BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J02

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011088839.1|  PREDICTED: uncharacterized protein At4g22758     52.4    1e-11   Sesamum indicum [beniseed]
emb|CDP06984.1|  unnamed protein product                              52.0    1e-10   Coffea canephora [robusta coffee]
ref|XP_006367869.1|  PREDICTED: uncharacterized protein At4g22758...  49.3    8e-10   Solanum tuberosum [potatoes]
ref|XP_004228457.1|  PREDICTED: uncharacterized protein At4g22758...  49.3    8e-10   Solanum lycopersicum
gb|EYU36098.1|  hypothetical protein MIMGU_mgv1a014176mg              46.2    1e-09   Erythranthe guttata [common monkey flower]
emb|CAC09928.1|  hypothetical protein                                 48.5    2e-09   Catharanthus roseus [chatas]
ref|XP_009616748.1|  PREDICTED: uncharacterized protein LOC104109228  49.3    2e-09   Nicotiana tomentosiformis
gb|ABB87098.1|  hypothetical protein                                  47.8    2e-09   Solanum tuberosum [potatoes]
ref|XP_009599426.1|  PREDICTED: uncharacterized protein At4g22758...  48.1    3e-09   Nicotiana tomentosiformis
ref|XP_009803629.1|  PREDICTED: uncharacterized protein LOC104248970  50.8    4e-09   Nicotiana sylvestris
ref|XP_009588059.1|  PREDICTED: uncharacterized protein At4g22758...  47.8    7e-09   Nicotiana tomentosiformis
ref|XP_004251013.1|  PREDICTED: uncharacterized protein LOC101246792  60.8    1e-08   
ref|XP_011090002.1|  PREDICTED: uncharacterized protein At4g22758...  43.5    1e-08   Sesamum indicum [beniseed]
ref|XP_004294037.1|  PREDICTED: uncharacterized protein LOC101299937  43.1    2e-08   Fragaria vesca subsp. vesca
ref|XP_008227132.1|  PREDICTED: uncharacterized protein LOC103326671  44.7    2e-07   Prunus mume [ume]
ref|XP_006347223.1|  PREDICTED: uncharacterized protein At4g22758...  45.8    2e-07   Solanum tuberosum [potatoes]
ref|XP_009786754.1|  PREDICTED: uncharacterized protein At4g22758...  42.4    2e-07   Nicotiana sylvestris
ref|XP_006349080.1|  PREDICTED: uncharacterized protein At4g22758...  55.8    3e-07   Solanum tuberosum [potatoes]
ref|XP_004241302.1|  PREDICTED: uncharacterized protein At4g22758...  45.8    5e-07   Solanum lycopersicum
ref|XP_010089162.1|  hypothetical protein L484_003293                 40.8    6e-07   Morus notabilis
ref|XP_002269322.1|  PREDICTED: uncharacterized protein At4g22758     41.2    1e-06   Vitis vinifera
emb|CAN83835.1|  hypothetical protein VITISV_009604                   41.2    1e-06   Vitis vinifera
ref|XP_009587253.1|  PREDICTED: uncharacterized protein LOC104084994  39.7    2e-06   Nicotiana tomentosiformis
gb|KDP34370.1|  hypothetical protein JCGZ_11253                       40.4    4e-06   Jatropha curcas
ref|XP_002279186.1|  PREDICTED: uncharacterized protein LOC100262329  39.7    4e-06   Vitis vinifera
gb|EPS60596.1|  hypothetical protein M569_14207                       39.3    6e-06   Genlisea aurea
ref|XP_009783453.1|  PREDICTED: uncharacterized protein LOC104232056  40.4    8e-06   Nicotiana sylvestris
ref|XP_009337403.1|  PREDICTED: uncharacterized protein LOC103929867  43.1    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_011044435.1|  PREDICTED: uncharacterized protein At4g22758     37.7    1e-05   Populus euphratica
ref|XP_002313647.1|  hypothetical protein POPTR_0009s15140g           37.7    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008344912.1|  PREDICTED: uncharacterized protein LOC103407817  41.6    3e-05   Malus domestica [apple tree]
ref|XP_006384668.1|  hypothetical protein POPTR_0004s20000g           39.3    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011005606.1|  PREDICTED: uncharacterized protein At4g22758...  38.9    3e-05   Populus euphratica
ref|XP_008385454.1|  PREDICTED: uncharacterized protein LOC103447997  43.1    5e-05   Malus domestica [apple tree]
ref|XP_010278240.1|  PREDICTED: uncharacterized protein At4g22758     44.7    6e-05   Nelumbo nucifera [Indian lotus]
ref|XP_007015951.1|  Uncharacterized protein TCM_041515               42.0    6e-05   
gb|KJB06372.1|  hypothetical protein B456_001G119300                  40.4    1e-04   Gossypium raimondii
gb|EYU36977.1|  hypothetical protein MIMGU_mgv1a014088mg              38.5    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_009349334.1|  PREDICTED: uncharacterized protein At4g22758...  39.7    1e-04   
ref|XP_009364846.1|  PREDICTED: uncharacterized protein At4g22758     39.3    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_002527451.1|  conserved hypothetical protein                   42.4    2e-04   Ricinus communis
emb|CDX71412.1|  BnaC04g16470D                                        43.9    3e-04   
ref|XP_006471415.1|  PREDICTED: uncharacterized protein LOC102620...  39.7    4e-04   Citrus sinensis [apfelsine]
ref|XP_009103627.1|  PREDICTED: uncharacterized protein At4g22758     43.9    4e-04   Brassica rapa
gb|EYU36099.1|  hypothetical protein MIMGU_mgv1a014176mg              43.1    7e-04   Erythranthe guttata [common monkey flower]
ref|XP_006424343.1|  hypothetical protein CICLE_v10029315mg           39.3    0.001   Citrus clementina [clementine]



>ref|XP_011088839.1| PREDICTED: uncharacterized protein At4g22758 [Sesamum indicum]
Length=194

 Score = 52.4 bits (124),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSPK  R+GG +EKNRKGRL EKA SF G  G  +   ++ RPRTVPDLLAG
Sbjct  1    MPSPKNYRKGGHQEKNRKGRLPEKASSFHGRGGGVAEE-MIPRPRTVPDLLAG  52


 Score = 43.5 bits (101),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIP  556
            PKLTKLLLNVTIQRS GA++VL+P
Sbjct  70   PKLTKLLLNVTIQRSLGAVKVLMP  93



>emb|CDP06984.1| unnamed protein product [Coffea canephora]
Length=202

 Score = 52.0 bits (123),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 4/59 (7%)
 Frame = +1

Query  271  MPSP-KTQRRGGTEEKNRKGRLAEKamsfsghsgass---aaVLLQRPRTVPDLLAGPE  435
            MPSP K+  R GT EKNRKG+LAEKA SF   S ++       LLQRPRTVPDLL+G E
Sbjct  1    MPSPAKSNHRKGTGEKNRKGKLAEKAQSFHAGSVSAGKVGQMSLLQRPRTVPDLLSGKE  59


 Score = 40.4 bits (93),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            P KLTKLLLNVTIQRS G +QV++ P+
Sbjct  73   PLKLTKLLLNVTIQRSLGPVQVVMSPE  99



>ref|XP_006367869.1| PREDICTED: uncharacterized protein At4g22758-like [Solanum tuberosum]
Length=190

 Score = 49.3 bits (116),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKG-RLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSP+T RRG  +EKNRK  RL+EK+ SF G S  SS   LL+RP+TVPDLLAG
Sbjct  2    MPSPRTHRRGN-DEKNRKDMRLSEKSKSFHGQSSGSSKTELLRRPKTVPDLLAG  54


 Score = 40.4 bits (93),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLI  553
            P KLTKLLLNVTIQRS G +QVLI
Sbjct  69   PMKLTKLLLNVTIQRSVGPVQVLI  92



>ref|XP_004228457.1| PREDICTED: uncharacterized protein At4g22758-like [Solanum lycopersicum]
Length=190

 Score = 49.3 bits (116),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKG-RLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSP+T RRG  +EKNRK  RL+EK+ SF G S  SS   LL+RP+TVPDLLAG
Sbjct  2    MPSPRTHRRGN-DEKNRKDMRLSEKSKSFHGQSSGSSKTELLRRPKTVPDLLAG  54


 Score = 40.4 bits (93),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLI  553
            P KLTKLLLNVTIQRS G +QVLI
Sbjct  69   PMKLTKLLLNVTIQRSVGPVQVLI  92



>gb|EYU36098.1| hypothetical protein MIMGU_mgv1a014176mg [Erythranthe guttata]
Length=198

 Score = 46.2 bits (108),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSPK  R+GG E KN+KGRL+E+A SF    G   A  +L RPRTVPDLLA 
Sbjct  1    MPSPKCHRKGGLE-KNKKGRLSERASSFHVRGGGVVAE-MLPRPRTVPDLLAA  51


 Score = 43.1 bits (100),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            P KLTKLLL+VT+QRS GA+ VL+PP+
Sbjct  67   PQKLTKLLLHVTVQRSPGAVHVLLPPE  93



>emb|CAC09928.1| hypothetical protein [Catharanthus roseus]
Length=196

 Score = 48.5 bits (114),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = +1

Query  271  MPSPKTQ---RRGGTEEKNRKGRLAEKamsfsghsg--assaaVLLQRPRTVPDLLAGPE  435
            MPSPK Q   + G   EKNRKGRLAEKA+SF   +    ++  +LL RPRTVP+LL+G  
Sbjct  1    MPSPKNQNHRKSGSVGEKNRKGRLAEKALSFHAGTSVGNAAETMLLNRPRTVPNLLSG-G  59

Query  436  KFI  444
            KF+
Sbjct  60   KFV  62


 Score = 40.0 bits (92),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = +2

Query  473  LQF-PPKLTKLLLNVTIQRSTGALQVLIPPD  562
             QF PPKLTKLLLNVTI  S G +QVL  P+
Sbjct  69   FQFQPPKLTKLLLNVTIMGSVGPIQVLTSPE  99



>ref|XP_009616748.1| PREDICTED: uncharacterized protein LOC104109228 [Nicotiana tomentosiformis]
Length=198

 Score = 49.3 bits (116),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 2/53 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSP+  R+G T+EKNRKG+L+EK+MSF G S  S+   LL+RPRTVPDLL+ 
Sbjct  1    MPSPRNHRKG-TDEKNRKGKLSEKSMSFHGQSSESTTQ-LLRRPRTVPDLLSA  51


 Score = 39.3 bits (90),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  488  KLTKLLLNVTIQRSTGALQVLI  553
            KLTKLLLNVTIQRS GA+ VLI
Sbjct  67   KLTKLLLNVTIQRSLGAVHVLI  88



>gb|ABB87098.1| hypothetical protein [Solanum tuberosum]
Length=190

 Score = 47.8 bits (112),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKG-RLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSP+T RRG  +EKNRK  RL+EK+ SF G    SS   +L+RP+TVPDLLAG
Sbjct  2    MPSPRTHRRGN-DEKNRKDMRLSEKSKSFHGQISGSSKTEVLRRPKTVPDLLAG  54


 Score = 40.4 bits (93),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLI  553
            P KLTKLLLNVTIQRS G +QVLI
Sbjct  69   PMKLTKLLLNVTIQRSVGPVQVLI  92



>ref|XP_009599426.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
tomentosiformis]
Length=190

 Score = 48.1 bits (113),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 3/55 (5%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaV--LLQRPRTVPDLLAG  429
            M SP+  RRG  EEKNRKG+L+EK+MSF G S  SS+    LL+RPRTVPDLLAG
Sbjct  1    MSSPRINRRGN-EEKNRKGKLSEKSMSFHGQSSGSSSTPSELLRRPRTVPDLLAG  54


 Score = 39.7 bits (91),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 1/29 (3%)
 Frame = +2

Query  470  ALQFPP-KLTKLLLNVTIQRSTGALQVLI  553
            A+ F P KLTKLL+NVTIQRS G +QVLI
Sbjct  64   AVNFRPMKLTKLLVNVTIQRSVGPVQVLI  92



>ref|XP_009803629.1| PREDICTED: uncharacterized protein LOC104248970 [Nicotiana sylvestris]
Length=200

 Score = 50.8 bits (120),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 2/53 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSP++ R+G T+EKNRKG+L+EK+MSF G S  S+   LL+RPRTVPDLLA 
Sbjct  1    MPSPRSHRKG-TDEKNRKGKLSEKSMSFHGQSSESTTE-LLRRPRTVPDLLAA  51


 Score = 36.6 bits (83),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  488  KLTKLLLNVTIQRSTGALQVLI  553
            KLTKLLLNVTIQRS G + VLI
Sbjct  67   KLTKLLLNVTIQRSLGPVHVLI  88



>ref|XP_009588059.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
tomentosiformis]
Length=192

 Score = 47.8 bits (112),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 3/55 (5%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaV--LLQRPRTVPDLLAG  429
            M SP+  RRG  EEKNRKG+L+EK+MSF G S  SS+    LL+RPRTVPDLLAG
Sbjct  1    MSSPRINRRGN-EEKNRKGKLSEKSMSFHGQSSGSSSTSSELLRRPRTVPDLLAG  54


 Score = 38.9 bits (89),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 1/29 (3%)
 Frame = +2

Query  470  ALQFPP-KLTKLLLNVTIQRSTGALQVLI  553
            A+ F P KLTK+L+NVTIQRS G +QVLI
Sbjct  65   AVNFRPMKLTKMLVNVTIQRSVGPVQVLI  93



>ref|XP_004251013.1| PREDICTED: uncharacterized protein LOC101246792 [Solanum lycopersicum]
 ref|XP_010313326.1| PREDICTED: uncharacterized protein LOC101246792 [Solanum lycopersicum]
Length=198

 Score = 60.8 bits (146),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSP+  RRGG+EEKNRKG+L+EK+MSF   S   S + LL+RPRTVPDLL+ 
Sbjct  1    MPSPRNHRRGGSEEKNRKGKLSEKSMSFHVQSSEGSTSELLRRPRTVPDLLSA  53


 Score = 25.0 bits (53),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +2

Query  509  NVTIQRSTGALQVLI  553
            NVTIQRS G + VLI
Sbjct  77   NVTIQRSIGPVHVLI  91



>ref|XP_011090002.1| PREDICTED: uncharacterized protein At4g22758-like [Sesamum indicum]
Length=193

 Score = 43.5 bits (101),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSPK  R+    EKN+KGRL+EKA SF G      A  +L RPRTVP+LLAG
Sbjct  1    MPSPKNHRKV-VHEKNKKGRLSEKASSFHGKGAGVVAE-MLPRPRTVPELLAG  51


 Score = 42.7 bits (99),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            PPK TKLLLNVTIQRS G + VL+ P+
Sbjct  68   PPKFTKLLLNVTIQRSLGPVHVLMSPE  94



>ref|XP_004294037.1| PREDICTED: uncharacterized protein LOC101299937 [Fragaria vesca 
subsp. vesca]
Length=200

 Score = 43.1 bits (100),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLL  423
            MPSPK+QRR   E KNR+GRL  +          ++    L+RP+TVPD++
Sbjct  1    MPSPKSQRRVQEESKNRRGRLVSERSLSFHGQTLAATTPQLRRPKTVPDMV  51


 Score = 42.4 bits (98),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  470  ALQFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            A +  PKLTKLLLNVTIQ S GA+QV++ P+
Sbjct  66   AQELRPKLTKLLLNVTIQGSVGAVQVVMSPE  96



>ref|XP_008227132.1| PREDICTED: uncharacterized protein LOC103326671 [Prunus mume]
Length=194

 Score = 44.7 bits (104),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  470  ALQFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            A +  PKLTKLLLNVTIQ S GA+ V++PP+
Sbjct  62   ATELRPKLTKLLLNVTIQGSVGAIHVVMPPE  92


 Score = 37.0 bits (84),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDL  420
            MPSPK+  R   EEKNR+GR   +  S      +  A   L+RP+TVPD+
Sbjct  1    MPSPKSTHRRVHEEKNRRGRSLNEKSSSFHGQLSDMATPQLRRPKTVPDM  50



>ref|XP_006347223.1| PREDICTED: uncharacterized protein At4g22758-like [Solanum tuberosum]
Length=188

 Score = 45.8 bits (107),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  473  LQFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            LQ  PKLTKLLLNVTIQRS G +QVLI P+
Sbjct  62   LQVRPKLTKLLLNVTIQRSPGPVQVLISPE  91


 Score = 35.4 bits (80),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            M SP++ RR   EE+NRKG+L+EK+MSF G+   S++ +  +R RTVPDL +G
Sbjct  1    MASPRSHRRV-IEERNRKGKLSEKSMSFQGYIPGSTSEI-SRRIRTVPDLFSG  51



>ref|XP_009786754.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
sylvestris]
Length=190

 Score = 42.4 bits (98),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVL--LQRPRTVPDLLAG  429
            M SP+  RRG  EEKNRKG+L+EK+MSF G S  SS+     L+RPRTVPDL AG
Sbjct  1    MSSPRINRRGN-EEKNRKGKLSEKSMSFHGQSSGSSSTPSEQLRRPRTVPDLRAG  54


 Score = 38.9 bits (89),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 1/29 (3%)
 Frame = +2

Query  470  ALQFPP-KLTKLLLNVTIQRSTGALQVLI  553
            A+ F P KLTK+L+NVTIQRS G +QVLI
Sbjct  64   AVNFRPMKLTKMLVNVTIQRSVGPVQVLI  92



>ref|XP_006349080.1| PREDICTED: uncharacterized protein At4g22758-like [Solanum tuberosum]
Length=201

 Score = 55.8 bits (133),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MPSP+  RRGG+EEKNRKG+L+EK+MSF   S  SS + LL+RPRTVPDLL+ 
Sbjct  1    MPSPRNHRRGGSEEKNRKGKLSEKSMSFHVQSSESSTSELLRRPRTVPDLLSA  53


 Score = 25.0 bits (53),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +2

Query  509  NVTIQRSTGALQVLI  553
            NVTIQRS G + VLI
Sbjct  78   NVTIQRSIGPVHVLI  92



>ref|XP_004241302.1| PREDICTED: uncharacterized protein At4g22758-like [Solanum lycopersicum]
Length=187

 Score = 45.8 bits (107),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  473  LQFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            LQ  PKLTKLLLNVTIQRS G +QVLI P+
Sbjct  62   LQVRPKLTKLLLNVTIQRSPGPVQVLISPE  91


 Score = 34.3 bits (77),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            M SP++ RR   EE+NRKG+L+EK+MSF G+   S++ +  +R RTVPDL +G
Sbjct  1    MASPRSCRRV-IEERNRKGKLSEKSMSFEGYIPGSTSEI-SRRIRTVPDLFSG  51



>ref|XP_010089162.1| hypothetical protein L484_003293 [Morus notabilis]
 gb|EXB37423.1| hypothetical protein L484_003293 [Morus notabilis]
Length=195

 Score = 40.8 bits (94),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  476  QFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            Q P KLTKLLLNVTIQ S GA+QV++ P+
Sbjct  63   QRPMKLTKLLLNVTIQGSLGAVQVVMTPE  91


 Score = 39.3 bits (90),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLL  423
            M SPK  RRG  EEKNR+GRLAEK+ SF G S +   +  L+RP+TV DLL
Sbjct  1    MASPKNHRRGH-EEKNRRGRLAEKSSSFHGRSPSEPTSQ-LRRPKTVSDLL  49



>ref|XP_002269322.1| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
Length=196

 Score = 41.2 bits (95),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            P+LTKLLLNVT+QRS G +QV++ PD
Sbjct  65   PRLTKLLLNVTVQRSLGPVQVVMSPD  90


 Score = 38.1 bits (87),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghs-gassaaVLLQRPRTVPDLLAG  429
            M + K  RRG  EEKNRKGRLA+++ SF        +    L+RP+T+PDLL+G
Sbjct  1    MSTSKIHRRG-HEEKNRKGRLAQRSSSFHSGIPMTMAPQAELRRPKTLPDLLSG  53



>emb|CAN83835.1| hypothetical protein VITISV_009604 [Vitis vinifera]
Length=197

 Score = 41.2 bits (95),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            P+LTKLLLNVT+QRS G +QV++ PD
Sbjct  66   PRLTKLLLNVTVQRSLGPVQVVMSPD  91


 Score = 37.7 bits (86),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghs-gassaaVLLQRPRTVPDLLAG  429
            M + K  RRG  EEKNRKGRLA+++ SF        +    L+RP+T+PDLL+G
Sbjct  1    MSTSKXHRRG-HEEKNRKGRLAQRSSSFHSGIPMTMAPQAELRRPKTLPDLLSG  53



>ref|XP_009587253.1| PREDICTED: uncharacterized protein LOC104084994 [Nicotiana tomentosiformis]
Length=196

 Score = 39.7 bits (91),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  488  KLTKLLLNVTIQRSTGALQVLIPPD  562
            KLTKLLLNVTIQRS G + VLI P+
Sbjct  69   KLTKLLLNVTIQRSLGPVHVLISPE  93


 Score = 38.5 bits (88),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +1

Query  268  PMPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            P P+P++ RR   EEKNRKG+L EK+MS  G    S++  + +RPRTVP+L +G
Sbjct  2    PSPTPRSHRRV-IEEKNRKGKLPEKSMSLHGDISGSTSE-MSRRPRTVPNLFSG  53



>gb|KDP34370.1| hypothetical protein JCGZ_11253 [Jatropha curcas]
Length=205

 Score = 40.4 bits (93),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            PKLTKLLLNVT+Q S GA+QV++ P+
Sbjct  66   PKLTKLLLNVTVQGSAGAVQVVMSPE  91


 Score = 37.0 bits (84),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +1

Query  271  MPS-PKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MP+ PK+ RRG   EKNRK RL +KA SF G          ++RP T+P+LL G
Sbjct  1    MPTTPKSNRRGQEPEKNRKNRLTDKASSFHGRIPVDVPEPRMRRPNTLPNLLGG  54



>ref|XP_002279186.1| PREDICTED: uncharacterized protein LOC100262329 [Vitis vinifera]
Length=113

 Score = 39.7 bits (91),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            P+LTKLLLN+T+QRS G +QV++ PD
Sbjct  65   PQLTKLLLNLTVQRSLGPVQVVMSPD  90


 Score = 37.7 bits (86),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassa-aVLLQRPRTVPDLLAGPEKF  441
            M + KT RRG  EEKN KG+LA+++ SF      + A    L+RP+T+PDLL+G   F
Sbjct  1    MSTSKTHRRG-HEEKNLKGKLAQRSSSFHSSIPMTMAPQAELRRPKTLPDLLSGRSVF  57



>gb|EPS60596.1| hypothetical protein M569_14207, partial [Genlisea aurea]
Length=152

 Score = 39.3 bits (90),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            PPKLTK+LLN+T+QRS  A++++I P+
Sbjct  67   PPKLTKILLNMTVQRSHTAVKLVISPE  93


 Score = 37.4 bits (85),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 3/53 (6%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEK-NRKGRL--AEKamsfsghsgassaaVLLQRPRTVPDL  420
            MPSPK+ R+G + EK NRKG L  A    +  G  G   AA +LQRPRT P+L
Sbjct  1    MPSPKSYRKGASPEKINRKGVLTRASSFQAADGGGGGGVAAEMLQRPRTFPNL  53



>ref|XP_009783453.1| PREDICTED: uncharacterized protein LOC104232056 [Nicotiana sylvestris]
Length=212

 Score = 40.4 bits (93),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +2

Query  473  LQFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            +Q   KLTKLLLNVTIQRS G + VLI P+
Sbjct  63   VQVRLKLTKLLLNVTIQRSLGPIHVLISPE  92


 Score = 35.8 bits (81),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAGPE  435
            MPSP++ RR   EEK RKG+L EK+MS  G    S++  + +RPRT P+L +G E
Sbjct  2    MPSPRSHRRV-IEEKIRKGKLPEKSMSLHGDISGSTSE-MSRRPRTAPNLFSGRE  54



>ref|XP_009337403.1| PREDICTED: uncharacterized protein LOC103929867 [Pyrus x bretschneideri]
 ref|XP_009337404.1| PREDICTED: uncharacterized protein LOC103929867 [Pyrus x bretschneideri]
Length=197

 Score = 43.1 bits (100),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  470  ALQFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            +++  PKLTKLLLNVTIQ S GA+QV++ P+
Sbjct  64   SMELRPKLTKLLLNVTIQGSVGAIQVVMSPE  94


 Score = 32.7 bits (73),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 28/51 (55%), Gaps = 1/51 (2%)
 Frame = +1

Query  271  MPSPKTQ-RRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDL  420
            MPSPK+  RRG  EEKNR+ R      S         A   L+RP+TVPD+
Sbjct  1    MPSPKSSSRRGQPEEKNRRPRPLSDRSSSFHGQFPEVATQQLRRPKTVPDM  51



>ref|XP_011044435.1| PREDICTED: uncharacterized protein At4g22758 [Populus euphratica]
Length=202

 Score = 37.7 bits (86),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  268  PMPSPKTQRRGGTE-EKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            P P+   +R GG E E+NRK RL EKA+SF G   A      ++RP+T+PDLLAG
Sbjct  3    PTPTKGYRRGGGQELERNRKNRLNEKALSFHGKIPAEITEARIRRPKTLPDLLAG  57


 Score = 37.4 bits (85),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLI  553
            PKLTK+LLNVT+Q S GA+QVL+
Sbjct  69   PKLTKVLLNVTVQGSVGAVQVLM  91



>ref|XP_002313647.1| hypothetical protein POPTR_0009s15140g [Populus trichocarpa]
 gb|EEE87602.1| hypothetical protein POPTR_0009s15140g [Populus trichocarpa]
Length=202

 Score = 37.7 bits (86),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLI  553
            PKLTK+LLNVT+Q S GA+QVL+
Sbjct  69   PKLTKVLLNVTVQGSVGAVQVLM  91


 Score = 37.4 bits (85),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  268  PMPSPKTQRRGGTE-EKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            P P+   +R GG E E+NRK RL EKA+SF G   A      ++RP+T+PDLLAG
Sbjct  3    PTPTKGYRRGGGQELERNRKNRLNEKALSFHGKIPAEMPEARIRRPKTLPDLLAG  57



>ref|XP_008344912.1| PREDICTED: uncharacterized protein LOC103407817 [Malus domestica]
Length=197

 Score = 41.6 bits (96),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  476  QFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            +  PKLTKLLLNVTIQ S GA+QV++ P+
Sbjct  66   ELRPKLTKLLLNVTIQGSVGAVQVVMSPE  94


 Score = 33.1 bits (74),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +1

Query  271  MPSPK-TQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDL  420
            MPSPK + RRG  EEKNR+ R      S        +AA  L+RP+TVPD+
Sbjct  1    MPSPKISSRRGQPEEKNRRPRPLSVRSSSFHGQFTDAAAPQLRRPKTVPDM  51



>ref|XP_006384668.1| hypothetical protein POPTR_0004s20000g [Populus trichocarpa]
 gb|ERP62465.1| hypothetical protein POPTR_0004s20000g [Populus trichocarpa]
Length=204

 Score = 39.3 bits (90),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            PKLTK+L+NVT+Q S GA+QVL+ P+
Sbjct  68   PKLTKVLVNVTVQGSVGAVQVLMSPE  93


 Score = 35.0 bits (79),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = +1

Query  271  MPSPKTQ--RRGGTE-EKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MP+  T+  RRGG + E+NRK RL  KA SF G   A      ++RP+T+PDLLAG
Sbjct  1    MPTTPTKGNRRGGQDPERNRKNRLTAKASSFHGKIPAEIPEARIRRPKTLPDLLAG  56



>ref|XP_011005606.1| PREDICTED: uncharacterized protein At4g22758-like [Populus euphratica]
Length=204

 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            PKLTK+L+NVT+Q S GA+QVL+ P+
Sbjct  68   PKLTKVLVNVTVQGSVGAVQVLMSPE  93


 Score = 35.0 bits (79),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = +1

Query  271  MPSPKTQ--RRGGTE-EKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MP+  T+  RRGG + E+NRK RL  KA SF G   A      ++RP+T+PDLLAG
Sbjct  1    MPTTPTKGNRRGGQDPERNRKNRLTAKASSFHGKIPAEIPEARIRRPKTLPDLLAG  56



>ref|XP_008385454.1| PREDICTED: uncharacterized protein LOC103447997 [Malus domestica]
Length=197

 Score = 43.1 bits (100),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  470  ALQFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            +++  PKLTKLLLNVTIQ S GA+QV++ P+
Sbjct  64   SMELRPKLTKLLLNVTIQGSVGAIQVVMSPE  94


 Score = 30.4 bits (67),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (53%), Gaps = 1/51 (2%)
 Frame = +1

Query  271  MPSPKTQ-RRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDL  420
            MPSPK+  RRG  EEK R+ R      S         A   L+RP+TVPD+
Sbjct  1    MPSPKSSSRRGQPEEKYRRPRPLSDRSSSFHGQFPEMATQQLRRPKTVPDM  51



>ref|XP_010278240.1| PREDICTED: uncharacterized protein At4g22758 [Nelumbo nucifera]
Length=193

 Score = 44.7 bits (104),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            P KLTKLLLNVTIQRS GA+QV+I P+
Sbjct  64   PAKLTKLLLNVTIQRSLGAIQVVISPE  90


 Score = 28.5 bits (62),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 3/54 (6%)
 Frame = +1

Query  271  MP-SPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MP S K  RRG  ++  + G+L EK+ SF G S      +L  RP+T PDLL+G
Sbjct  1    MPTSSKNHRRGHEDKVVKMGKLTEKSSSFHGRSNLIPPQLL--RPKTDPDLLSG  52



>ref|XP_007015951.1| Uncharacterized protein TCM_041515 [Theobroma cacao]
 gb|EOY33570.1| Uncharacterized protein TCM_041515 [Theobroma cacao]
Length=185

 Score = 42.0 bits (97),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            PKLTKLLLNVTIQ S GA+QVL+ P+
Sbjct  61   PKLTKLLLNVTIQGSLGAVQVLMSPE  86


 Score = 31.2 bits (69),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLA  426
            MP+ K  R+    EKNR+GRL+EKA SF G     + A  L+RP+T+PDLL+
Sbjct  1    MPNSKNNRK--EPEKNRRGRLSEKASSFHGRIPTIAPAE-LRRPKTLPDLLS  49



>gb|KJB06372.1| hypothetical protein B456_001G119300 [Gossypium raimondii]
 gb|KJB06373.1| hypothetical protein B456_001G119300 [Gossypium raimondii]
Length=183

 Score = 40.4 bits (93),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            PKLTKLLLNVTIQ S GA+QV++ P+
Sbjct  61   PKLTKLLLNVTIQGSLGAVQVVLSPE  86


 Score = 32.0 bits (71),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLA  426
            MP+ K  R+   +EKNRKG+L+EKA SF G     + +  L+RP+T+PDL +
Sbjct  1    MPNSKNNRK--EQEKNRKGKLSEKASSFHGKFPTVAPSD-LRRPKTLPDLFS  49



>gb|EYU36977.1| hypothetical protein MIMGU_mgv1a014088mg [Erythranthe guttata]
Length=201

 Score = 38.5 bits (88),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  470  ALQFPPKLTKLLLNVTIQRSTGALQVLIP  556
            A+  P KLTKLLLNVTI R  GA++V++P
Sbjct  67   AIGAPAKLTKLLLNVTIHRCLGAVRVVVP  95


 Score = 33.5 bits (75),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 9/60 (15%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNR-KGR----LAEKamsfs--ghsgassaaVLLQRPRTVPDLLAG  429
            MPSPK  R+ G  EKN+ KG     L+EK+ SF         +A ++L+RPRT PDL AG
Sbjct  1    MPSPKIHRKAG--EKNKIKGMMRKTLSEKSSSFHGRDDGAVVAAEMILRRPRTAPDLFAG  58



>ref|XP_009349334.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=200

 Score = 39.7 bits (91),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            PKLTKLLLNVTIQ S GA+ V++ P+
Sbjct  70   PKLTKLLLNVTIQGSVGAVHVVMSPE  95


 Score = 32.3 bits (72),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 2/52 (4%)
 Frame = +1

Query  271  MPSPK-TQRRGGTEEKNRKGR-LAEKamsfsghsgassaaVLLQRPRTVPDL  420
            MPSPK + RRG  EEKNR+ R L+ ++ SF G    ++    L+RP+TVPD+
Sbjct  1    MPSPKISSRRGQPEEKNRRPRPLSVRSSSFHGQFTDAAPPPQLRRPKTVPDM  52



>ref|XP_009364846.1| PREDICTED: uncharacterized protein At4g22758 [Pyrus x bretschneideri]
Length=194

 Score = 39.3 bits (90),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +2

Query  485  PKLTKLLLNVTIQRSTGALQVLIPPD  562
            PKLTKLLLNVTIQ S GA+ V++ P+
Sbjct  70   PKLTKLLLNVTIQGSVGAVHVVMSPE  95


 Score = 32.3 bits (72),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 2/52 (4%)
 Frame = +1

Query  271  MPSPK-TQRRGGTEEKNRKGR-LAEKamsfsghsgassaaVLLQRPRTVPDL  420
            MPSPK + RRG  EEKNR+ R L+ ++ SF G    ++    L+RP+TVPD+
Sbjct  1    MPSPKISSRRGQPEEKNRRPRPLSVRSSSFHGQFTDAAPPPQLRRPKTVPDM  52



>ref|XP_002527451.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34943.1| conserved hypothetical protein [Ricinus communis]
Length=199

 Score = 42.4 bits (98),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  470  ALQFPPKLTKLLLNVTIQRSTGALQVLIPPD  562
            +++  PKLTKLLLNVT+Q S GA+QVL+ P+
Sbjct  65   SMEARPKLTKLLLNVTVQGSVGAVQVLMSPE  95


 Score = 29.3 bits (64),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query  271  MPS-PKTQRRGGTE--EKNRKGRLAEKamsfsghsgassaaVLLQRPRTVPDLLAG  429
            MP+ PK   R G E  + +RK RL EKA SF G     +    ++RP T+PDLL G
Sbjct  1    MPTTPKISNRRGQEPEKSSRKNRLKEKASSFHGRIPVDAPEARIRRPNTLPDLLGG  56



>emb|CDX71412.1| BnaC04g16470D [Brassica napus]
Length=194

 Score = 43.9 bits (102),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            PP+LTKLLLNVT+Q S GALQ++I P+
Sbjct  70   PPRLTKLLLNVTVQGSLGALQIIISPE  96


 Score = 26.6 bits (57),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  268  PMPSPKTQRRG--GTEEKNRKGRLAEKamsfsghsga-ssaaVLLQRPRTVPDLLA  426
            P+ S    R+G  G  EKNR+G+L EKAMSF G      S    L+RP+T+P+L +
Sbjct  2    PVNSKNANRKGTTGETEKNRRGKLQEKAMSFHGRGTVPHSNPGELRRPKTLPELFS  57



>ref|XP_006471415.1| PREDICTED: uncharacterized protein LOC102620132 isoform X1 [Citrus 
sinensis]
Length=197

 Score = 39.7 bits (91),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            P KLTKLLLNVT+Q S GAL V++ P+
Sbjct  66   PKKLTKLLLNVTVQGSVGALHVIMSPE  92


 Score = 30.8 bits (68),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfs--ghsgassaaVLLQRPRTVPDLL  423
            MP+ K+ RRG  +E +R+ RL+EK+ SF     +   +    L+RP+T+PDLL
Sbjct  1    MPNTKSHRRG-VQESSRRARLSEKSSSFHGGIPATMQTDQKELRRPKTLPDLL  52



>ref|XP_009103627.1| PREDICTED: uncharacterized protein At4g22758 [Brassica rapa]
 emb|CDY04516.1| BnaA07g13420D [Brassica napus]
Length=194

 Score = 43.9 bits (102),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            PP+LTKLLLNVT+Q S GALQ++I P+
Sbjct  70   PPRLTKLLLNVTVQGSLGALQIIISPE  96


 Score = 26.2 bits (56),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  268  PMPSPKTQRRG--GTEEKNRKGRLAEKamsfsghsga-ssaaVLLQRPRTVPDLLA  426
            P+ S    R+G  G  EKNR+G+L EKAMSF G      S    L+RP+T+P+L +
Sbjct  2    PVNSKTANRKGTTGETEKNRRGKLQEKAMSFHGRGTVPHSNPGELRRPKTLPELFS  57



>gb|EYU36099.1| hypothetical protein MIMGU_mgv1a014176mg [Erythranthe guttata]
Length=161

 Score = 43.1 bits (100),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            P KLTKLLL+VT+QRS GA+ VL+PP+
Sbjct  30   PQKLTKLLLHVTVQRSPGAVHVLLPPE  56


 Score = 26.6 bits (57),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +1

Query  388  LLQRPRTVPDLLAG  429
            +L RPRTVPDLLA 
Sbjct  1    MLPRPRTVPDLLAA  14



>ref|XP_006424343.1| hypothetical protein CICLE_v10029315mg [Citrus clementina]
 gb|ESR37583.1| hypothetical protein CICLE_v10029315mg [Citrus clementina]
Length=197

 Score = 39.3 bits (90),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  PPKLTKLLLNVTIQRSTGALQVLIPPD  562
            P KLTKLLLNVT+Q S GAL V++ P+
Sbjct  66   PKKLTKLLLNVTVQGSVGALHVIMSPE  92


 Score = 29.6 bits (65),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = +1

Query  271  MPSPKTQRRGGTEEKNRKGRLAEKamsfsghsgassaaVL--LQRPRTVPDLL  423
            MP+ K+ RRG  +E +R+ +L+EK+ SF G   A+       L+RP+T+PDLL
Sbjct  1    MPNTKSHRRG-VQEPSRRAKLSEKSSSFHGGIPATMQTYQKELRRPKTLPDLL  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880