  160



>ref|XP_006381340.1| hypothetical protein POPTR_0006s11970g [Populus trichocarpa]
 gb|ERP59137.1| hypothetical protein POPTR_0006s11970g [Populus trichocarpa]
Length=351

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN + T+ KA++ PYGRD+ +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALIIFGDSVVDVGNNNNLTTLIKANFLPYGRDYVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF++YP AYLSP A+G+N+L GANFASAASG  + TA   ++I L++Q+ YY++YQ K+ 
Sbjct  85   GFTTYPPAYLSPDASGRNILTGANFASAASGLYDGTAQSYSSISLTRQLSYYRDYQMKVV  144

Query  464  GVAGSKKAASIIKDALYI  517
             +AG  +A  I   A+++
Sbjct  145  NMAGQARANDIFSGAIHL  162



>emb|CDP15327.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF  H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLPTLIKANFPPYGRDFLGHRPTGRFCNGKLATDYTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF +YP AYLS +A G ++L G NFASAASGY + TA L  AI L+QQ++YYKE++ K+ 
Sbjct  86   GFRAYPPAYLSQEAKGSSILTGVNFASAASGYYDGTAQLYRAISLTQQLQYYKEWRTKVV  145

Query  464  GVAGSKKAASIIKDALYI  517
               G  KA +II   +++
Sbjct  146  NAVGKAKANTIISGGVHL  163



>ref|XP_008387479.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Malus domestica]
Length=350

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS  D GNNN + T  KA++PPYGRDF +H+PTGRFCNGKL TD TA+ L
Sbjct  25   PLVPALIIFGDSVADXGNNNNLTTPIKANFPPYGRDFVTHRPTGRFCNGKLTTDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  463
            GF+SYP AYLSP+A G+NLL   NFASAASGY + T  L N + L++Q+ YY++YQ ++ 
Sbjct  85   GFTSYPPAYLSPEAEGQNLLTXVNFASAASGYLDYTPFLYNTLSLTRQLNYYRQYQNEVV  144

Query  464  GVAGSKKAASIIKDALYI  517
             + GS   ++I   A+++
Sbjct  145  SMVGSNNTSAIFSGAIHL  162



>ref|XP_010493512.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Camelina sativa]
Length=341

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VDV NNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  31   QPLVPSMFIFGDSVVDVANNNEIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+SYP AYLS +A G+NLL GANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  91   LGFTSYPQAYLSKKAKGRNLLTGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  150



>ref|XP_008462404.1| PREDICTED: GDSL esterase/lipase APG isoform X5 [Cucumis melo]
Length=420

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PAI  FGDS++DVGNNN   T+FKA+Y PYGRDF +H+PTGRFCNGKL +DITA++LG
Sbjct  94   IFPAIFTFGDSALDVGNNNNRFTMFKANYLPYGRDFINHKPTGRFCNGKLVSDITAESLG  153

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SYP AYLSP+A+G+ LLIGA FASAA+GYDE+ ++ + AI L QQ+  YKEYQGK+A 
Sbjct  154  FQSYPPAYLSPEASGRKLLIGAGFASAAAGYDEEASISNRAITLGQQLANYKEYQGKVAM  213

Query  467  VAGSKKAASIIKDALYI  517
            V G ++AA+I+ D L+I
Sbjct  214  VVGDEEAAAIVADGLHI  230



>dbj|BAJ89672.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  277
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T +
Sbjct  31   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVE  90

Query  278  TLGFSSYPVAYLS--PQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  451
            +LG SSYP AYLS   Q+  K LL GANFAS A+GY + TA L  AI L +Q++Y+KEYQ
Sbjct  91   SLGLSSYPPAYLSGEAQSDNKTLLHGANFASGAAGYLDATAALYGAISLGRQLDYFKEYQ  150

Query  452  GKLAGVAGSKKAASIIKDALYI  517
             K+A VAG K+AA++   ++Y+
Sbjct  151  SKVAAVAGEKRAAALTSGSIYL  172



>emb|CDP14394.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 104/139 (75%), Gaps = 1/139 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNNY+ T+ KA++PPYGRDF +H+ TGRFCNGKLATD T + 
Sbjct  23   QPLVPALYLFGDSIVDVGNNNYLETLIKANFPPYGRDFINHEATGRFCNGKLATDFTGEN  82

Query  281  LGFSSYPVAYLSPQA-TGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            LGF+ YP  YLS +A T KN+L+GANFASA SGY E TA + N + LS+Q+  YK+YQ +
Sbjct  83   LGFTDYPKPYLSNKAKTTKNMLLGANFASAGSGYYEATAKIYNTLSLSKQLALYKDYQNR  142

Query  458  LAGVAGSKKAASIIKDALY  514
            L  + G   A++ I  +++
Sbjct  143  LVVILGKVNASATINGSIH  161



>emb|CDP17381.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 103/139 (74%), Gaps = 1/139 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNNY+ T+ KA++PPYGRDF +H+ TGRFCNGKLATD T + 
Sbjct  23   QPLVPALYLFGDSIVDVGNNNYLETLIKANFPPYGRDFINHEATGRFCNGKLATDFTGEN  82

Query  281  LGFSSYPVAYLSPQA-TGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  457
            LGF+ YP  YLS +A T KN+L+GANFASA SGY E TA +   + LS+Q+  YK+YQ +
Sbjct  83   LGFTDYPKPYLSNKAKTTKNMLLGANFASAGSGYYEATAKIYTTLSLSKQLALYKDYQNR  142

Query  458  LAGVAGSKKAASIIKDALY  514
            L  + G   A++ I  +++
Sbjct  143  LVVILGKVNASATINGSIH  161



>ref|XP_006403725.1| hypothetical protein EUTSA_v10010500mg [Eutrema salsugineum]
 gb|ESQ45178.1| hypothetical protein EUTSA_v10010500mg [Eutrema salsugineum]
Length=351

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF +H+PTGRFCNGKLA D +A+ LG
Sbjct  26   VVPALIMFGDSIVDVGNNNNLFSIVKSNFPPYGRDFINHRPTGRFCNGKLAVDFSAEYLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            FSSYP A+LS +A+ ++LLIGANFASA+SGY + T++   AI L++Q+ YY+ YQ ++  
Sbjct  86   FSSYPPAFLSREASNEDLLIGANFASASSGYYDATSVPFGAISLTRQLSYYRTYQNRVTT  145

Query  467  VAGSKKAASIIKDALYI  517
            + G +KA  +   A++I
Sbjct  146  MIGKEKARVLFSKAIHI  162



>gb|ABK21582.1| unknown [Picea sitchensis]
Length=350

 Score =   165 bits (418),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS+VDVGNNNY+ T+ K+++PPYGRDF +H PTGRFC+G+LATD  A+T
Sbjct  23   QPLVPALFIFGDSTVDVGNNNYLFTLVKSNFPPYGRDFDTHNPTGRFCDGRLATDYVAET  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF+S+P AYLSPQA+G+NLL G NFAS ASG  + TA  SNAI ++QQ++Y+++YQ K+
Sbjct  83   LGFTSFPPAYLSPQASGQNLLTGVNFASGASGIYDDTAQRSNAISMTQQLQYFQQYQSKV  142

Query  461  AGVAGSKKAASIIKDALYI  517
                G    ++I+  ALY+
Sbjct  143  EKSVGRANVSTIVSKALYV  161



>gb|ABZ85654.1| truncated At5g03810, partial [Arabidopsis thaliana]
Length=137

 Score =   159 bits (401),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  VDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQ  322
            VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ LGF+SYPVAYLS  
Sbjct  2    VDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAENLGFTSYPVAYLSQD  61

Query  323  ATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIK  502
            A   NLL GANFAS ASG+D+ TA+  NAI LSQQ++ YKEYQ K+  + G ++A  I  
Sbjct  62   ANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKVTNIVGKERANEIFS  121

Query  503  DALYI  517
             A+++
Sbjct  122  GAIHL  126



>emb|CAB85501.1| putative protein [Arabidopsis thaliana]
Length=320

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  128  FGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVA  307
             GDS VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ LGF+SYPVA
Sbjct  1    MGDSVVDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAENLGFTSYPVA  60

Query  308  YLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKA  487
            YLS +A   NLL GANFAS ASG+D+ TA+  NAI LSQQ++ YKEYQ K+  + G ++A
Sbjct  61   YLSQEANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKVTNIVGKERA  120

Query  488  ASIIKDALYI  517
              I   A+++
Sbjct  121  NEIFSGAIHL  130



>ref|XP_006382055.1| hypothetical protein POPTR_0006s256601g, partial [Populus trichocarpa]
 gb|ERP59852.1| hypothetical protein POPTR_0006s256601g, partial [Populus trichocarpa]
Length=106

 Score =   157 bits (397),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            L PAII+FGDSSVDVGNNN++ TIFKA+YPPYGRDFA+H+PTGRFCNGKL  DITA+ L 
Sbjct  8    LFPAIISFGDSSVDVGNNNHLSTIFKANYPPYGRDFANHKPTGRFCNGKLTIDITAEALR  67

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  403
            F +Y  AYL P+A+GKNLLIG NFASAASGYD+KT  L+
Sbjct  68   FKTYAPAYLIPEASGKNLLIGVNFASAASGYDDKTDFLN  106



>ref|XP_004982165.1| PREDICTED: GDSL esterase/lipase At5g03820-like isoform X2 [Setaria 
italica]
Length=357

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 105/142 (74%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  277
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLA D T +
Sbjct  27   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLAMDYTVE  86

Query  278  TLGFSSYPVAYLS--PQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  451
            +LG SSYP AYLS   Q+  K+LL GANFAS A+GY + TA L  AI LS+Q EY++EYQ
Sbjct  87   SLGLSSYPPAYLSQEAQSNNKSLLNGANFASGAAGYLDATAALYGAISLSRQAEYFREYQ  146

Query  452  GKLAGVAGSKKAASIIKDALYI  517
             ++A  AG ++A S+   ++Y+
Sbjct  147  SRVAASAGEQRAKSLTSGSIYV  168



>ref|XP_006650413.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Oryza brachyantha]
Length=361

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 107/142 (75%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  277
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T D
Sbjct  32   QALVPGVMIFGDSVVDAGNNNRLPTLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVD  91

Query  278  TLGFSSYPVAYLSPQATGKN--LLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  451
            +LG ++YP AYL  +A   N  LL GANFAS ASGY + TA L  AI LS+Q++Y++EY+
Sbjct  92   SLGLAAYPPAYLGQEARSDNRTLLHGANFASGASGYLDATAALYGAISLSRQLDYFREYK  151

Query  452  GKLAGVAGSKKAASIIKDALYI  517
             K+A  AG +KAA++  +++Y+
Sbjct  152  AKVAAGAGREKAAALTSESIYV  173



>gb|EYU41566.1| hypothetical protein MIMGU_mgv1a008897mg [Erythranthe guttata]
Length=359

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 104/139 (75%), Gaps = 1/139 (1%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRF NGKLATD TA+ L
Sbjct  32   PLVPALIIFGDSVVDVGNNNNLQTLIKANFLPYGRDFVTHKPTGRFSNGKLATDFTAEYL  91

Query  284  GFSSYPVAYLSPQA-TGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            GF+SYP AY S +A +GKN+L G NFASAASGY ++TA L  A+ L+QQ+  Y+++Q K+
Sbjct  92   GFNSYPPAYFSQEARSGKNILTGVNFASAASGYYDRTAQLYRALTLTQQLANYRDWQSKV  151

Query  461  AGVAGSKKAASIIKDALYI  517
              + G  KA  I    +++
Sbjct  152  VNLVGRSKANDIFSGGIHL  170



>ref|XP_002466664.1| hypothetical protein SORBIDRAFT_01g011850 [Sorghum bicolor]
 gb|EER93662.1| hypothetical protein SORBIDRAFT_01g011850 [Sorghum bicolor]
Length=362

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 3/142 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  277
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T +
Sbjct  32   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVE  91

Query  278  TLGFSSYPVAYLSP--QATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  451
            +LG SSYP AYLS   Q+  K+LL GANFAS A+GY + TA L  AI L +Q EY++EYQ
Sbjct  92   SLGLSSYPPAYLSEEAQSNNKSLLHGANFASGAAGYLDATAGLYGAISLRRQAEYFREYQ  151

Query  452  GKLAGVAGSKKAASIIKDALYI  517
             ++A  AG ++A  +   ++Y+
Sbjct  152  SRVAASAGERRARELTSGSIYV  173



>ref|XP_004141668.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
 gb|KGN45574.1| hypothetical protein Csa_7G452290 [Cucumis sativus]
Length=366

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PAI  FGDS++D+GNNN   T+FKA+Y PYG+DF +H+PTGRFCNGKL +DITA+TLG
Sbjct  40   IFPAIFTFGDSALDMGNNNNRFTMFKANYLPYGQDFTNHKPTGRFCNGKLVSDITAETLG  99

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F +YP  YLSP+A+G+NLLIGA FASAA+GYDE+ ++ + AI LSQQ+  YKEYQ K+A 
Sbjct  100  FQTYPPPYLSPEASGRNLLIGAGFASAAAGYDEQASISNRAITLSQQLGNYKEYQSKVAM  159

Query  467  VAGSKKAASIIKDALYI  517
            V G ++A +I+ + L+I
Sbjct  160  VVGDEEAGAIVANGLHI  176



>ref|XP_004506128.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cicer arietinum]
Length=356

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            +PLVPA   FGDSS DVGNNN + T  KA++PPYGRDF +H PTGRFCNGKL  D  ++ 
Sbjct  26   KPLVPAFFIFGDSSFDVGNNNNLPTTIKANFPPYGRDFMNHIPTGRFCNGKLTIDFASEF  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  460
            LGF SY  AYL+    GKNLL GANFAS+ SGY E TA L  +I L+QQ+E+YK+ Q +L
Sbjct  86   LGFISYQPAYLNLYIKGKNLLNGANFASSGSGYHESTAKLYKSISLNQQLEFYKDSQNEL  145

Query  461  AGVAGSKKAASIIKDALYI  517
              +AG   A SII  A+Y+
Sbjct  146  MKIAGRSDALSIIFGAVYL  164



>ref|XP_008462399.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g05700 isoform X1 [Cucumis melo]
Length=1194

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  107   LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
             + PAI  FGDS++DVGNNN   T+FKA+Y PYGRDF +H+PTGRFCNGKL +DITA++LG
Sbjct  868   IFPAIFTFGDSALDVGNNNNRFTMFKANYLPYGRDFINHKPTGRFCNGKLVSDITAESLG  927

Query  287   FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
             F SYP AYLSP+A+G+ LLIGA FASAA+GYDE+ ++ + AI L QQ+  YKEYQGK+A 
Sbjct  928   FQSYPPAYLSPEASGRKLLIGAGFASAAAGYDEEASISNRAITLGQQLANYKEYQGKVAM  987

Query  467   VAGSKKAASIIKDALYI  517
             V G ++AA+I+ D L+I
Sbjct  988   VVGDEEAAAIVADGLHI  1004



>ref|XP_008462402.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g05700 isoform X3 [Cucumis melo]
Length=1179

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PAI  FGDS++DVGNNN   T+FKA+Y PYGRDF +H+PTGRFCNGKL +DITA++LG
Sbjct  853  IFPAIFTFGDSALDVGNNNNRFTMFKANYLPYGRDFINHKPTGRFCNGKLVSDITAESLG  912

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SYP AYLSP+A+G+ LLIGA FASAA+GYDE+ ++ + AI L QQ+  YKEYQGK+A 
Sbjct  913  FQSYPPAYLSPEASGRKLLIGAGFASAAAGYDEEASISNRAITLGQQLANYKEYQGKVAM  972

Query  467  VAGSKKAASIIKDALYI  517
            V G ++AA+I+ D L+I
Sbjct  973  VVGDEEAAAIVADGLHI  989



>ref|XP_008462401.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g05700 isoform X2 [Cucumis melo]
Length=1184

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PAI  FGDS++DVGNNN   T+FKA+Y PYGRDF +H+PTGRFCNGKL +DITA++LG
Sbjct  858  IFPAIFTFGDSALDVGNNNNRFTMFKANYLPYGRDFINHKPTGRFCNGKLVSDITAESLG  917

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SYP AYLSP+A+G+ LLIGA FASAA+GYDE+ ++ + AI L QQ+  YKEYQGK+A 
Sbjct  918  FQSYPPAYLSPEASGRKLLIGAGFASAAAGYDEEASISNRAITLGQQLANYKEYQGKVAM  977

Query  467  VAGSKKAASIIKDALYI  517
            V G ++AA+I+ D L+I
Sbjct  978  VVGDEEAAAIVADGLHI  994



>ref|XP_008462403.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g05700 isoform X4 [Cucumis melo]
Length=1167

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PAI  FGDS++DVGNNN   T+FKA+Y PYGRDF +H+PTGRFCNGKL +DITA++LG
Sbjct  841  IFPAIFTFGDSALDVGNNNNRFTMFKANYLPYGRDFINHKPTGRFCNGKLVSDITAESLG  900

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  466
            F SYP AYLSP+A+G+ LLIGA FASAA+GYDE+ ++ + AI L QQ+  YKEYQGK+A 
Sbjct  901  FQSYPPAYLSPEASGRKLLIGAGFASAAAGYDEEASISNRAITLGQQLANYKEYQGKVAM  960

Query  467  VAGSKKAASIIKDALYI  517
            V G ++AA+I+ D L+I
Sbjct  961  VVGDEEAAAIVADGLHI  977



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325