BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001J01

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAG10403.1|AF233284_1  mannose-binding lectin                        144   1e-39   Convolvulus arvensis
gb|AAC49564.1|  lectin                                                  137   5e-37   Calystegia sepium
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...    132   3e-35   Calystegia sepium
dbj|BAA14024.1|  ipomoelin                                              103   4e-24   Ipomoea batatas [batate]
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...    103   4e-24   Ipomoea batatas [batate]
gb|AAA87042.1|  putative 32.7 kDa jasmonate-induced protein           78.2    6e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA93998.1|  NB-ARC domain containing protein, expressed           79.0    3e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52195.1|  hypothetical protein OsJ_34074                        78.2    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  78.2    4e-13   Nicotiana sylvestris
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  78.2    4e-13   Nicotiana sylvestris
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  78.2    4e-13   Nicotiana sylvestris
ref|XP_010690084.1|  PREDICTED: jacalin-related lectin 19             73.9    5e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS66150.1|  hypothetical protein TRIUR3_12251                     74.3    1e-12   Triticum urartu
gb|AAA87041.1|  putative 32.6 kDa jasmonate-induced protein           74.3    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001066367.1|  Os12g0198700                                     74.3    1e-12   
ref|XP_006853911.1|  hypothetical protein AMTR_s00036p00183970        71.6    1e-12   
ref|XP_006343016.1|  PREDICTED: agglutinin-like                       72.8    2e-12   Solanum tuberosum [potatoes]
ref|XP_009398855.1|  PREDICTED: protein GOS9-like                     72.0    2e-12   
ref|XP_004235622.1|  PREDICTED: jacalin-related lectin 19             72.4    2e-12   Solanum lycopersicum
dbj|BAK00987.1|  predicted protein                                    73.2    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010230396.1|  PREDICTED: jacalin-related lectin 3-like         72.0    4e-12   Brachypodium distachyon [annual false brome]
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  75.5    4e-12   Nicotiana sylvestris
gb|EEC68267.1|  hypothetical protein OsI_36302                        75.1    5e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  75.1    5e-12   Nicotiana sylvestris
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  74.7    6e-12   Nicotiana sylvestris
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  74.7    6e-12   Nicotiana sylvestris
ref|XP_009589464.1|  PREDICTED: agglutinin-like                       73.2    6e-12   Nicotiana tomentosiformis
ref|XP_006663483.1|  PREDICTED: probable disease resistance RPP8-...  74.7    6e-12   
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...  74.3    9e-12   Nicotiana sylvestris
gb|EAZ01021.1|  hypothetical protein OsI_23055                        73.6    9e-12   Oryza sativa Indica Group [Indian rice]
emb|CAD40628.2|  OSJNBa0016N04.16                                     73.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440163.1|  hypothetical protein SORBIDRAFT_09g027055        70.5    1e-11   
gb|EMT11070.1|  hypothetical protein F775_02114                       72.0    1e-11   
ref|XP_004168675.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    1e-11   
ref|NP_001052560.1|  Os04g0369100                                     73.2    1e-11   
gb|EEE60834.1|  hypothetical protein OsJ_14451                        73.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAR20919.1|  jasmonate-induced protein                             71.2    2e-11   Triticum aestivum [Canadian hard winter wheat]
gb|ABA94002.1|  Jacalin-like lectin domain containing protein, ex...  73.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002439182.1|  hypothetical protein SORBIDRAFT_09g001880        70.9    2e-11   Sorghum bicolor [broomcorn]
gb|EEC68269.1|  hypothetical protein OsI_36304                        73.2    2e-11   Oryza sativa Indica Group [Indian rice]
gb|EEE52196.1|  hypothetical protein OsJ_34075                        73.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007215056.1|  hypothetical protein PRUPE_ppa012210mg           69.3    2e-11   
ref|XP_004152769.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  73.2    2e-11   Nicotiana tomentosiformis
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  73.2    2e-11   Nicotiana tomentosiformis
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  73.2    2e-11   Nicotiana tomentosiformis
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  73.2    2e-11   Nicotiana tomentosiformis
gb|EMT24046.1|  hypothetical protein F775_25349                       70.9    2e-11   
gb|ABS82785.1|  jasmonate-induced protein                             70.5    2e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008244753.1|  PREDICTED: agglutinin-like                       68.9    2e-11   Prunus mume [ume]
ref|XP_011030089.1|  PREDICTED: jacalin-related lectin 19             69.3    3e-11   Populus euphratica
ref|XP_002318228.2|  hypothetical protein POPTR_0012s13320g           69.7    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  72.4    3e-11   Nicotiana sylvestris
ref|XP_006647196.1|  PREDICTED: disease resistance protein RPM1-l...  72.4    3e-11   Oryza brachyantha
ref|XP_006372713.1|  hypothetical protein POPTR_0017s043602g          68.9    3e-11   
ref|XP_006647195.1|  PREDICTED: disease resistance protein RPM1-l...  72.4    3e-11   Oryza brachyantha
ref|XP_008444758.1|  PREDICTED: LOW QUALITY PROTEIN: myrosinase-b...  72.0    3e-11   
gb|KGN62634.1|  hypothetical protein Csa_2G362470                     71.6    3e-11   Cucumis sativus [cucumbers]
ref|XP_008806706.1|  PREDICTED: agglutinin-like isoform X1            68.9    4e-11   Phoenix dactylifera
ref|XP_008806712.1|  PREDICTED: agglutinin-like isoform X2            68.9    4e-11   Phoenix dactylifera
ref|NP_001066495.1|  Os12g0247700                                     70.1    4e-11   
gb|EMS55842.1|  hypothetical protein TRIUR3_32339                     69.7    4e-11   Triticum urartu
ref|XP_008348486.1|  PREDICTED: agglutinin alpha chain-like           68.6    4e-11   Malus domestica [apple tree]
ref|XP_008677994.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    4e-11   Zea mays [maize]
ref|XP_008677998.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    4e-11   Zea mays [maize]
ref|XP_008677991.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    5e-11   
ref|XP_008677986.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    5e-11   
ref|XP_008677996.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    5e-11   Zea mays [maize]
ref|XP_008677990.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    5e-11   
ref|XP_010924945.1|  PREDICTED: jacalin-related lectin 19-like is...  68.6    5e-11   Elaeis guineensis
gb|EEC69076.1|  hypothetical protein OsI_37951                        68.9    5e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_008654961.1|  PREDICTED: LOC100282355 isoform X1               68.9    5e-11   
ref|XP_008654962.1|  PREDICTED: LOC100282355 isoform X2               68.9    5e-11   Zea mays [maize]
ref|XP_010924946.1|  PREDICTED: jacalin-related lectin 19-like is...  68.6    5e-11   Elaeis guineensis
ref|XP_008677992.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    5e-11   
ref|XP_006853910.1|  hypothetical protein AMTR_s00036p00183430        68.2    5e-11   
ref|XP_008654963.1|  PREDICTED: LOC100282355 isoform X3               68.6    5e-11   
ref|NP_001148739.1|  LOC100282355                                     68.6    5e-11   Zea mays [maize]
ref|XP_011463712.1|  PREDICTED: jacalin-related lectin 3-like         70.9    6e-11   Fragaria vesca subsp. vesca
ref|XP_008654965.1|  PREDICTED: LOC100282355 isoform X4               68.2    6e-11   Zea mays [maize]
sp|P83304.1|LEC_PARPC  RecName: Full=Mannose/glucose-specific lectin  70.5    6e-11   Parkia platycephala
ref|XP_004982894.1|  PREDICTED: salt stress-induced protein-like      67.4    6e-11   
gb|EAY82651.1|  hypothetical protein OsI_37872                        69.3    8e-11   Oryza sativa Indica Group [Indian rice]
gb|EEE60695.1|  hypothetical protein OsJ_14181                        65.9    8e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  70.9    9e-11   Nicotiana sylvestris
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  70.9    9e-11   Nicotiana sylvestris
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  70.9    9e-11   Nicotiana sylvestris
ref|XP_010273654.1|  PREDICTED: mannose/glucose-specific lectin-like  67.0    9e-11   Nelumbo nucifera [Indian lotus]
ref|XP_009770862.1|  PREDICTED: putative late blight resistance p...  70.9    9e-11   Nicotiana sylvestris
gb|EYU45843.1|  hypothetical protein MIMGU_mgv1a014002mg              67.8    9e-11   Erythranthe guttata [common monkey flower]
ref|XP_006426466.1|  hypothetical protein CICLE_v10026553mg           67.4    1e-10   Citrus clementina [clementine]
gb|KDO58671.1|  hypothetical protein CISIN_1g037526mg                 67.4    1e-10   Citrus sinensis [apfelsine]
ref|XP_006853909.1|  hypothetical protein AMTR_s00036p00182710        67.4    1e-10   
gb|ACF87628.1|  unknown                                               66.2    1e-10   Zea mays [maize]
emb|CDM80625.1|  unnamed protein product                              68.6    1e-10   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001106057.1|  PL3K2                                            66.2    2e-10   Zea mays [maize]
gb|ACG29554.1|  hypothetical protein                                  66.2    2e-10   Zea mays [maize]
ref|XP_009622525.1|  PREDICTED: agglutinin-like isoform X2            69.3    2e-10   
ref|XP_009622524.1|  PREDICTED: mannose/glucose-specific lectin-l...  69.3    2e-10   Nicotiana tomentosiformis
ref|XP_011001798.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.9    2e-10   Populus euphratica
ref|XP_011001797.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.9    2e-10   Populus euphratica
ref|XP_002515891.1|  hypothetical protein RCOM_1485780                68.9    2e-10   
ref|NP_177447.1|  Mannose-binding lectin superfamily protein          66.2    3e-10   
ref|XP_011081586.1|  PREDICTED: jacalin-related lectin 19-like        67.8    3e-10   
ref|XP_009367509.1|  PREDICTED: agglutinin alpha chain                66.2    3e-10   Pyrus x bretschneideri [bai li]
ref|NP_001052399.1|  Os04g0295400                                     65.5    3e-10   
ref|XP_006390600.1|  hypothetical protein EUTSA_v10019210mg           65.9    3e-10   Eutrema salsugineum [saltwater cress]
gb|AFK34206.1|  unknown                                               65.9    3e-10   Lotus japonicus
ref|XP_002450764.1|  hypothetical protein SORBIDRAFT_05g017250        69.3    3e-10   
gb|KCW69704.1|  hypothetical protein EUGRSUZ_F03098                   66.6    3e-10   Eucalyptus grandis [rose gum]
ref|XP_010471351.1|  PREDICTED: jacalin-related lectin 19             65.9    3e-10   Camelina sativa [gold-of-pleasure]
gb|KCW69706.1|  hypothetical protein EUGRSUZ_F03098                   66.6    3e-10   Eucalyptus grandis [rose gum]
gb|EAY93469.1|  hypothetical protein OsI_15270                        65.5    3e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004960459.1|  PREDICTED: salt stress-induced protein-like      65.5    3e-10   Setaria italica
ref|XP_009391787.1|  PREDICTED: agglutinin-like                       66.6    4e-10   
emb|CAJ38387.1|  jacalin-domain protein                               65.9    4e-10   Plantago major [cart-track plant]
ref|XP_011001796.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.6    4e-10   Populus euphratica
ref|XP_010062570.1|  PREDICTED: jacalin-related lectin 19             66.6    4e-10   Eucalyptus grandis [rose gum]
ref|XP_006301377.1|  hypothetical protein CARUB_v10021789mg           65.5    5e-10   
emb|CDP17400.1|  unnamed protein product                              67.0    5e-10   Coffea canephora [robusta coffee]
emb|CDO97947.1|  unnamed protein product                              66.6    5e-10   Coffea canephora [robusta coffee]
ref|XP_002888904.1|  predicted protein                                65.1    6e-10   
gb|EEC72970.1|  hypothetical protein OsI_06866                        68.2    6e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAD23250.1|  putative LZ-NBS-LRR class RGA                        68.2    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010030903.1|  PREDICTED: agglutinin alpha chain-like           63.5    6e-10   
pdb|4MQ0|A  Chain A, Crystal Structure Of Parkia Biglobosa Seed L...  67.4    6e-10   Parkia biglobosa
gb|EMT07330.1|  Disease resistance protein RPM1                       68.2    6e-10   
gb|AFW60405.1|  putative protein kinase superfamily protein           67.8    7e-10   
ref|XP_008348483.1|  PREDICTED: agglutinin-like isoform X1            64.7    9e-10   
ref|XP_010232948.1|  PREDICTED: jacalin-related lectin 19-like        65.9    9e-10   
ref|XP_008348484.1|  PREDICTED: agglutinin-like isoform X2            64.3    9e-10   
gb|KDP40814.1|  hypothetical protein JCGZ_24813                       64.7    9e-10   Jatropha curcas
ref|XP_008656248.1|  PREDICTED: putative receptor-like protein ki...  67.0    1e-09   Zea mays [maize]
gb|AFW81812.1|  putative protein kinase superfamily protein           67.0    1e-09   
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  67.8    1e-09   
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  67.8    1e-09   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  67.8    1e-09   
ref|XP_010232946.1|  PREDICTED: uncharacterized protein LOC104583002  65.5    1e-09   
gb|KHG23822.1|  Agglutinin alpha chain                                64.3    1e-09   Gossypium arboreum [tree cotton]
ref|XP_004297619.2|  PREDICTED: agglutinin                            67.0    1e-09   Fragaria vesca subsp. vesca
gb|EMS58273.1|  hypothetical protein TRIUR3_17900                     65.9    1e-09   Triticum urartu
ref|XP_004961357.1|  PREDICTED: agglutinin-like                       64.7    1e-09   Setaria italica
ref|XP_010654564.1|  PREDICTED: jacalin-related lectin 19-like        64.3    1e-09   Vitis vinifera
gb|EMS65594.1|  hypothetical protein TRIUR3_06346                     65.9    1e-09   Triticum urartu
gb|EMT07650.1|  Horcolin                                              65.9    1e-09   
ref|XP_009622528.1|  PREDICTED: agglutinin-like isoform X5            66.6    1e-09   Nicotiana tomentosiformis
ref|XP_009622527.1|  PREDICTED: agglutinin-like isoform X4            66.6    1e-09   
ref|XP_006372325.1|  Mannose/glucose-specific lectin family protein   66.6    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006663456.1|  PREDICTED: disease resistance protein RPM1-like  67.0    1e-09   
emb|CBI35988.3|  unnamed protein product                              64.3    1e-09   Vitis vinifera
gb|KJB70346.1|  hypothetical protein B456_011G068300                  63.9    2e-09   Gossypium raimondii
ref|XP_009127966.1|  PREDICTED: agglutinin                            63.9    2e-09   Brassica rapa
ref|XP_006663484.1|  PREDICTED: putative disease resistance RPP13...  67.0    2e-09   
ref|XP_010428208.1|  PREDICTED: jacalin-related lectin 19-like is...  63.5    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010428207.1|  PREDICTED: jacalin-related lectin 19-like is...  64.3    2e-09   
ref|XP_009622526.1|  PREDICTED: agglutinin-like isoform X3            66.2    2e-09   
ref|XP_010088386.1|  hypothetical protein L484_008121                 63.9    2e-09   Morus notabilis
gb|EAY80990.1|  hypothetical protein OsI_36172                        66.6    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010428206.1|  PREDICTED: jacalin-related lectin 19-like is...  63.9    2e-09   
ref|XP_010267066.1|  PREDICTED: jacalin-related lectin 19             63.5    3e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010060992.1|  PREDICTED: jacalin-related lectin 3              66.2    3e-09   Eucalyptus grandis [rose gum]
ref|XP_009784520.1|  PREDICTED: uncharacterized protein LOC104232941  66.2    3e-09   Nicotiana sylvestris
ref|NP_001148448.1|  jasmonate-induced protein                        63.2    3e-09   
gb|KEH39538.1|  mannose-binding lectin superfamily protein            63.2    3e-09   Medicago truncatula
gb|KEH39536.1|  mannose-binding lectin superfamily protein            63.2    3e-09   Medicago truncatula
ref|XP_010231090.1|  PREDICTED: jacalin-related lectin 19-like is...  63.5    3e-09   Brachypodium distachyon [annual false brome]
gb|KEH39537.1|  mannose-binding lectin superfamily protein            63.2    3e-09   Medicago truncatula
ref|XP_002893064.1|  hypothetical protein ARALYDRAFT_472198           66.2    3e-09   
ref|XP_009338132.1|  PREDICTED: uncharacterized protein LOC103930...  65.9    3e-09   Pyrus x bretschneideri [bai li]
gb|KFK41744.1|  hypothetical protein AALP_AA2G166700                  62.8    4e-09   Arabis alpina [alpine rockcress]
ref|XP_009768586.1|  PREDICTED: jacalin-related lectin 3-like         63.5    4e-09   Nicotiana sylvestris
ref|XP_009588771.1|  PREDICTED: agglutinin-like                       64.7    4e-09   Nicotiana tomentosiformis
ref|XP_007024409.1|  Mannose-binding lectin superfamily protein       64.3    4e-09   
ref|XP_010231089.1|  PREDICTED: jacalin-related lectin 19-like is...  63.2    4e-09   Brachypodium distachyon [annual false brome]
gb|AFW82809.1|  hypothetical protein ZEAMMB73_630227                  62.8    4e-09   
ref|NP_001185041.1|  Mannose-binding lectin superfamily protein       65.5    4e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EMT18893.1|  Disease resistance protein RPM1                       65.5    5e-09   
ref|XP_011015046.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.1    5e-09   Populus euphratica
ref|NP_001117315.1|  Mannose-binding lectin superfamily protein       65.1    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004964114.1|  PREDICTED: mannose/glucose-specific lectin-like  61.6    5e-09   
ref|NP_849691.1|  Mannose-binding lectin superfamily protein          65.1    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004984089.1|  PREDICTED: protein GOS9-like                     62.0    5e-09   Setaria italica
ref|XP_010231088.1|  PREDICTED: jacalin-related lectin 19-like is...  63.5    5e-09   Brachypodium distachyon [annual false brome]
ref|XP_011015045.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.1    5e-09   Populus euphratica
tpg|DAA60181.1|  TPA: hypothetical protein ZEAMMB73_326702            63.9    6e-09   
ref|XP_002893063.1|  jacalin lectin family protein                    64.7    6e-09   
ref|XP_009400545.1|  PREDICTED: agglutinin alpha chain                62.4    7e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004986922.1|  PREDICTED: horcolin-like                         61.2    7e-09   
ref|XP_003597652.1|  Agglutinin alpha chain                           64.7    7e-09   
ref|XP_003577374.2|  PREDICTED: mannose/glucose-specific lectin-l...  64.7    8e-09   
emb|CAE76026.1|  B1292H11.12                                          62.0    8e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004291831.1|  PREDICTED: jacalin-related lectin 3              64.7    8e-09   Fragaria vesca subsp. vesca
ref|XP_006473572.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    8e-09   Citrus sinensis [apfelsine]
ref|XP_010237569.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.7    8e-09   
ref|XP_010477196.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    9e-09   Camelina sativa [gold-of-pleasure]
ref|XP_002461768.1|  hypothetical protein SORBIDRAFT_02g007760        63.9    9e-09   
emb|CDY48032.1|  BnaA02g16250D                                        62.4    9e-09   Brassica napus [oilseed rape]
ref|XP_008244775.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  63.5    1e-08   
gb|KJB58185.1|  hypothetical protein B456_009G198200                  64.7    1e-08   Gossypium raimondii
gb|KJB58186.1|  hypothetical protein B456_009G198200                  64.7    1e-08   Gossypium raimondii
ref|XP_004979669.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.3    1e-08   
ref|XP_004979670.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.3    1e-08   Setaria italica
ref|XP_010498396.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_011074623.1|  PREDICTED: jacalin-related lectin 3              64.3    1e-08   Sesamum indicum [beniseed]
ref|XP_004979671.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.3    1e-08   
gb|EMS53468.1|  hypothetical protein TRIUR3_21407                     60.8    1e-08   Triticum urartu
ref|XP_002510454.1|  hypothetical protein RCOM_1595950                63.9    1e-08   
ref|XP_009608047.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  64.7    1e-08   
gb|KDO84683.1|  hypothetical protein CISIN_1g007083mg                 63.9    1e-08   Citrus sinensis [apfelsine]
gb|ABA94728.1|  Jacalin-like lectin domain containing protein         64.3    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006838705.1|  hypothetical protein AMTR_s00002p00249920        63.9    1e-08   Amborella trichopoda
ref|XP_009614721.1|  PREDICTED: jacalin-related lectin 19             62.0    1e-08   Nicotiana tomentosiformis
ref|XP_010477195.1|  PREDICTED: jacalin-related lectin 3-like iso...  63.9    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010477194.1|  PREDICTED: jacalin-related lectin 3-like iso...  63.9    1e-08   Camelina sativa [gold-of-pleasure]
gb|KDO84682.1|  hypothetical protein CISIN_1g007083mg                 63.9    1e-08   Citrus sinensis [apfelsine]
gb|ABA94732.1|  Jacalin-like lectin domain containing protein, ex...  63.9    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006473571.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    1e-08   Citrus sinensis [apfelsine]
ref|XP_006435072.1|  hypothetical protein CICLE_v10000604mg           63.9    1e-08   Citrus clementina [clementine]
gb|EMS51533.1|  hypothetical protein TRIUR3_05238                     62.8    1e-08   Triticum urartu
ref|XP_009602425.1|  PREDICTED: mannose/glucose-specific lectin-like  60.1    1e-08   
ref|XP_010459648.1|  PREDICTED: jacalin-related lectin 3 isoform X1   63.5    1e-08   
gb|KDP38566.1|  hypothetical protein JCGZ_04491                       63.5    2e-08   Jatropha curcas
gb|EAZ25557.1|  hypothetical protein OsJ_09383                        60.1    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011001803.1|  PREDICTED: mannose/glucose-specific lectin-like  63.2    2e-08   Populus euphratica
ref|XP_008651439.1|  PREDICTED: jasmonate-induced protein isoform X1  62.4    2e-08   
gb|ACN33395.1|  unknown                                               62.8    2e-08   Zea mays [maize]
gb|EMT23136.1|  hypothetical protein F775_18655                       59.7    2e-08   
emb|CDX82115.1|  BnaC02g21750D                                        61.6    2e-08   
ref|XP_002510452.1|  pentatricopeptide repeat-containing protein,...  63.5    2e-08   
ref|XP_007216928.1|  hypothetical protein PRUPE_ppa016643mg           62.8    2e-08   
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  63.5    2e-08   Nicotiana tomentosiformis
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  63.5    2e-08   Nicotiana tomentosiformis
ref|XP_006838698.1|  hypothetical protein AMTR_s00002p00248970        60.1    2e-08   
gb|AAM46813.1|  hessian fly response gene 1 protein                   62.4    2e-08   Triticum aestivum [Canadian hard winter wheat]
gb|AGT16237.1|  Jacalin-like lectin domain containing protein         62.8    3e-08   Saccharum hybrid cultivar R570
ref|NP_001141303.1|  uncharacterized protein LOC100273394             62.0    3e-08   
ref|XP_003615697.1|  Myrosinase-binding protein-like protein          62.8    3e-08   
ref|XP_006654724.1|  PREDICTED: agglutinin-like                       60.5    3e-08   
gb|ABJ97445.1|  beta-glucosidase aggregating factor 1                 62.0    3e-08   Zea mays [maize]
ref|NP_001104964.1|  beta-glucosidase aggregating factor precursor    62.0    3e-08   
ref|XP_002467725.1|  hypothetical protein SORBIDRAFT_01g033090        59.7    3e-08   
gb|EAY90359.1|  hypothetical protein OsI_11939                        59.7    3e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_008677993.1|  PREDICTED: mannose/glucose-specific lectin-l...  62.8    3e-08   
ref|XP_004980504.1|  PREDICTED: protein GOS9-like                     59.3    3e-08   
ref|XP_008677995.1|  PREDICTED: mannose/glucose-specific lectin-l...  62.8    3e-08   
gb|AGT16242.1|  Jacalin-like lectin domain containing protein         62.8    3e-08   Saccharum hybrid cultivar R570
ref|XP_010537548.1|  PREDICTED: LOW QUALITY PROTEIN: jacalin-rela...  60.1    3e-08   
gb|AAZ73661.1|  At1g19715                                             60.1    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ73664.1|  At1g19715                                             60.1    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306414.1|  hypothetical protein CARUB_v10012347mg           62.8    3e-08   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...  62.8    4e-08   Nicotiana tomentosiformis
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  62.8    4e-08   Nicotiana tomentosiformis
ref|XP_006416472.1|  hypothetical protein EUTSA_v10007145mg           62.4    4e-08   Eutrema salsugineum [saltwater cress]
ref|XP_006354454.1|  PREDICTED: probable disease resistance RPP8-...  61.6    4e-08   Solanum tuberosum [potatoes]
gb|AAZ73652.1|  At1g19715                                             59.7    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782510.1|  PREDICTED: jacalin-related lectin 19             60.1    4e-08   Nicotiana sylvestris
ref|XP_010533565.1|  PREDICTED: jacalin-related lectin 3 isoform X1   62.4    4e-08   Tarenaya hassleriana [spider flower]
ref|XP_010533571.1|  PREDICTED: jacalin-related lectin 3 isoform X2   62.0    4e-08   Tarenaya hassleriana [spider flower]
gb|KJB63589.1|  hypothetical protein B456_010G007400                  62.0    5e-08   Gossypium raimondii
ref|XP_008783084.1|  PREDICTED: inactive protein RESTRICTED TEV M...  60.1    5e-08   Phoenix dactylifera
ref|XP_008391447.1|  PREDICTED: uncharacterized protein LOC103453663  61.6    5e-08   
ref|XP_004974871.1|  PREDICTED: mannose/glucose-specific lectin-like  60.5    5e-08   
gb|AAB72098.1|  32 kDa protein                                        61.2    5e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW67999.1|  hypothetical protein EUGRSUZ_F01690                   62.4    5e-08   Eucalyptus grandis [rose gum]
ref|NP_001068257.2|  Os11g0607900                                     58.2    6e-08   
gb|KCW67998.1|  hypothetical protein EUGRSUZ_F01690                   62.0    6e-08   Eucalyptus grandis [rose gum]
gb|KHG26998.1|  Agglutinin                                            61.6    6e-08   Gossypium arboreum [tree cotton]
ref|XP_009149456.1|  PREDICTED: agglutinin                            61.6    6e-08   
emb|CDY39357.1|  BnaC05g15300D                                        61.6    6e-08   Brassica napus [oilseed rape]
gb|AAZ73669.1|  At1g19715-like protein                                59.3    7e-08   Arabidopsis lyrata [lyrate rockcress]
gb|AAK55472.1|AC084295_5  putative salt-induced protein               59.3    7e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KHN30030.1|  Agglutinin alpha chain                                59.3    7e-08   Glycine soja [wild soybean]
ref|XP_006662244.1|  PREDICTED: uncharacterized protein LOC102708001  61.2    7e-08   
ref|XP_006595102.1|  PREDICTED: agglutinin                            59.3    7e-08   Glycine max [soybeans]
ref|XP_006362247.1|  PREDICTED: myrosinase-binding protein-like A...  61.6    7e-08   Solanum tuberosum [potatoes]
ref|XP_010236764.1|  PREDICTED: jacalin-related lectin 19-like        58.9    8e-08   
ref|XP_004977415.1|  PREDICTED: uncharacterized protein LOC101784...  60.8    8e-08   Setaria italica
ref|XP_006651478.1|  PREDICTED: horcolin-like                         58.9    8e-08   
gb|EMT33622.1|  Cysteine proteinase RD21a                             61.6    8e-08   
gb|ABF96452.1|  Jacalin-like lectin domain containing protein, ex...  58.9    8e-08   
ref|XP_006362248.1|  PREDICTED: myrosinase-binding protein-like A...  61.6    8e-08   
ref|XP_002449838.1|  hypothetical protein SORBIDRAFT_05g024220        60.5    8e-08   
gb|EEE60415.1|  hypothetical protein OsJ_13609                        57.8    8e-08   
ref|XP_008388156.1|  PREDICTED: uncharacterized protein LOC103450568  61.2    9e-08   
ref|XP_010064569.1|  PREDICTED: jacalin-related lectin 4-like         61.6    9e-08   
gb|EMT07446.1|  hypothetical protein F775_10439                       60.5    9e-08   
ref|XP_010109960.1|  hypothetical protein L484_009242                 59.3    9e-08   
dbj|BAJ88436.1|  predicted protein                                    61.2    1e-07   
ref|NP_001176790.1|  Os12g0144100                                     57.0    1e-07   
ref|XP_009760249.1|  PREDICTED: agglutinin-like                       60.5    1e-07   
ref|XP_007017646.1|  Mannose-binding lectin superfamily protein, ...  61.2    1e-07   
emb|CAE76030.1|  B1292H11.16                                          58.2    1e-07   
ref|XP_007017648.1|  Mannose-binding lectin superfamily protein, ...  61.2    1e-07   
dbj|BAJ85606.1|  predicted protein                                    61.2    1e-07   
ref|XP_008221341.1|  PREDICTED: uncharacterized protein LOC103321320  61.2    1e-07   
ref|NP_001050311.2|  Os03g0399800                                     58.9    1e-07   
ref|XP_006597184.1|  PREDICTED: agglutinin-like isoform X4            58.5    1e-07   
ref|XP_009407881.1|  PREDICTED: inactive protein RESTRICTED TEV M...  58.5    1e-07   
gb|AAL10685.1|  mannose-binding lectin                                58.2    1e-07   
gb|EMT07336.1|  hypothetical protein F775_29709                       60.5    1e-07   
gb|KHN32674.1|  Agglutinin alpha chain                                58.5    1e-07   
gb|AFW74848.1|  hypothetical protein ZEAMMB73_609032                  57.8    1e-07   
ref|XP_004170416.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  60.5    1e-07   
ref|XP_004249154.1|  PREDICTED: jacalin-related lectin 3 isoform X2   60.8    1e-07   
tpg|DAA39774.1|  TPA: hypothetical protein ZEAMMB73_034611            57.8    1e-07   
ref|XP_010674585.1|  PREDICTED: uncharacterized protein LOC104890703  61.2    1e-07   
ref|XP_002467724.1|  hypothetical protein SORBIDRAFT_01g033080        57.8    1e-07   
emb|CDM80828.1|  unnamed protein product                              57.8    1e-07   
gb|KHN46147.1|  Agglutinin                                            60.5    1e-07   
ref|XP_010312054.1|  PREDICTED: jacalin-related lectin 3 isoform X1   60.5    2e-07   
ref|XP_006662272.1|  PREDICTED: uncharacterized protein LOC102701759  59.7    2e-07   
gb|ABC70328.1|  agglutinin isoform                                    59.7    2e-07   
sp|P82859.1|LECA_CASCR  RecName: Full=Agglutinin; AltName: Full=CCA   59.7    2e-07   
ref|XP_009599288.1|  PREDICTED: jacalin-related lectin 3 isoform X1   60.5    2e-07   
ref|XP_008377187.1|  PREDICTED: uncharacterized protein LOC103440289  60.5    2e-07   
ref|XP_011028924.1|  PREDICTED: uncharacterized protein LOC105128...  60.5    2e-07   
ref|XP_008671662.1|  PREDICTED: horcolin-like                         58.2    2e-07   
ref|XP_008656997.1|  PREDICTED: cysteine-rich receptor-like prote...  60.1    2e-07   
ref|XP_009599289.1|  PREDICTED: jacalin-related lectin 3 isoform X2   60.1    2e-07   
ref|XP_006597181.1|  PREDICTED: agglutinin-like isoform X1            60.1    2e-07   
gb|ABA94721.1|  Jacalin-like lectin domain containing protein         60.5    2e-07   
gb|KFK44089.1|  hypothetical protein AALP_AA1G214700                  60.1    2e-07   
ref|NP_001055995.1|  Os05g0508400                                     60.1    2e-07   
ref|XP_006654618.1|  PREDICTED: myrosinase-binding protein-like A...  60.1    2e-07   
gb|AFW84361.1|  putative protein kinase superfamily protein           60.1    2e-07   
ref|XP_008778289.1|  PREDICTED: mannose/glucose-specific lectin-like  59.3    2e-07   
ref|XP_004490606.1|  PREDICTED: mannose/glucose-specific lectin-l...  60.1    2e-07   
gb|EAY98637.1|  hypothetical protein OsI_20561                        60.1    2e-07   
gb|EEE64302.1|  hypothetical protein OsJ_19139                        60.1    2e-07   
ref|XP_010227994.1|  PREDICTED: jacalin-related lectin 3-like         59.3    3e-07   
ref|XP_010092355.1|  hypothetical protein L484_023733                 57.8    3e-07   
ref|XP_010233169.1|  PREDICTED: jacalin-related lectin 3-like         60.1    3e-07   
ref|XP_010932970.1|  PREDICTED: mannose/glucose-specific lectin-l...  57.8    3e-07   
ref|XP_004490607.1|  PREDICTED: mannose/glucose-specific lectin-l...  59.7    3e-07   
ref|XP_003561042.1|  PREDICTED: jacalin-related lectin 3-like         59.3    3e-07   
emb|CDM86052.1|  unnamed protein product                              59.3    3e-07   
ref|XP_010664949.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    3e-07   
ref|XP_009384641.1|  PREDICTED: agglutinin alpha chain-like isofo...  57.8    3e-07   
ref|XP_009771019.1|  PREDICTED: jacalin-related lectin 3 isoform X1   59.7    3e-07   
gb|ABA96465.1|  Protein GOS9, putative                                56.2    3e-07   
ref|XP_007222058.1|  hypothetical protein PRUPE_ppa003185mg           59.7    3e-07   
ref|XP_009384722.1|  PREDICTED: agglutinin alpha chain-like isofo...  57.4    3e-07   
ref|XP_009771020.1|  PREDICTED: jacalin-related lectin 3 isoform X2   59.7    3e-07   
sp|Q5U9T2.1|LECH_HORVU  RecName: Full=Horcolin; AltName: Full=Agg...  56.6    4e-07   
ref|XP_010910707.1|  PREDICTED: jacalin-related lectin 3-like         57.0    4e-07   
ref|XP_009614655.1|  PREDICTED: mannose/glucose-specific lectin-like  56.6    4e-07   
gb|EEE52450.1|  hypothetical protein OsJ_34606                        58.9    4e-07   
emb|CDM86063.1|  unnamed protein product                              59.3    4e-07   
gb|EEE59214.1|  hypothetical protein OsJ_11170                        58.9    4e-07   
ref|NP_001056189.1|  Os05g0541800                                     56.2    4e-07   
ref|XP_010935305.1|  PREDICTED: jacalin-related lectin 3-like         58.9    4e-07   
gb|EAY92859.1|  hypothetical protein OsI_14658                        57.8    5e-07   
ref|XP_002439535.1|  hypothetical protein SORBIDRAFT_09g010668        56.2    5e-07   
ref|XP_008804539.1|  PREDICTED: mannose/glucose-specific lectin-like  56.2    5e-07   
ref|XP_008466548.1|  PREDICTED: agglutinin-like                       58.9    5e-07   
gb|AFW74847.1|  hypothetical protein ZEAMMB73_609032                  57.8    5e-07   
gb|EMT07556.1|  hypothetical protein F775_11805                       55.8    5e-07   
ref|NP_001183767.1|  hypothetical protein                             56.6    5e-07   
gb|AFW74846.1|  hypothetical protein ZEAMMB73_609032                  57.4    5e-07   
ref|XP_008782838.1|  PREDICTED: agglutinin alpha chain-like           57.0    5e-07   
emb|CDM80401.1|  unnamed protein product                              57.8    6e-07   
ref|XP_002300741.2|  hypothetical protein POPTR_0002s03180g           58.9    6e-07   
ref|XP_004979687.1|  PREDICTED: myrosinase-binding protein-like A...  58.2    6e-07   
ref|XP_008782839.1|  PREDICTED: agglutinin alpha chain-like           56.6    6e-07   
ref|XP_004979688.1|  PREDICTED: mannose/glucose-specific lectin-like  58.2    7e-07   
dbj|BAM00996.1|  hypothetical protein CLDAP_29560                     57.8    7e-07   
gb|AHW81907.1|  mannose-binding lectin                                56.2    7e-07   
gb|EMT07620.1|  hypothetical protein F775_29169                       57.8    8e-07   
ref|XP_010239309.1|  PREDICTED: LOW QUALITY PROTEIN: protein GOS9...  57.4    9e-07   
emb|CDM86053.1|  unnamed protein product                              57.8    1e-06   
emb|CDM83580.1|  unnamed protein product                              57.8    1e-06   
ref|XP_003573652.1|  PREDICTED: horcolin-like                         54.7    1e-06   
ref|XP_004164005.1|  PREDICTED: agglutinin-like                       55.5    1e-06   
ref|XP_009413935.1|  PREDICTED: protein GOS9-like                     55.5    1e-06   
ref|XP_010932865.1|  PREDICTED: jacalin-related lectin 3-like iso...  56.6    1e-06   
ref|XP_003573736.1|  PREDICTED: jacalin-related lectin 9-like         57.4    1e-06   
ref|XP_010110012.1|  hypothetical protein L484_021901                 57.8    1e-06   
ref|XP_007142198.1|  hypothetical protein PHAVU_008G260500g           57.8    1e-06   
ref|XP_007142199.1|  hypothetical protein PHAVU_008G260500g           57.8    1e-06   
ref|XP_010110011.1|  hypothetical protein L484_021900                 57.8    1e-06   
ref|XP_002281330.1|  PREDICTED: jacalin-related lectin 19-like        55.5    1e-06   
gb|KDP38565.1|  hypothetical protein JCGZ_04490                       57.4    1e-06   
ref|XP_009336846.1|  PREDICTED: uncharacterized protein LOC103929382  57.4    1e-06   
gb|ACR38528.1|  unknown                                               56.2    2e-06   
ref|XP_010932961.1|  PREDICTED: mannose/glucose-specific lectin-l...  57.0    2e-06   
ref|XP_011028923.1|  PREDICTED: jacalin-related lectin 3-like iso...  57.4    2e-06   
ref|XP_010932856.1|  PREDICTED: mannose/glucose-specific lectin-l...  56.6    2e-06   
ref|XP_008677750.1|  PREDICTED: hypothetical protein isoform X2       56.6    2e-06   
ref|XP_009413293.1|  PREDICTED: protein GOS9-like                     54.7    2e-06   
gb|AFW74852.1|  hypothetical protein ZEAMMB73_609032                  57.0    2e-06   
gb|EAY82243.1|  hypothetical protein OsI_37448                        57.0    2e-06   
emb|CDY63700.1|  BnaC08g19180D                                        57.4    2e-06   
ref|XP_008677749.1|  PREDICTED: hypothetical protein isoform X1       56.6    2e-06   
gb|EYU34206.1|  hypothetical protein MIMGU_mgv1a025615mg              57.0    2e-06   
emb|CBI35989.3|  unnamed protein product                              55.8    2e-06   
ref|XP_008466547.1|  PREDICTED: uncharacterized protein LOC103503932  57.4    2e-06   
gb|EMS65495.1|  hypothetical protein TRIUR3_18396                     57.0    2e-06   
gb|EEE68468.1|  hypothetical protein OsJ_26865                        57.0    2e-06   
ref|XP_009110261.1|  PREDICTED: agglutinin-like                       57.0    2e-06   
emb|CBI19765.3|  unnamed protein product                              57.0    2e-06   
emb|CDX96652.1|  BnaA08g21950D                                        57.0    2e-06   
ref|XP_010026053.1|  PREDICTED: jacalin-related lectin 3-like         56.2    2e-06   
ref|XP_008648490.1|  PREDICTED: salt stress-induced protein-like      54.3    2e-06   
ref|XP_003578759.1|  PREDICTED: mannose/glucose-specific lectin-like  56.6    2e-06   
gb|AFW74546.1|  hypothetical protein ZEAMMB73_667809                  54.3    2e-06   
pdb|1XXQ|A  Chain A, Structure Of A Mannose-Specific Jacalin-Rela...  54.7    2e-06   
ref|XP_006372328.1|  hypothetical protein POPTR_0017s00620g           54.3    2e-06   
gb|ACF78865.1|  unknown                                               56.2    2e-06   
dbj|BAE95375.1|  lectin                                               56.2    3e-06   
ref|XP_010100192.1|  hypothetical protein L484_015337                 54.3    3e-06   
gb|EEC71570.1|  hypothetical protein OsI_03937                        57.0    3e-06   
gb|EMS46735.1|  hypothetical protein TRIUR3_02016                     56.2    3e-06   
gb|EEE55471.1|  hypothetical protein OsJ_03649                        57.0    3e-06   
gb|EMS51477.1|  Mannose/glucose-specific lectin                       56.2    3e-06   
ref|XP_004960702.1|  PREDICTED: mannose/glucose-specific lectin-like  56.2    3e-06   
ref|XP_010092351.1|  hypothetical protein L484_023729                 55.1    3e-06   
gb|EEC79620.1|  hypothetical protein OsI_20824                        55.1    3e-06   
ref|XP_003578760.1|  PREDICTED: mannose/glucose-specific lectin-like  56.2    3e-06   
emb|CDP07465.1|  unnamed protein product                              56.6    3e-06   
ref|XP_010932117.1|  PREDICTED: jacalin-related lectin 3-like iso...  53.9    4e-06   
ref|XP_003575754.1|  PREDICTED: uncharacterized protein LOC100829827  55.8    4e-06   
gb|EMT31922.1|  hypothetical protein F775_02779                       54.7    4e-06   
ref|XP_007146775.1|  hypothetical protein PHAVU_006G068800g           56.2    4e-06   
ref|NP_001142347.1|  uncharacterized protein LOC100274518             55.8    4e-06   
ref|XP_004147878.1|  PREDICTED: uncharacterized protein LOC101206314  56.2    4e-06   
ref|XP_006342218.1|  PREDICTED: agglutinin-like                       55.8    4e-06   
ref|XP_010932990.1|  PREDICTED: mannose/glucose-specific lectin-like  55.5    4e-06   
sp|P18674.2|LECA_MACPO  RecName: Full=Agglutinin alpha chain; Alt...  53.5    4e-06   
ref|XP_003576339.1|  PREDICTED: jacalin-related lectin 3-like         55.5    5e-06   
ref|XP_010932115.1|  PREDICTED: jacalin-related lectin 3-like iso...  54.3    5e-06   
ref|XP_010029921.1|  PREDICTED: jacalin-related lectin 4-like iso...  56.2    5e-06   
ref|XP_010029920.1|  PREDICTED: myrosinase-binding protein 2-like...  56.2    5e-06   
ref|XP_010029918.1|  PREDICTED: jacalin-related lectin 4-like iso...  55.8    5e-06   
ref|XP_010935315.1|  PREDICTED: uncharacterized protein LOC105055242  55.8    6e-06   
ref|XP_006383725.1|  hypothetical protein POPTR_0005s25400g           55.8    6e-06   
ref|XP_002440568.1|  hypothetical protein SORBIDRAFT_09g003330        52.8    6e-06   
ref|XP_010091770.1|  hypothetical protein L484_000767                 53.5    6e-06   
gb|ABS86033.1|  mannose-specific recombinant lectin                   53.1    6e-06   
gb|EAY96520.1|  hypothetical protein OsI_18424                        53.1    6e-06   
ref|XP_004500273.1|  PREDICTED: agglutinin-like                       55.5    7e-06   
gb|EMT16343.1|  Cysteine-rich receptor-like protein kinase 41         55.5    7e-06   
ref|XP_011048836.1|  PREDICTED: jacalin-related lectin 3-like iso...  55.5    7e-06   
ref|XP_011048835.1|  PREDICTED: jacalin-related lectin 3-like iso...  55.5    8e-06   
ref|XP_008466552.1|  PREDICTED: agglutinin-like                       53.1    8e-06   
ref|XP_010928799.1|  PREDICTED: jacalin-related lectin 19-like        53.5    8e-06   
ref|NP_001054618.1|  Os05g0143600                                     53.1    8e-06   
pdb|1TOQ|A  Chain A, Crystal Structure Of A Galactose Specific Le...  52.8    8e-06   
gb|EMT33809.1|  hypothetical protein F775_16156                       53.5    9e-06   
gb|AAB22274.1|  jacalin heavy chain, agglutinin heavy chain=Thoms...  52.8    9e-06   
ref|XP_010030255.1|  PREDICTED: agglutinin-like                       55.1    9e-06   
ref|XP_004147859.1|  PREDICTED: myrosinase-binding protein-like A...  55.1    9e-06   
ref|XP_003567168.1|  PREDICTED: jacalin-related lectin 3-like         55.1    9e-06   
ref|XP_011048833.1|  PREDICTED: jacalin-related lectin 3-like iso...  55.1    1e-05   
gb|KCW56858.1|  hypothetical protein EUGRSUZ_I02520                   55.5    1e-05   
ref|XP_006383724.1|  hypothetical protein POPTR_0005s25390g           55.1    1e-05   
ref|XP_010029904.1|  PREDICTED: jacalin-related lectin 4-like         55.1    1e-05   
ref|XP_010320536.1|  PREDICTED: mannose/glucose-specific lectin-like  53.1    1e-05   
ref|XP_008804538.1|  PREDICTED: uncharacterized protein LOC103717797  55.1    1e-05   
ref|XP_004154909.1|  PREDICTED: uncharacterized protein LOC101231870  54.7    1e-05   
gb|AAQ07258.1|  jacalin-like lectin                                   52.8    1e-05   
ref|XP_011048832.1|  PREDICTED: jacalin-related lectin 3-like iso...  55.1    1e-05   
ref|XP_004970153.1|  PREDICTED: myrosinase-binding protein-like A...  55.1    1e-05   
ref|XP_002440040.1|  hypothetical protein SORBIDRAFT_09g024950        54.7    1e-05   
gb|KDP26963.1|  hypothetical protein JCGZ_22259                       54.3    1e-05   
pdb|1J4S|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  52.4    1e-05   
ref|XP_006644795.1|  PREDICTED: mannose/glucose-specific lectin-like  54.7    1e-05   
ref|XP_009417114.1|  PREDICTED: horcolin {ECO:0000312|EMBL:AAV395...  52.4    1e-05   
pdb|1J4T|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  52.4    1e-05   
ref|NP_001140746.1|  hypothetical protein                             54.7    1e-05   
ref|XP_008657187.1|  PREDICTED: agglutinin-like                       54.3    1e-05   
pdb|1VBP|A  Chain A, Crystal Structure Of Artocarpin-Mannopentose...  52.4    1e-05   
pdb|1VBO|A  Chain A, Crystal Structure Of Artocarpin-Mannotriose ...  52.4    1e-05   
gb|EMS47771.1|  hypothetical protein TRIUR3_34363                     52.0    1e-05   
dbj|BAO09554.1|  mannose-binding lectin a                             53.5    1e-05   
ref|XP_002461767.1|  hypothetical protein SORBIDRAFT_02g007750        54.3    1e-05   
ref|XP_004980207.1|  PREDICTED: mannose/glucose-specific lectin-like  50.8    1e-05   
ref|XP_009391798.1|  PREDICTED: agglutinin-like                       52.8    1e-05   
ref|XP_004979016.1|  PREDICTED: salt stress-induced protein-like      52.8    1e-05   
gb|EYU36743.1|  hypothetical protein MIMGU_mgv1a007927mg              54.3    1e-05   
dbj|BAO09555.1|  mannose-binding lectin b                             52.4    1e-05   
ref|XP_002883010.1|  jacalin lectin family protein                    54.7    2e-05   
gb|ABI24164.1|  beta-glucosidase aggregating factor                   53.9    2e-05   
dbj|BAG24500.1|  jacalin-related lectin                               53.9    2e-05   
ref|XP_010029744.1|  PREDICTED: jacalin-related lectin 4-like         54.7    2e-05   
gb|AAL09163.1|  galactose-binding lectin                              53.1    2e-05   
pdb|3P8S|A  Chain A, Crystal Structure Of Single Chain Recombinan...  52.0    2e-05   
ref|XP_004961574.1|  PREDICTED: mannose/glucose-specific lectin-like  54.3    2e-05   
pdb|4AKD|A  Chain A, High Resolution Structure Of Mannose Binding...  52.0    2e-05   
ref|XP_010932114.1|  PREDICTED: inactive protein RESTRICTED TEV M...  52.4    2e-05   
gb|AAA32679.1|  jacalin                                               52.8    2e-05   
ref|XP_004960761.1|  PREDICTED: mannose/glucose-specific lectin-like  53.9    3e-05   
ref|XP_010099935.1|  hypothetical protein L484_020123                 52.8    3e-05   
gb|EMT09327.1|  hypothetical protein F775_29083                       53.5    3e-05   
ref|XP_008653193.1|  PREDICTED: agglutinin-like                       53.1    3e-05   
gb|AAY35064.1|  lectin KM+                                            51.6    3e-05   
ref|XP_006602089.1|  PREDICTED: agglutinin-like                       53.5    3e-05   
pdb|1X1V|A  Chain A, Structure Of Banana Lectin- Methyl-Alpha-Man...  51.2    3e-05   
ref|XP_004960760.1|  PREDICTED: mannose/glucose-specific lectin-like  53.5    3e-05   
gb|AFW74842.1|  hypothetical protein ZEAMMB73_660308                  52.0    3e-05   
gb|EMT19890.1|  hypothetical protein F775_11960                       53.1    3e-05   



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 111/157 (71%), Gaps = 7/157 (4%)
 Frame = +2

Query  74   MAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEti  253
            M VPID +SGP GN+GG+FWSFRP NKINQIVI      N  PI +TFS    D SK+TI
Sbjct  1    MTVPIDTISGPWGNNGGNFWSFRPINKINQIVITYSAGNN--PIALTFSATKADGSKDTI  58

Query  254  tvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPY  433
            TVGG G D++       I    ADEY+T I GTFG ++D++  VLRSIKF TN++ +GPY
Sbjct  59   TVGGAGPDSITGTDTVDIG---ADEYVTGISGTFGIYLDNN--VLRSIKFITNLKAYGPY  113

Query  434  GPNVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIYSA  544
            GPNVG+PF  +   G +IVGF+GR+G+YVDAIG Y+ 
Sbjct  114  GPNVGTPFSSENVVGNEIVGFLGRSGYYVDAIGTYNT  150



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = +2

Query  74   MAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEti  253
            MAVP+D +SGP GN+GG+FWSFRP NKINQIVI  GG GNN PI +TFS    D SK+TI
Sbjct  1    MAVPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGGGGNN-PIALTFSSTKADGSKDTI  59

Query  254  tvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPY  433
            TVGGGG D++       I     DEYLT I GTFG ++D++  VLRSI FTTN++  GPY
Sbjct  60   TVGGGGPDSITGTEMVNIG---TDEYLTGISGTFGIYLDNN--VLRSITFTTNLKAHGPY  114

Query  434  GPNVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIYS  541
            G  VG+PF      G +IVGF+GR+G+YVDAIG Y+
Sbjct  115  GQKVGTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  150



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 110/154 (71%), Gaps = 6/154 (4%)
 Frame = +2

Query  80   VPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitv  259
            VP+D +SGP GN+GG+FWSFRP NKINQIVI  GG GNN PI +TFS    D SK+TITV
Sbjct  2    VPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGGGGNN-PIALTFSSTKADGSKDTITV  60

Query  260  ggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP  439
            GGGG D++       I     DEYLT I GTFG ++D++  VLRSI FTTN++  GPYG 
Sbjct  61   GGGGPDSITGTEMVNIG---TDEYLTGISGTFGIYLDNN--VLRSITFTTNLKAHGPYGQ  115

Query  440  NVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIYS  541
             VG+PF      G +IVGF+GR+G+YVDAIG Y+
Sbjct  116  KVGTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  149



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 88/157 (56%), Gaps = 13/157 (8%)
 Frame = +2

Query  74   MAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggs--gnnnPIGITFSCINEDDSKE  247
            +A   DA SGP+G++GG FWSFRP   +N+IV+   GS     N I ITFS    D    
Sbjct  5    LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTD----  60

Query  248  titvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFG  427
                       +     T     + D  + EI G    +    Y+V+RSIKFTTN +E+G
Sbjct  61   -----IITVGGVGPEPLTYTETVNIDGDIIEISGMIANY--KGYNVIRSIKFTTNKKEYG  113

Query  428  PYGPNVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
            PYG N G+PF+ + PDG KIVGF G +G+YVDAIG Y
Sbjct  114  PYGANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  150



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 88/157 (56%), Gaps = 13/157 (8%)
 Frame = +2

Query  74   MAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggs--gnnnPIGITFSCINEDDSKE  247
            +A   DA SGP+G++GG FWSFRP   +N+IV+   GS     N I ITFS    D    
Sbjct  11   LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTD----  66

Query  248  titvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFG  427
                       +     T     + D  + EI G    +    Y+V+RSIKFTTN +E+G
Sbjct  67   -----IITVGGVGPEPLTYTETVNIDGDIIEISGMIANY--KGYNVIRSIKFTTNKKEYG  119

Query  428  PYGPNVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
            PYG N G+PF+ + PDG KIVGF G +G+YVDAIG Y
Sbjct  120  PYGANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  156



>gb|AAA87042.1| putative 32.7 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72097.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            A E++ E+ GTFG +  D ++++ S+KF TNV+ +GP+G   G+PF   A     IVGF 
Sbjct  228  ASEFMKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIPAQKNSSIVGFF  287

Query  500  GRAGFYVDAIGIY  538
            GR+G Y+DA+G+Y
Sbjct  288  GRSGIYLDALGVY  300



>gb|ABA93998.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=1384

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E+L E+ GTFG F   +  ++ S+ F TN + +GPYG   G+PFH        IVGF GR
Sbjct  1041  EFLVEVSGTFGRF-RAALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGFFGR  1099

Query  506   AGFYVDAIGIY  538
             AG+YVDAIGIY
Sbjct  1100  AGWYVDAIGIY  1110


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT + GTFG + + SY V+ SI   TN+  +GP+G   G  F+F       IVGF G 
Sbjct  1150  ELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFFGH  1208

Query  506   AGFYVDAIGIY  538
             A  Y+DAIG+Y
Sbjct  1209  AELYIDAIGVY  1219



>gb|EEE52195.1| hypothetical protein OsJ_34074 [Oryza sativa Japonica Group]
Length=1311

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E+L E+ GTFG F   +  ++ S+ F TN + +GPYG   G+PFH        IVGF GR
Sbjct  973   EFLVEVSGTFGRF-RAALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGFFGR  1031

Query  506   AGFYVDAIGIY  538
             AG+YVDAIGIY
Sbjct  1032  AGWYVDAIGIY  1042


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT + GTFG + + SY V+ SI   TN+  +GP+G   G  F+F       IVGF G 
Sbjct  1082  ELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFFGH  1140

Query  506   AGFYVDAIGIY  538
             A  Y+DAIG+Y
Sbjct  1141  AELYIDAIGVY  1151


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNV-REFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E++T++ GTFGPF +    V+ S+ F  N   ++GP+G   G+PFH        IVGF G
Sbjct  1237  EFITKVHGTFGPFGEFPI-VITSLTFINNAGHQYGPFGQGGGTPFHAPISGNGSIVGFFG  1295

Query  503   RAGFYVDAIGIY  538
               G  ++AIG Y
Sbjct  1296  HQGACLEAIGFY  1307



>ref|XP_009772163.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009772164.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
Length=1547

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 54/147 (37%), Positives = 77/147 (52%), Gaps = 11/147 (7%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G + G  W+++  + I +I+I  G   +     I F  I E    +  T        
Sbjct  174  GPWGGTSGSEWNYKLKHPIKEILIAHGYFID----SIMFRTITE----QGTTTDSQKFGG  225

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  457
               R + V+I     EYLT I GTFG + D  + V++S+ F TN   +GP+G N G +PF
Sbjct  226  NGGRINKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGTPF  283

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 +G  IVGF GR+GFY+DAIG+Y
Sbjct  284  SLVMKEGVAIVGFHGRSGFYLDAIGVY  310


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E LT I GT G F  + + V++S+ FTTNV+ +GP+G   G +PF     +G  I+GF G
Sbjct  35   ERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSEGGGTPFSHVMKEGGAIMGFHG  92

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  93   RCGEYLDAIGVY  104



>ref|XP_009772162.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X2 [Nicotiana sylvestris]
Length=1598

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 54/147 (37%), Positives = 77/147 (52%), Gaps = 11/147 (7%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G + G  W+++  + I +I+I  G   +     I F  I E    +  T        
Sbjct  226  GPWGGTSGSEWNYKLKHPIKEILIAHGYFID----SIMFRTITE----QGTTTDSQKFGG  277

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  457
               R + V+I     EYLT I GTFG + D  + V++S+ F TN   +GP+G N G +PF
Sbjct  278  NGGRINKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGTPF  335

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 +G  IVGF GR+GFY+DAIG+Y
Sbjct  336  SLVMKEGVAIVGFHGRSGFYLDAIGVY  362


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 53/148 (36%), Positives = 80/148 (54%), Gaps = 12/148 (8%)
 Frame = +2

Query  101  GPLGN-SGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtd  277
            GP G+ SGG  W+++  N I +I+I  G + N     I F  I E    +  T+      
Sbjct  19   GPWGDTSGGSEWNYKLKNPIKEILIAHGDAIN----SIMFRTITE----QGTTINSQKFG  70

Query  278  tlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SP  454
                + + V+ ++   E LT I GT G F  + + V++S+ FTTNV+ +GP+G   G +P
Sbjct  71   GNGGQINKVVFEETPLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSEGGGTP  128

Query  455  FHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
            F     +G  I+GF GR G Y+DAIG+Y
Sbjct  129  FSHVMKEGGAIMGFHGRCGEYLDAIGVY  156



>ref|XP_009772161.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X1 [Nicotiana sylvestris]
Length=1599

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 54/147 (37%), Positives = 77/147 (52%), Gaps = 11/147 (7%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G + G  W+++  + I +I+I  G   +     I F  I E    +  T        
Sbjct  226  GPWGGTSGSEWNYKLKHPIKEILIAHGYFID----SIMFRTITE----QGTTTDSQKFGG  277

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  457
               R + V+I     EYLT I GTFG + D  + V++S+ F TN   +GP+G N G +PF
Sbjct  278  NGGRINKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGTPF  335

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 +G  IVGF GR+GFY+DAIG+Y
Sbjct  336  SLVMKEGVAIVGFHGRSGFYLDAIGVY  362


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 53/148 (36%), Positives = 80/148 (54%), Gaps = 12/148 (8%)
 Frame = +2

Query  101  GPLGN-SGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtd  277
            GP G+ SGG  W+++  N I +I+I  G + N     I F  I E    +  T+      
Sbjct  19   GPWGDTSGGSEWNYKLKNPIKEILIAHGDAIN----SIMFRTITE----QGTTINSQKFG  70

Query  278  tlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SP  454
                + + V+ ++   E LT I GT G F  + + V++S+ FTTNV+ +GP+G   G +P
Sbjct  71   GNGGQINKVVFEETPLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSEGGGTP  128

Query  455  FHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
            F     +G  I+GF GR G Y+DAIG+Y
Sbjct  129  FSHVMKEGGAIMGFHGRCGEYLDAIGVY  156



>ref|XP_010690084.1| PREDICTED: jacalin-related lectin 19 [Beta vulgaris subsp. vulgaris]
Length=189

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V     V+RS+ F +N R FGP+G   G+PF+F   +G +I+GF G
Sbjct  83   EEYLISVSGYYSPVVQGMTPVVRSLSFKSNRRSFGPFGVEEGTPFYFPV-EGGRIIGFKG  141

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            R+G+Y+D+IG Y + V + +++  +  W
Sbjct  142  RSGWYLDSIGFYVSRVHSKTITKRVQRW  169



>gb|EMS66150.1| hypothetical protein TRIUR3_12251 [Triticum urartu]
Length=307

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            A E++ E+ GT+G +  D ++++ S+KF TNV+ +GP+G   G+PF     +   IVGF 
Sbjct  231  ASEFVKEVSGTYGIYDADQHNIIMSLKFITNVKAYGPFGEANGTPFTIPVENNSSIVGFF  290

Query  500  GRAGFYVDAIGIY  538
            GR+G Y+DA+G+Y
Sbjct  291  GRSGIYLDALGVY  303



>gb|AAA87041.1| putative 32.6 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72096.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            A E++ E+ GTFG +  D ++++ S+KF TNV+ +GP+G   G+PF         IVGF 
Sbjct  228  ASEFVKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIAVQKNSSIVGFF  287

Query  500  GRAGFYVDAIGIY  538
             R+G Y+DA+G+Y
Sbjct  288  ARSGIYLDALGVY  300



>ref|NP_001066367.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|ABA96667.1| jasmonate-induced protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29386.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|EAY82558.1| hypothetical protein OsI_37779 [Oryza sativa Indica Group]
 gb|EAZ19941.1| hypothetical protein OsJ_35533 [Oryza sativa Japonica Group]
Length=307

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            + E+L E+ GTFGP+  + + V+RSIKF TN + +GP+G   G+PF     +   IVGF 
Sbjct  233  SSEFLKEVSGTFGPY--EGWKVIRSIKFVTNKKTYGPFGRQEGTPFSVPVQNNSTIVGFF  290

Query  500  GRAGFYVDAIGIY  538
            GR+G Y+D +GIY
Sbjct  291  GRSGKYLDTVGIY  303



>ref|XP_006853911.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
 gb|ERN15378.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
Length=126

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E++T + G + P V     V+RS+KF TN + +GPYG   G+PF F   DG  IVGF G
Sbjct  22   EEFITGVSGHYSPMVHSGTPVIRSLKFATNRKTYGPYGVEEGTPFSFPM-DGGHIVGFKG  80

Query  503  RAGFYVDAIGIYSA*VITSS  562
            R+G+Y+DAIG   + + +SS
Sbjct  81   RSGWYLDAIGFRLSRLHSSS  100



>ref|XP_006343016.1| PREDICTED: agglutinin-like [Solanum tuberosum]
Length=201

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYLT + G + P V     V+RS+ F++N R+FGP+G   G+PF     +G +IVGF G
Sbjct  81   EEYLTSVSGYYSPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPM-EGGQIVGFKG  139

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R+G+Y+DAIG Y A V T+++
Sbjct  140  RSGWYLDAIGFYIAKVKTTTV  160



>ref|XP_009398855.1| PREDICTED: protein GOS9-like [Musa acuminata subsp. malaccensis]
Length=143

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE L  I G +G F  D  S+LRS+ F +N R +GP+G   G  F  +AP G +IVGF G
Sbjct  73   DETLRSIRGHYGRF--DGVSILRSLTFVSNKRTYGPFGREEGVAFTLEAP-GSRIVGFTG  129

Query  503  RAGFYVDAIGIYSA  544
            R+G Y+DA+GIY A
Sbjct  130  RSGLYLDALGIYVA  143



>ref|XP_004235622.1| PREDICTED: jacalin-related lectin 19 [Solanum lycopersicum]
Length=201

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYLT + G + P V     V+RS+ F++N R+FGP+G   G+PF     +G +IVGF G
Sbjct  81   EEYLTSVSGYYCPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPM-EGGQIVGFKG  139

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R+G+YVDAIG Y A V T+ +
Sbjct  140  RSGWYVDAIGFYIAKVKTTRV  160



>dbj|BAK00987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LTE+ GT     D    V+ SI+F TN++ +GP+G   G+PF F  P  KK+VGF GR
Sbjct  233  EFLTEVSGTIS---DSRCEVVESIQFVTNIQTYGPFGTQDGTPFTFSVPRYKKVVGFFGR  289

Query  506  AGFYVDAIGIY  538
             G ++DAIGIY
Sbjct  290  GGLFLDAIGIY  300



>ref|XP_010230396.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
 ref|XP_010230397.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=246

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G +G F  D +SV+R++ F +N R  GPYG + G  F   A  G KIVGF G
Sbjct  173  DEYLTGVKGRYGQF--DGWSVIRALTFVSNRRTIGPYGTDEGMEFELPAAGGGKIVGFHG  230

Query  503  RAGFYVDAIGIY  538
            R+G  VDAIG Y
Sbjct  231  RSGGLVDAIGTY  242



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E+LT I GT G F  D YSV++S+ FTTNV+ +GP+G   G +PF     +G  IVGF G
Sbjct  83   EHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHG  140

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  141  RCGAYLDAIGVY  152


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 78/147 (53%), Gaps = 11/147 (7%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G +GG  W+++  + I +I+I  GG  +     I F  I E    +  T+       
Sbjct  222  GPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITE----QGTTIDSPKFGG  273

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  457
               R + V+I+    EYLT I GTFG +  + + V++S+ F TN   +GP+G + G +PF
Sbjct  274  NGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTPF  331

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 +G  IVGF G  G Y+DAIGIY
Sbjct  332  SLVMKEGVAIVGFHGLCGAYLDAIGIY  358



>gb|EEC68267.1| hypothetical protein OsI_36302 [Oryza sativa Indica Group]
Length=1396

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E+L E+ GTFG F   + +++ S+ F TN + +GPYG   G+PFH        IVGF GR
Sbjct  1013  EFLVEVSGTFGRF-RAALNIITSLTFVTNAQSYGPYGQREGTPFHIPVQSSGCIVGFFGR  1071

Query  506   AGFYVDAIGIY  538
             AG+YVDAIGIY
Sbjct  1072  AGWYVDAIGIY  1082


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT + GTFG + + SY V+ SI   TN+  +GP+G   G  F+F       IVGF G 
Sbjct  1168  ELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFFGH  1226

Query  506   AGFYVDAIGIY  538
             A  Y+DAIG+Y
Sbjct  1227  AELYIDAIGVY  1237


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNV-REFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E++T++ GTFGP+ +    V+ S+ F  N   ++GP+G   G+PFH        IVGF G
Sbjct  1322  EFITKVHGTFGPYGEFPI-VITSLTFINNAGHQYGPFGQGGGTPFHAPISGNGSIVGFFG  1380

Query  503   RAGFYVDAIGIY  538
               G  ++AIG Y
Sbjct  1381  HQGACLEAIGFY  1392



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E+LT I GT G F  D YSV++S+ FTTNV+ +GP+G   G +PF     +G  IVGF G
Sbjct  217  EHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHG  274

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  275  RCGAYLDAIGVY  286


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYLT I GTFG      YSV++S+ F TN + +GP+G   G+PF     +G  IVGF GR
Sbjct  35   EYLTCIKGTFG--YCGGYSVVKSLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  92

Query  506  AGFYVDAIGIYSA*VITSSLS  568
             G Y+DAIG+Y   +   +LS
Sbjct  93   CGAYLDAIGVYLQKLTPPTLS  113


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 78/147 (53%), Gaps = 11/147 (7%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G +GG  W+++  + I +I+I  GG  +     I F  I E    +  T+       
Sbjct  356  GPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITE----QGTTIDSPKFGG  407

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  457
               R + V+I+    EYLT I GTFG +  + + V++S+ F TN   +GP+G + G +PF
Sbjct  408  NGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTPF  465

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 +G  IVGF G  G Y+DAIGIY
Sbjct  466  SLVMKEGVAIVGFHGLCGAYLDAIGIY  492



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E+LT I GT G F  D YSV++S+ FTTNV+ +GP+G   G +PF     +G  IVGF G
Sbjct  287  EHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHG  344

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  345  RCGAYLDAIGVY  356


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYLT I GTFG      YSV++S+ F TN + +GP+G   G+PF     +G  IVGF GR
Sbjct  105  EYLTCIKGTFG--YCGGYSVVKSLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  162

Query  506  AGFYVDAIGIYSA*VITSSLS  568
             G Y+DAIG+Y   +   +LS
Sbjct  163  CGAYLDAIGVYLQKLTPPTLS  183


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 78/147 (53%), Gaps = 11/147 (7%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G +GG  W+++  + I +I+I  GG  +     I F  I E    +  T+       
Sbjct  426  GPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITE----QGTTIDSPKFGG  477

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  457
               R + V+I+    EYLT I GTFG +  + + V++S+ F TN   +GP+G + G +PF
Sbjct  478  NGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTPF  535

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 +G  IVGF G  G Y+DAIGIY
Sbjct  536  SLVMKEGVAIVGFHGLCGAYLDAIGIY  562



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E+LT I GT G F  D YSV++S+ FTTNV+ +GP+G   G +PF     +G  IVGF G
Sbjct  219  EHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHG  276

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  277  RCGAYLDAIGVY  288


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 78/147 (53%), Gaps = 11/147 (7%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G +GG  W+++  + I +I+I  GG  +     I F  I E    +  T+       
Sbjct  358  GPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITE----QGTTIDSPKFGG  409

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  457
               R + V+I+    EYLT I GTFG +  + + V++S+ F TN   +GP+G + G +PF
Sbjct  410  NGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTPF  467

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 +G  IVGF G  G Y+DAIGIY
Sbjct  468  SLVMKEGVAIVGFHGLCGAYLDAIGIY  494


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = +2

Query  326  EYLTEICGTF-GPFVDDSYSVLRSIKFTTNVREFGPYGP-NVGSPFHFQAPDGKKIVGFI  499
            EYLT I GTF G  +   + V+ S+ F TN + +GP+G  + G+PF F   +G  I GF 
Sbjct  35   EYLTGIKGTFRGCGI---HLVINSLCFITNAKNYGPFGSKDGGTPFSFAMKEGGAIEGFQ  91

Query  500  GRAGFYVDAIGIY  538
            GR G Y+DAIG+Y
Sbjct  92   GRCGAYLDAIGVY  104



>ref|XP_009589464.1| PREDICTED: agglutinin-like, partial [Nicotiana tomentosiformis]
Length=363

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 86/170 (51%), Gaps = 10/170 (6%)
 Frame = +2

Query  29   SSIPFALKLSSN*ETMAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIG  208
            S++P   ++  N  +       +  P G +GG  W ++  + I +I+I  G    +    
Sbjct  19   SALPILFQVKGNQVSYDQADSILVEPWGGTGGSEWYYKLKSPIKEILITHGDCIES----  74

Query  209  ITFSCINEDDSKEtitvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVL  388
            I F  + E  +    T+          R D V+I+  + EYLT I GTFG     SY V+
Sbjct  75   IMFRTVTEQGT----TIDSPKFGGDGGRRDKVVIEAASLEYLTGIKGTFGHC--GSYLVI  128

Query  389  RSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
            +S+ F TN R +GP+G  +G+PF     +G  IVGF GR G Y+DAIG+Y
Sbjct  129  KSLCFETNARNYGPFGSEIGTPFSLVMKEGGAIVGFHGRCGAYLDAIGVY  178


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYL  I GTF  +   S+ V+ S+ F TN + +GP+G   G +PF F   +G  I GF G
Sbjct  297  EYLIGIKGTFRRY--GSHFVINSLCFITNAKNYGPFGSEAGGTPFSFVMKEGGAIEGFHG  354

Query  503  RAGFYVDAI  529
            R G Y+DAI
Sbjct  355  RCGAYLDAI  363



>ref|XP_006663483.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Oryza brachyantha]
Length=1368

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E+L E+ GTFG F   + +V+ S+ F TN   +GPYG   G+PFH        IVGF GR
Sbjct  984   EFLLEVSGTFGRF-RTALNVMTSLTFVTNAHSYGPYGKIEGTPFHMPVQSNGCIVGFFGR  1042

Query  506   AGFYVDAIGIY  538
             AG+YVDAIGIY
Sbjct  1043  AGWYVDAIGIY  1053


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  323   DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             +E++T +CGT G + + S+ V+ SI   TN+  +GP+G   G PFHF       IVGF G
Sbjct  1138  EEFITSVCGTIGSY-NTSFDVITSITLVTNIDCYGPFGQENGIPFHFPIQGNGSIVGFFG  1196

Query  503   RAGFYVDAIGIY  538
              A  YVDAIG+Y
Sbjct  1197  HADIYVDAIGVY  1208


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNV-REFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT++ GTFG F D+   V+ S+ F +N   ++GP+G   G+PFH        IVGF G
Sbjct  1294  EFLTKVLGTFGQF-DEFPIVITSLTFFSNTGHQYGPFGQGGGTPFHAPISGNGSIVGFFG  1352

Query  503   RAGFYVDAIGIY  538
               G  V+AIG Y
Sbjct  1353  YQGDCVEAIGFY  1364



>ref|XP_009769147.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1335

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  99   EYLTGIKGTFGRFY--GHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  156

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  157  RSGLYLDAIGVY  168



>gb|EAZ01021.1| hypothetical protein OsI_23055 [Oryza sativa Indica Group]
Length=694

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPD-GKKIVGFI  499
             EYL EI GT GPF    + V+ S+   T +R +GPYG  VG+PFH    + G  IVGF 
Sbjct  313  SEYLIEISGTVGPFTYAPHGVITSLTLVTTIRTYGPYGELVGNPFHIPMQNKGGSIVGFF  372

Query  500  GRAGFYVDAIGIY  538
             R G+YVDA GIY
Sbjct  373  ARVGWYVDAFGIY  385


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 6/75 (8%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGK---KIVG  493
             E++T + GT GPF + S SV+ S++F TN  ++GP+G  +G+  HFQAP  K    IVG
Sbjct  619  SEFVTAVYGTVGPFGNYS-SVITSLRFVTNAGKYGPFGQGIGT--HFQAPMHKGSSSIVG  675

Query  494  FIGRAGFYVDAIGIY  538
            F GR+   V++IG Y
Sbjct  676  FFGRSSSCVESIGFY  690


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 42/73 (58%), Gaps = 6/73 (8%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT   GT G      ++V+ S+   TN R +GP+G   G+PF     +   IVGF G
Sbjct  469  SEFLTGFSGTTG------HNVVTSLTLITNARSYGPFGQVGGAPFQVPMRNNASIVGFFG  522

Query  503  RAGFYVDAIGIYS  541
            RA  Y++AIG+Y+
Sbjct  523  RADQYLNAIGVYA  535



>emb|CAD40628.2| OSJNBa0016N04.16 [Oryza sativa Japonica Group]
 emb|CAD40707.2| OSJNBb0042I07.4 [Oryza sativa Japonica Group]
 emb|CAH66364.1| H0607F01.9 [Oryza sativa Indica Group]
Length=477

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EY+TE+ GT GPF      V+ S+ F TN   +GP+G   G+PFH    D   IVGF  R
Sbjct  79   EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  138

Query  506  AGFYVDAIGIY  538
            AG+YVDA GIY
Sbjct  139  AGWYVDAFGIY  149



>ref|XP_002440163.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
 gb|EES18593.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
Length=206

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G + P       V+RS+ F TN+R +GP+G   G+PF F    G  IVGF G
Sbjct  83   DEYLTTVSGHYAPIAHGGSPVIRSLAFRTNLRAYGPFGAAEGTPFSFPVVGG-VIVGFYG  141

Query  503  RAGFYVDAIGIYSA  544
            R+G+ +DA+G+Y A
Sbjct  142  RSGWQLDAVGLYVA  155



>gb|EMT11070.1| hypothetical protein F775_02114 [Aegilops tauschii]
Length=332

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G +G F D  + V+RS+ F +N+R +GPYG   G PF   A  G KI+GF  
Sbjct  257  DEYLTSVHGHYGQFKD--FVVIRSLTFVSNLRSYGPYGKEDGVPFALHAGPGGKIIGFHA  314

Query  503  RAGFYVDAIGIY  538
            R+G ++DAIG Y
Sbjct  315  RSGQFLDAIGTY  326



>ref|XP_004168675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like, 
partial [Cucumis sativus]
Length=1090

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  323   DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             DEYLT I G +G FV      +RS+ F +N +++GPYG   G+ F F   +G KIVGF G
Sbjct  922   DEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTTEG-KIVGFHG  980

Query  503   RAGFYVDAIGIYSA*VITSSLSSLMLH  583
             R+G Y+DAIG+Y   +   S S  M+ 
Sbjct  981   RSGLYLDAIGVYLKPMAIQSPSKAMIQ  1007



>ref|NP_001052560.1| Os04g0369100 [Oryza sativa Japonica Group]
 dbj|BAF14474.1| Os04g0369100 [Oryza sativa Japonica Group]
Length=770

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EY+TE+ GT GPF      V+ S+ F TN   +GP+G   G+PFH    D   IVGF  R
Sbjct  372  EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  431

Query  506  AGFYVDAIGIY  538
            AG+YVDA GIY
Sbjct  432  AGWYVDAFGIY  442



>gb|EEE60834.1| hypothetical protein OsJ_14451 [Oryza sativa Japonica Group]
Length=736

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EY+TE+ GT GPF      V+ S+ F TN   +GP+G   G+PFH    D   IVGF  R
Sbjct  338  EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  397

Query  506  AGFYVDAIGIY  538
            AG+YVDA GIY
Sbjct  398  AGWYVDAFGIY  408



>gb|AAR20919.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E++ E+ GTFG +  D+++++ S+KF TNV+ +GP+G   G+ F         IVGF 
Sbjct  228  TSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGFF  287

Query  500  GRAGFYVDAIGIY  538
            GR+G Y+DA+G+Y
Sbjct  288  GRSGIYLDALGVY  300



>gb|ABA94002.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1386

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +2

Query  320   ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
             + E L E+ GTFG F     +++ S+ F TN + +GP+G   G+PFH     G +IVGF 
Sbjct  1000  SSEVLVEVSGTFGRFAGFQ-NIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFF  1058

Query  500   GRAGFYVDAIGIY  538
             GRAG+  DAIGIY
Sbjct  1059  GRAGWCFDAIGIY  1071


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVR-EFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+  ++ GTFGPF  +  +V+ S+ F TN   ++GP+G   G+PFH        IVGF G
Sbjct  1312  EFFVKVSGTFGPF-GEFPNVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGFFG  1370

Query  503   RAGFYVDAIGIY  538
             R G  ++A+G Y
Sbjct  1371  REGLCIEAVGFY  1382


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E++T + GT G +   S  V+ SI   TN   +GP+G   G PF F       IVGF G 
Sbjct  1157  EFITRVYGTIGSYNTPS-DVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGH  1215

Query  506   AGFYVDAIGIY  538
             A  YVDAIG+Y
Sbjct  1216  ANLYVDAIGVY  1226



>ref|XP_002439182.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
 gb|EES17612.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
Length=304

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EY+ E+ GT+G F  +  +VL S K  TNVR +GP+    G+PF   AP    IVGF GR
Sbjct  234  EYVKEVSGTYGTF--EGITVLTSFKLVTNVRTWGPWAIENGTPFSITAPTNSSIVGFYGR  291

Query  506  AGFYVDAIGIYSA  544
            AG  +DAIG+Y A
Sbjct  292  AGRLIDAIGVYFA  304



>gb|EEC68269.1| hypothetical protein OsI_36304 [Oryza sativa Indica Group]
Length=1419

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +2

Query  320   ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
             + E L E+ GTFG F     +++ S+ F TN + +GP+G   G+PFH     G +IVGF 
Sbjct  1045  SSEVLVEVSGTFGRFAGFQ-NIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFF  1103

Query  500   GRAGFYVDAIGIY  538
             GRAG+  DAIGIY
Sbjct  1104  GRAGWCFDAIGIY  1116


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVR-EFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+  ++ GTFGPF  +  +V+ S+ F TN   ++GP+G   G+PFH        IVGF G
Sbjct  1345  EFFVKVSGTFGPF-GEFPNVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGFFG  1403

Query  503   RAGFYVDAIGIY  538
             R G  ++A+G Y
Sbjct  1404  REGLCIEAVGFY  1415


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 1/69 (1%)
 Frame = +2

Query  332   LTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRAG  511
             +T + GT G +   S  V+ SI   TN   +GP+G   G PF F       IVGF G A 
Sbjct  1192  ITRVYGTSGSYNTPS-DVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHAN  1250

Query  512   FYVDAIGIY  538
              YVDAIG+Y
Sbjct  1251  LYVDAIGVY  1259



>gb|EEE52196.1| hypothetical protein OsJ_34075 [Oryza sativa Japonica Group]
Length=1431

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +2

Query  320   ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
             + E L E+ GTFG F     +++ S+ F TN + +GP+G   G+PFH     G +IVGF 
Sbjct  1045  SSEVLVEVSGTFGRFAGFQ-NIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFF  1103

Query  500   GRAGFYVDAIGIY  538
             GRAG+  DAIGIY
Sbjct  1104  GRAGWCFDAIGIY  1116


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVR-EFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+  ++ GTFGPF  +  +V+ S+ F TN   ++GP+G   G+PFH        IVGF G
Sbjct  1357  EFFVKVSGTFGPF-GEFPNVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGFFG  1415

Query  503   RAGFYVDAIGIY  538
             R G  ++A+G Y
Sbjct  1416  REGLCIEAVGFY  1427


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E++T + GT G +   S  V+ SI   TN   +GP+G   G PF F       IVGF G 
Sbjct  1202  EFITRVYGTIGSYNTPS-DVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGH  1260

Query  506   AGFYVDAIGIY  538
             A  YVDAIG+Y
Sbjct  1261  ANLYVDAIGVY  1271



>ref|XP_007215056.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
 gb|EMJ16255.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
Length=179

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+L  + G + P V     ++RS+KF +N R FGPYG   G+PF F   DG KIVG  G
Sbjct  82   DEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTPFTFSV-DGGKIVGLKG  140

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R G+Y+DAIG + +   T  L
Sbjct  141  RNGWYLDAIGFHVSPPQTKKL  161



>ref|XP_004152769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Cucumis sativus]
Length=1463

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  323   DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             DEYLT I G +G FV      +RS+ F +N +++GPYG   G+ F F   +G KIVGF G
Sbjct  949   DEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTTEG-KIVGFHG  1007

Query  503   RAGFYVDAIGIYSA*VITSSLSSLMLH  583
             R+G Y+DAIG+Y   +   S S  M+ 
Sbjct  1008  RSGLYLDAIGVYLKPMAIQSPSKAMIQ  1034


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT + G +GP +    +V++S+ F T   ++GP+G   G+PF     +G KIVGF GR
Sbjct  1178  EILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG-KIVGFHGR  1236

Query  506   AGFYVDAIGIY  538
              G ++DA+G++
Sbjct  1237  KGLFLDALGVH  1247


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPF-VDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E LT I G +G    D+    ++S+ F T+  +FGP+G  VGS F     +G K+VGF G
Sbjct  1374  EVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEVGSFFTSTTTEG-KVVGFHG  1432

Query  503   RAGFYVDAIGIY  538
             R+  Y+DAIG++
Sbjct  1433  RSSLYLDAIGVH  1444



>ref|XP_009614996.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009614997.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1313

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  55   EYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  112

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  113  RSGLYLDAIGVY  124



>ref|XP_009614994.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=1334

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  159

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  160  RSGLYLDAIGVY  171



>ref|XP_009614993.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1351

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  159

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  160  RSGLYLDAIGVY  171



>ref|XP_009614991.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009614992.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1360

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  159

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  160  RSGLYLDAIGVY  171



>gb|EMT24046.1| hypothetical protein F775_25349 [Aegilops tauschii]
Length=304

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E++ E+ GTFG +  D+++++ S+KF TNV+ +GP+G   G+ F         IVGF G
Sbjct  229  SEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGFFG  288

Query  503  RAGFYVDAIGIY  538
            R+G Y+DA+G+Y
Sbjct  289  RSGIYLDALGVY  300



>gb|ABS82785.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E++ E+ GTFG +  D+++++ S+KF TNV+ +GP+G   G+ F         IVGF 
Sbjct  228  TSEFVREVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGFF  287

Query  500  GRAGFYVDAIGIY  538
            GR+G Y+DA+G+Y
Sbjct  288  GRSGIYLDALGVY  300



>ref|XP_008244753.1| PREDICTED: agglutinin-like [Prunus mume]
Length=179

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+L  + G + P V     ++RS+KF +N R FGPYG   G+PF F   DG KIVG  G
Sbjct  82   DEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGKIVGLKG  140

Query  503  RAGFYVDAIGIY  538
            R G+Y+DAIG +
Sbjct  141  RNGWYLDAIGFH  152



>ref|XP_011030089.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
 ref|XP_011030090.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
Length=191

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYLT + G + P V     V+RS+ F++N R FGP+G   G+PF   + DG  IVGF G
Sbjct  84   EEYLTSVSGHYCPVVYGGSPVIRSLTFSSNKRTFGPFGVEEGTPFTL-SMDGASIVGFKG  142

Query  503  RAGFYVDAIG  532
            R+G+Y+DAIG
Sbjct  143  RSGWYLDAIG  152



>ref|XP_002318228.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
 gb|EEE96448.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
Length=237

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYLT + G + P V     V+RS+ F++N R FGP+G   G+PF   + DG  IVGF G
Sbjct  130  EEYLTSVSGHYCPVVYGGSPVIRSLAFSSNKRTFGPFGVEEGTPFTL-SMDGASIVGFKG  188

Query  503  RAGFYVDAIG  532
            R G+Y+DAIG
Sbjct  189  RGGWYLDAIG  198



>ref|XP_009795366.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795367.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795368.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795369.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795370.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795371.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795372.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795373.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795374.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795375.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1346

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG F D S  +++S+ F TN + +GP+G    G+PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFGRFYDRS--IIKSLCFITNAKNYGPFGCEAAGTPFSLVMEEGVAIVGFHG  159

Query  503  RAGFYVDAIGIY  538
            R+G ++DAIG+Y
Sbjct  160  RSGLFLDAIGVY  171



>ref|XP_006647196.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Oryza 
brachyantha]
Length=960

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL E+ GT GPF + S   + S+   TNVR +GP+G   G+PF         IVGF GR
Sbjct  887  EYLVEVIGTVGPF-NVSSEAITSLTLVTNVRSYGPFGQPQGTPFRTPLKKNSCIVGFFGR  945

Query  506  AGFYVDAIGIY  538
            +G Y+DA+G+Y
Sbjct  946  SGTYLDAVGVY  956



>ref|XP_006372713.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
 gb|ERP50510.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
Length=173

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 72/146 (49%), Gaps = 12/146 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GG+ WS+     INQIVI          +G     I+  D+ +  +   GG + 
Sbjct  33   GPWGGQGGNPWSYMTNQGINQIVIN---------VGSNIKSISFRDTTDLDSATFGGNNP  83

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  84   NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  141

Query  461  FQAPDGKKIVGFIGRAGFYVDAIGIY  538
                +   +VGF GRAG Y+DAIGI+
Sbjct  142  IPI-NNNTVVGFHGRAGHYLDAIGIF  166



>ref|XP_006647195.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Oryza 
brachyantha]
Length=1077

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             EYL E+ GT GPF + S   + S+   TNVR +GP+G   G+PF         IVGF GR
Sbjct  1004  EYLVEVIGTVGPF-NVSSEAITSLTLVTNVRSYGPFGQPQGTPFRTPLKKNSCIVGFFGR  1062

Query  506   AGFYVDAIGIY  538
             +G Y+DA+G+Y
Sbjct  1063  SGTYLDAVGVY  1073



>ref|XP_008444758.1| PREDICTED: LOW QUALITY PROTEIN: myrosinase-binding protein-like 
At3g16470 [Cucumis melo]
Length=598

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT I G +G FV      +RS+ F +N +++GPYG   G+ F F   +G KIVGF G
Sbjct  80   DEYLTMIRGYYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTVFSFPTTEG-KIVGFHG  138

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHWNTSMC  601
            R+G Y+DAIG+Y   +   S S  M+     + 
Sbjct  139  RSGLYLDAIGVYLKPMAIQSPSKAMIQSQDHLA  171


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + G +GP +    +V++S+ F T   ++GP+G   G+PF     +G KIVGF GR
Sbjct  313  EILTHVTGHYGPVMYMGPNVIKSLSFHTTKAKYGPFGEAQGTPFSTNVKEG-KIVGFHGR  371

Query  506  AGFYVDAIGIY  538
             G ++DA+G++
Sbjct  372  KGLFLDALGVH  382


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 47/88 (53%), Gaps = 14/88 (16%)
 Frame = +2

Query  326  EYLTEICGTFGPF-VDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E LT I G +G    D+    ++S+ F T+  +FGP+G  VGS F     +G K+VGF G
Sbjct  509  EVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEVGSFFTSTTTEG-KVVGFHG  567

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            R+  Y+DAIG++            M HW
Sbjct  568  RSSLYLDAIGVH------------MQHW  583



>gb|KGN62634.1| hypothetical protein Csa_2G362470 [Cucumis sativus]
Length=598

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT I G +G FV      +RS+ F +N +++GPYG   G+ F F   +G KIVGF G
Sbjct  80   DEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTTEG-KIVGFHG  138

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLH  583
            R+G Y+DAIG+Y   +   S S  M+ 
Sbjct  139  RSGLYLDAIGVYLKPMAIQSPSKAMIQ  165


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + G +GP +    +V++S+ F T   ++GP+G   G+PF     +G KIVGF GR
Sbjct  313  EILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG-KIVGFHGR  371

Query  506  AGFYVDAIGIY  538
             G ++DA+G++
Sbjct  372  KGLFLDALGVH  382


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 47/88 (53%), Gaps = 14/88 (16%)
 Frame = +2

Query  326  EYLTEICGTFGPF-VDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E LT I G +G    D+    ++S+ F T+  +FGP+G  VGS F     +G K+VGF G
Sbjct  509  EVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEVGSFFTSTTTEG-KVVGFHG  567

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            R+  Y+DAIG++            M HW
Sbjct  568  RSSLYLDAIGVH------------MQHW  583



>ref|XP_008806706.1| PREDICTED: agglutinin-like isoform X1 [Phoenix dactylifera]
Length=200

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+LT + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  IVGF G
Sbjct  82   EEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTFPM-DGGMIVGFSG  140

Query  503  RAGFYVDAIGI  535
            R+G+Y+DAIG+
Sbjct  141  RSGWYLDAIGL  151



>ref|XP_008806712.1| PREDICTED: agglutinin-like isoform X2 [Phoenix dactylifera]
Length=197

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+LT + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  IVGF G
Sbjct  79   EEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTFPM-DGGMIVGFSG  137

Query  503  RAGFYVDAIGI  535
            R+G+Y+DAIG+
Sbjct  138  RSGWYLDAIGL  148



>ref|NP_001066495.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|ABA97248.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB51090.1| mannose-specific jacalin-related lectin [Oryza sativa Japonica 
Group]
 dbj|BAF29514.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|EAZ20117.1| hypothetical protein OsJ_35712 [Oryza sativa Japonica Group]
Length=306

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            + E+L E+ GTFGP+  +  +V+ SI F TN + +GP+G   G+PF   A +   IVGF 
Sbjct  232  SSEFLKEVSGTFGPY--EGSTVITSINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGFF  289

Query  500  GRAGFYVDAIGIY  538
            GR+G Y++A+G+Y
Sbjct  290  GRSGKYINAVGVY  302



>gb|EMS55842.1| hypothetical protein TRIUR3_32339 [Triticum urartu]
Length=288

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E++ E+ GTFG +  D+++++ S+KF TN++ +GP+G   G+ F         IVGF G
Sbjct  213  SEFVKEVSGTFGLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSSIVGFFG  272

Query  503  RAGFYVDAIGIY  538
            R+G Y+DA+G+Y
Sbjct  273  RSGIYLDALGVY  284



>ref|XP_008348486.1| PREDICTED: agglutinin alpha chain-like [Malus domestica]
Length=189

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEY+  + G +G  V     ++RS+KF +N R FGP+G + G+PF +   DG KIVG  G
Sbjct  89   DEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGTPFTYTL-DGGKIVGLKG  147

Query  503  RAGFYVDAIGIY  538
            R G+Y+DAIG +
Sbjct  148  RNGWYIDAIGFH  159



>ref|XP_008677994.1| PREDICTED: mannose/glucose-specific lectin-like isoform X6 [Zea 
mays]
Length=684

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  249  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  307

Query  506  AGFYVDAIGIYS  541
            +G Y+ AIG+Y+
Sbjct  308  SGQYLYAIGVYT  319


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  439  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  497

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  498  GRSGRYLNAIGVYTA  512



>ref|XP_008677998.1| PREDICTED: mannose/glucose-specific lectin-like isoform X9 [Zea 
mays]
Length=616

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  181  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  239

Query  506  AGFYVDAIGIYS  541
            +G Y+ AIG+Y+
Sbjct  240  SGQYLYAIGVYT  251


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  371  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  429

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  430  GRSGRYLNAIGVYTA  444



>ref|XP_008677991.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Zea 
mays]
Length=778

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  348  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  406

Query  506  AGFYVDAIGIYS  541
            +G Y+ AIG+Y+
Sbjct  407  SGQYLYAIGVYT  418


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  538  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  596

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  597  GRSGRYLNAIGVYTA  611



>ref|XP_008677986.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677987.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677988.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677989.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
Length=783

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  348  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  406

Query  506  AGFYVDAIGIYS  541
            +G Y+ AIG+Y+
Sbjct  407  SGQYLYAIGVYT  418


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  538  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  596

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  597  GRSGRYLNAIGVYTA  611



>ref|XP_008677996.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
 ref|XP_008677997.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
Length=652

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  217  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  275

Query  506  AGFYVDAIGIYS  541
            +G Y+ AIG+Y+
Sbjct  276  SGQYLYAIGVYT  287


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  407  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  465

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  466  GRSGRYLNAIGVYTA  480



>ref|XP_008677990.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Zea 
mays]
Length=781

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  346  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  404

Query  506  AGFYVDAIGIYS  541
            +G Y+ AIG+Y+
Sbjct  405  SGQYLYAIGVYT  416


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  536  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  594

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  595  GRSGRYLNAIGVYTA  609



>ref|XP_010924945.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Elaeis 
guineensis]
Length=200

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+LT + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  IVGF G
Sbjct  82   EEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEEGTPFTFPM-DGGMIVGFSG  140

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R G+Y+DAIG+  + + T+ L
Sbjct  141  RGGWYLDAIGLCLSPIRTAGL  161



>gb|EEC69076.1| hypothetical protein OsI_37951 [Oryza sativa Indica Group]
Length=250

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            + E+L E+  TFGP+  +  +V+RSI F TN + +GP+G   G+PF   A +   +VGF 
Sbjct  176  SSEFLKEVSRTFGPY--EGSTVIRSINFITNKQTYGPFGRQEGTPFSVPAQNNSSVVGFF  233

Query  500  GRAGFYVDAIGIY  538
            GR+G Y++A+G+Y
Sbjct  234  GRSGKYINAVGVY  246



>ref|XP_008654961.1| PREDICTED: LOC100282355 isoform X1 [Zea mays]
Length=238

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  117  DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  175

Query  503  RAGFYVDAIGIYSA  544
            R+G+ +DA+G+Y A
Sbjct  176  RSGWQLDAVGLYVA  189



>ref|XP_008654962.1| PREDICTED: LOC100282355 isoform X2 [Zea mays]
 gb|AFW80927.1| hypothetical protein ZEAMMB73_478294 [Zea mays]
Length=237

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  116  DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  174

Query  503  RAGFYVDAIGIYSA  544
            R+G+ +DA+G+Y A
Sbjct  175  RSGWQLDAVGLYVA  188



>ref|XP_010924946.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Elaeis 
guineensis]
Length=197

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+LT + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  IVGF G
Sbjct  79   EEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEEGTPFTFPM-DGGMIVGFSG  137

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R G+Y+DAIG+  + + T+ L
Sbjct  138  RGGWYLDAIGLCLSPIRTAGL  158



>ref|XP_008677992.1| PREDICTED: mannose/glucose-specific lectin-like isoform X4 [Zea 
mays]
Length=760

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  325  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  383

Query  506  AGFYVDAIGIYS  541
            +G Y+ AIG+Y+
Sbjct  384  SGQYLYAIGVYT  395


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  515  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  573

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  574  GRSGRYLNAIGVYTA  588



>ref|XP_006853910.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
 gb|ERN15377.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
Length=191

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E++TE+ G + P V     V+RS+KFTTN+R +GPYG   G+PF     DG  IVGF G
Sbjct  90   EEFITEVSGHYCPVVHGGTPVIRSLKFTTNMRTYGPYGVEEGTPFSCPM-DGGLIVGFKG  148

Query  503  RAGFYVDAI  529
            R G+Y+D+I
Sbjct  149  RNGWYLDSI  157



>ref|XP_008654963.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
 ref|XP_008654964.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
Length=231

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  110  DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  168

Query  503  RAGFYVDAIGIYSA  544
            R+G+ +DA+G+Y A
Sbjct  169  RSGWQLDAVGLYVA  182



>ref|NP_001148739.1| LOC100282355 [Zea mays]
 gb|ACG32703.1| agglutinin [Zea mays]
Length=207

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  84   DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  142

Query  503  RAGFYVDAIGIYSA  544
            R+G+ +DA+G+Y A
Sbjct  143  RSGWQLDAVGLYVA  156



>ref|XP_011463712.1| PREDICTED: jacalin-related lectin 3-like [Fragaria vesca subsp. 
vesca]
Length=599

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  323  DEYLTEICGTFG--PFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
            DE+L  + G +    ++  +  VLRS+KF TN R FGP+G  VG+PF F+  DG KIVGF
Sbjct  333  DEFLVSVSGYYCGVTWIVGAPVVLRSLKFETNKRTFGPFGVEVGTPFTFRVKDGVKIVGF  392

Query  497  IGRAGFYVDAIGIY  538
             GR G+Y+DAIG +
Sbjct  393  KGRNGWYLDAIGFH  406


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+L  + G + P V     V+RS+KF +N R FGP+G   G+PF F   DG KIVG  G
Sbjct  83   DEFLVSVSGHYCPVVYGGSPVIRSLKFESNRRTFGPFGVEEGTPFTFTV-DGGKIVGLKG  141

Query  503  RAGFYVDAIGIY  538
            R G+Y+DAIG +
Sbjct  142  RGGWYLDAIGFH  153


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +2

Query  323  DEYLTEICGTFG--PFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
            +E++  + G +G   ++  +  VL S++F +N R FGP+G  VG+PF F+  DG +IVG 
Sbjct  485  NEFIVSVTGHYGGVTWIVGAPVVLLSLRFESNRRTFGPFGVQVGTPFTFRVKDGDQIVGL  544

Query  497  IGRAGFYVDAIGIYSA  544
             GR G+Y+DAIG +++
Sbjct  545  KGRNGWYLDAIGFHTS  560



>ref|XP_008654965.1| PREDICTED: LOC100282355 isoform X4 [Zea mays]
Length=211

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  90   DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  148

Query  503  RAGFYVDAIGIYSA  544
            R+G+ +DA+G+Y A
Sbjct  149  RSGWQLDAVGLYVA  162



>sp|P83304.1|LEC_PARPC RecName: Full=Mannose/glucose-specific lectin, partial [Parkia 
platycephala]
 pdb|1ZGR|A Chain A, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGR|B Chain B, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGS|A Chain A, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
 pdb|1ZGS|B Chain B, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
Length=447

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 74/154 (48%), Gaps = 25/154 (16%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPI-------GITFSCINEDDSKEtitv  259
            GP G SGGD WS+     INQI+I +G +  +            TF  +N  D+ E  TV
Sbjct  304  GPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTV  363

Query  260  ggggtdtlvtrtdtviidddADEYLTEICGTFGPF-VDDSYSVLRSIKFTTNVREFGPYG  436
                                  EYLT I GT+G +   D ++ + S+ FTTN+  +GP+G
Sbjct  364  SINW----------------PSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFG  407

Query  437  PNVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                + F     +   +VGF GRAG Y+DAIGI+
Sbjct  408  KASATSFSIPIHN-NMVVGFHGRAGDYLDAIGIF  440


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 75/147 (51%), Gaps = 11/147 (7%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G SGG++WSF+  + I +IVI    +  +    I+F   + D S    T GG     
Sbjct  9    GPWGGSGGNYWSFKANHAITEIVIHVKDNIKS----ISFKDASGDIS---GTFGGKDPRE  61

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                 +  I      EYL  I G++G +  +   V+RS+ F TN+  +GP+G   G    
Sbjct  62   NEKGDEKKIKIHWPTEYLKSISGSYGDY--NGVLVIRSLSFITNLTTYGPFGSTSGGE-S  118

Query  461  FQAPDGKKIV-GFIGRAGFYVDAIGIY  538
            F  P    +V GF GRAG+Y+DA+GI+
Sbjct  119  FSIPIADSVVVGFHGRAGYYLDALGIF  145


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+L  I GT+G +    + V+ S+ F TNV + GP+G   G+ F     +G  + GF G+
Sbjct  224  EHLKSISGTYGNY--KGFEVVTSLSFITNVTKHGPFGIASGTSFSIPI-EGSLVTGFHGK  280

Query  506  AGFYVDAIGIY  538
            +G+Y+D+IGIY
Sbjct  281  SGYYLDSIGIY  291



>ref|XP_004982894.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=151

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            A E++ EI GT+GPF    ++V+RS+ F TN+ + GP+G    +PF     DG  +VGF 
Sbjct  78   AGEFVKEISGTYGPF--GGHTVVRSLTFVTNIGKHGPFGTPWQTPFSVPVQDGAHVVGFF  135

Query  500  GRAGFYVDAIGIY  538
            GR+G  +DA+G+Y
Sbjct  136  GRSGSLLDAVGVY  148



>gb|EAY82651.1| hypothetical protein OsI_37872 [Oryza sativa Indica Group]
Length=304

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            + E+L E+ GTFG +   +  V+ SIKF TNV+ +GP+G   G+PF     +   +VGF 
Sbjct  230  SSEFLKEVSGTFGTYYGSN--VITSIKFVTNVKTYGPFGKQNGTPFSIPVQNNSSVVGFF  287

Query  500  GRAGFYVDAIGIY  538
            GR G Y+DA+G+Y
Sbjct  288  GRGGKYLDAVGVY  300



>gb|EEE60695.1| hypothetical protein OsJ_14181 [Oryza sativa Japonica Group]
Length=95

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  502
            +++ EI GT G +V    +VLRS+K TT  R +GPYG P  G PF F      +I GF  
Sbjct  20   DFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITGFFV  79

Query  503  RAGFYVDAIGIY  538
            RAGF  DAIG+Y
Sbjct  80   RAGFITDAIGVY  91



>ref|XP_009768641.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1282

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG  +  S+SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  29   EYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHG  86

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  87   RCGAYLDAIGVY  98



>ref|XP_009768640.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1339

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG  +  S+SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  86   EYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHG  143

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  144  RCGAYLDAIGVY  155



>ref|XP_009768636.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768638.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768639.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1355

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG  +  S+SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHG  159

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  160  RCGAYLDAIGVY  171



>ref|XP_010273654.1| PREDICTED: mannose/glucose-specific lectin-like [Nelumbo nucifera]
Length=147

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFV--DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
            DEYLT I GTFG      + + V+RSI+F TN R +GPYG   G+ F      G KIVGF
Sbjct  72   DEYLTSISGTFGRRWKNQNGHVVVRSIQFNTNARSYGPYGSTDGTAFSLPVKQG-KIVGF  130

Query  497  IGRAGFYVDAIGIY  538
             GR G  +D+IG+Y
Sbjct  131  HGRCGADLDSIGVY  144



>ref|XP_009770862.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770863.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770864.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770865.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770866.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1328

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 56/157 (36%), Positives = 85/157 (54%), Gaps = 12/157 (8%)
 Frame = +2

Query  74   MAVPIDAVS-GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEt  250
            M V +D++   P G +GG  W+++  N I +I+I  G   +     I F  +    +K+ 
Sbjct  1    MHVKMDSILLEPWGGTGGSKWNYKLKNPIKEILIAHGDIID----SIMFRTV----TKKG  52

Query  251  itvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGP  430
            IT+G         +   V+I+    EYLT I GTFG +     SV++S+ F TNV+ +GP
Sbjct  53   ITIGSPKFGGNGGQISKVVIEATPLEYLTGIKGTFGHYC--GLSVIKSLCFITNVKNYGP  110

Query  431  YGPNVG-SPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
            +G   G +PF     +G  IVGF GR G ++DAIG+Y
Sbjct  111  FGCEAGGTPFSLVMKEGVAIVGFHGRCGAFLDAIGVY  147



>gb|EYU45843.1| hypothetical protein MIMGU_mgv1a014002mg [Erythranthe guttata]
Length=204

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE LT + G + P V     V+RS+ F TN R FGP+G   G+PF     +G +IVGF G
Sbjct  84   DEILTTVTGYYSPVVHGGSPVIRSLTFKTNRRTFGPFGVEEGTPFSLPM-EGGQIVGFKG  142

Query  503  RAGFYVDAIGIY  538
            R G+Y+DAIG +
Sbjct  143  RGGWYLDAIGFH  154



>ref|XP_006426466.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
 ref|XP_006466099.1| PREDICTED: agglutinin-like [Citrus sinensis]
 gb|ESR39706.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
Length=190

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+L  + G + P V     V+RS+ F +N R FGP+G   G+PF F + DG  +VGF G
Sbjct  83   EEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVEEGTPFTF-SMDGGLVVGFKG  141

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLH  583
            R+G+YVDAIG Y    ++   SS +L 
Sbjct  142  RSGWYVDAIGFY----LSKKQSSKLLQ  164



>gb|KDO58671.1| hypothetical protein CISIN_1g037526mg, partial [Citrus sinensis]
Length=200

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+L  + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  +VGF G
Sbjct  93   EEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVEEGTPFTFSM-DGGLVVGFKG  151

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLH  583
            R+G+YVDAIG Y    ++   SS +L 
Sbjct  152  RSGWYVDAIGFY----LSKKQSSKLLQ  174



>ref|XP_006853909.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
 gb|ERN15376.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
Length=196

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E++TE+ G + P V     V+RS+KF T+ R +GPYG   G+PF F   DG  IVGF G
Sbjct  92   EEFITEVSGHYCPVVHGGTPVIRSLKFITSKRTYGPYGVEEGTPFSFLM-DGGLIVGFKG  150

Query  503  RAGFYVDAI  529
            R G+Y+DAI
Sbjct  151  RNGWYLDAI  159



>gb|ACF87628.1| unknown [Zea mays]
Length=122

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE LTEI GT GP  +   ++++S+KF TN R +GPYG + G+PF  +  +   + GF G
Sbjct  48   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFG  106

Query  503  RAGFYVDAIGIY  538
            R+G  +DAIG+Y
Sbjct  107  RSGDCLDAIGLY  118



>emb|CDM80625.1| unnamed protein product [Triticum aestivum]
 emb|CDM80626.1| unnamed protein product [Triticum aestivum]
Length=307

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G +G F    + V+RS+KF +N+R +GPYG   G  F   A  G KI+GF  
Sbjct  232  DEYLTSVHGHYGQF--KGFVVVRSLKFVSNLRSYGPYGKEDGVSFALHAGPGGKIIGFHA  289

Query  503  RAGFYVDAIGIY  538
            R+G ++DAIG Y
Sbjct  290  RSGQFLDAIGTY  301



>ref|NP_001106057.1| PL3K2 [Zea mays]
 gb|ABR68026.1| PL3K2 [Zea mays]
 gb|ACF80462.1| unknown [Zea mays]
 gb|ACG30569.1| hypothetical protein [Zea mays]
Length=151

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE LTEI GT GP  +   ++++S+KF TN R +GPYG + G+PF  +  +   + GF G
Sbjct  77   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFG  135

Query  503  RAGFYVDAIGIY  538
            R+G  +DAIG+Y
Sbjct  136  RSGDCLDAIGLY  147



>gb|ACG29554.1| hypothetical protein [Zea mays]
 gb|ACG44268.1| hypothetical protein [Zea mays]
Length=151

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE LTEI GT GP  +   ++++S+KF TN R +GPYG + G+PF  +  +   + GF G
Sbjct  77   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRTYGPYGRDEGTPFRVKVMNNGHVAGFFG  135

Query  503  RAGFYVDAIGIY  538
            R+G  +DAIG+Y
Sbjct  136  RSGDCLDAIGLY  147



>ref|XP_009622525.1| PREDICTED: agglutinin-like isoform X2 [Nicotiana tomentosiformis]
Length=546

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYLT I GTFG     SYSV++ + F TN + +GP+G   G+PF     +G  IVGF GR
Sbjct  12   EYLTGIKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  69

Query  506  AGFYVDAIGIY  538
             G Y+DAIG+Y
Sbjct  70   CGAYLDAIGVY  80


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  401  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  458

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  459  RSGLYLDAIGVY  470


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  329  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  508
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  196  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  253

Query  509  GFYVDAIGIY  538
              Y+DAIG+Y
Sbjct  254  RAYLDAIGVY  263



>ref|XP_009622524.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Nicotiana 
tomentosiformis]
Length=569

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYLT I GTFG     SYSV++ + F TN + +GP+G   G+PF     +G  IVGF GR
Sbjct  35   EYLTGIKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  92

Query  506  AGFYVDAIGIY  538
             G Y+DAIG+Y
Sbjct  93   CGAYLDAIGVY  103


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  424  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  481

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  482  RSGLYLDAIGVY  493


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  329  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  508
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  219  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  276

Query  509  GFYVDAIGIY  538
              Y+DAIG+Y
Sbjct  277  RAYLDAIGVY  286



>ref|XP_011001798.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 73/146 (50%), Gaps = 12/146 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GG+ WS+     INQIVI          +G+    I+  D+ +  +   GG + 
Sbjct  305  GPWGGQGGNPWSYITNRGINQIVIN---------VGLNIKSISFRDTTDLDSATFGGNNP  355

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  356  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  413

Query  461  FQAPDGKKIVGFIGRAGFYVDAIGIY  538
                +   +VGF GRAG Y+DAIGI+
Sbjct  414  IPI-NNNTVVGFHGRAGHYLDAIGIF  438


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 67/153 (44%), Gaps = 24/153 (16%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnP-------IGITFSCINEDDSKEtitv  259
            GP G  GGD WS+R +  I +IV+R  G+  +         +  TF     D +      
Sbjct  11   GPWGGLGGDHWSYRASGGITEIVLRVEGNIKSISFKDASGLVSGTFGGRGNDPNDRGEQK  70

Query  260  ggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP  439
                                  EYL  I GT+G +      V+ S+ F TN+  +GP+G 
Sbjct  71   KIEIQW--------------PSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGT  114

Query  440  NVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
             +G  F     D   +VGF GR G+Y+DA+GI+
Sbjct  115  ALGETFSIPIAD-SAVVGFHGRCGYYLDALGIF  146


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT I GT+G +      V+ S+ F TN+   GP+G   G+ F     +G  ++GF G
Sbjct  224  SEHLTSITGTYGNYA--GMVVITSLSFITNLTTHGPFGTATGTSFSIPI-EGSVVIGFHG  280

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIGI+
Sbjct  281  RGGHYLDAIGIH  292



>ref|XP_011001797.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
Length=445

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 73/146 (50%), Gaps = 12/146 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GG+ WS+     INQIVI          +G+    I+  D+ +  +   GG + 
Sbjct  305  GPWGGQGGNPWSYITNRGINQIVIN---------VGLNIKSISFRDTTDLDSATFGGNNP  355

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  356  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  413

Query  461  FQAPDGKKIVGFIGRAGFYVDAIGIY  538
                +   +VGF GRAG Y+DAIGI+
Sbjct  414  IPI-NNNTVVGFHGRAGHYLDAIGIF  438


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 69/147 (47%), Gaps = 12/147 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GGD WS+R +  I +IV+R         +G   S   +D S       GG  + 
Sbjct  11   GPWGGLGGDHWSYRASGGITEIVLRV--------VGNIKSISFKDASGLVSGTFGGRGND  62

Query  281  -lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPF  457
                     I      EYL  I GT+G +      V+ S+ F TN+  +GP+G  +G  F
Sbjct  63   PNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALGETF  120

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 D   +VGF GR G+Y+DA+GI+
Sbjct  121  SIPIAD-SAVVGFHGRCGYYLDALGIF  146


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT I GT+G +      V+ S+ F TN+   GP+G   G+ F     +G  ++GF G
Sbjct  224  SEHLTSITGTYGNYA--GMVVITSLSFITNLTTHGPFGTATGTSFSIPI-EGSVVIGFHG  280

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIGI+
Sbjct  281  RGGHYLDAIGIH  292



>ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus communis]
 gb|EEF46311.1| hypothetical protein RCOM_1485780 [Ricinus communis]
Length=514

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL    G + P V     V+RSI F +N R FGP+G   G+PF   + DG+++VGF G
Sbjct  405  EEYLVSASGNYCPVVYGGSPVIRSITFKSNRRTFGPFGIEEGTPFTL-SMDGRRVVGFTG  463

Query  503  RAGFYVDAIG  532
            R+G+Y+DAIG
Sbjct  464  RSGWYLDAIG  473



>ref|NP_177447.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|Q9SSM3.1|JAL19_ARATH RecName: Full=Jacalin-related lectin 19 [Arabidopsis thaliana]
 gb|AAD55651.1|AC008017_24 Similar to jacalin [Arabidopsis thaliana]
 gb|AAX49365.1| At1g73040 [Arabidopsis thaliana]
 gb|ABR46196.1| At1g73040 [Arabidopsis thaliana]
 gb|AEE35407.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=176

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 59/96 (61%), Gaps = 4/96 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYLT + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   EEYLTGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  139

Query  503  RAGFYVDAIGIYSA*VITSSLSSLM---LHWNTSMC  601
            R+G+Y+D+IG + +   ++ + + +   +HW T + 
Sbjct  140  RSGWYLDSIGFHLSRPKSTKMINKLRKKIHWLTRIV  175



>ref|XP_011081586.1| PREDICTED: jacalin-related lectin 19-like [Sesamum indicum]
Length=308

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLTE+ G   P      +++RS+KF +N R +GP+G    +PF F   +G  IVGF G
Sbjct  30   DEYLTEVSGHCSPLGRRGNAMVRSLKFRSNWRTYGPFGVESETPFCFPM-EGGMIVGFRG  88

Query  503  RAGFYVDAIGIYSA*VITSSLSSLM  577
            R G YVDAIG +    IT ++ ++M
Sbjct  89   RCGLYVDAIGFH----ITQTICTIM  109


 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+LT + G   P V     V+RS+ F +N R FGP+G   G PF F   +G +IVGF G
Sbjct  225  EEFLTTVTGHCSPVVCGGSPVIRSLTFKSNRRTFGPFGVEEGVPFSFPM-EGGQIVGFKG  283

Query  503  RAGFYVDAIGIYSA  544
            RAG+Y+DAIG + A
Sbjct  284  RAGWYLDAIGFHIA  297



>ref|XP_009367509.1| PREDICTED: agglutinin alpha chain [Pyrus x bretschneideri]
Length=189

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEY+  + G +G  V     ++RS+KF +N R FGP+G + G+PF +   D  KIVG  G
Sbjct  89   DEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGTPFTYTL-DRSKIVGLKG  147

Query  503  RAGFYVDAIGIY  538
            R G+Y+DAIG +
Sbjct  148  RNGWYIDAIGFH  159



>ref|NP_001052399.1| Os04g0295400 [Oryza sativa Japonica Group]
 emb|CAD40444.2| OSJNBa0041M21.2 [Oryza sativa Japonica Group]
 dbj|BAF14313.1| Os04g0295400 [Oryza sativa Japonica Group]
Length=150

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  502
            +++ EI GT G +V    +VLRS+K TT  R +GPYG P  G PF F      +I GF  
Sbjct  75   DFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITGFFV  134

Query  503  RAGFYVDAIGIY  538
            RAGF  DAIG+Y
Sbjct  135  RAGFITDAIGVY  146



>ref|XP_006390600.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
 gb|ESQ27886.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
Length=176

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  + G + P V     V+RSI F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   DEYLIGVSGYYWPVVHSGSPVIRSITFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGING  139

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLH  583
            R+G+Y+D+IG +    ++   S+ M+H
Sbjct  140  RSGWYLDSIGFH----LSRPKSTKMIH  162



>gb|AFK34206.1| unknown [Lotus japonicus]
Length=182

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+L  + G + P V     V RS+ F +N R FGPYG   G+PF F   DG ++VGF G
Sbjct  78   DEFLISVSGHYCPVVRGGSPVTRSLTFKSNRRTFGPYGVEEGTPFTFSI-DGGQVVGFKG  136

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLH  583
            R  +Y+D+I    A  ++S+ S  MLH
Sbjct  137  RGDWYLDSI----AFTLSSAPSKSMLH  159



>ref|XP_002450764.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
 gb|EES09752.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
Length=1080

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             EY+ E+ GT+G        V+ S+   TN+  +GP+G   G+PFH +      IVGF GR
Sbjct  1004  EYVKEVSGTYGLCSPHPDVVITSLTLVTNLCSYGPFGQPTGTPFHTRVDKTASIVGFFGR  1063

Query  506   AGFYVDAIGIY  538
             +G Y+DAIG+Y
Sbjct  1064  SGIYLDAIGVY  1074



>gb|KCW69704.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
 gb|KCW69705.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
Length=230

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  + G   P V     V+RS+ F +N R FGP+G   G+PF F  P   +IVGF G
Sbjct  121  DEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGMEHGTPFSF--PSDGRIVGFKG  178

Query  503  RAGFYVDAIGIY  538
            R+G+Y+D+IG +
Sbjct  179  RSGWYLDSIGFH  190



>ref|XP_010471351.1| PREDICTED: jacalin-related lectin 19 [Camelina sativa]
Length=177

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 4/96 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   DEYLIGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  139

Query  503  RAGFYVDAIGIYSA*VITSSLSSLM---LHWNTSMC  601
            R+G+Y+D+IG + +   ++ + + +   +HW T + 
Sbjct  140  RSGWYLDSIGFHLSRPKSTKMVNKLRKKIHWLTRIV  175



>gb|KCW69706.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
Length=226

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  + G   P V     V+RS+ F +N R FGP+G   G+PF F  P   +IVGF G
Sbjct  117  DEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGMEHGTPFSF--PSDGRIVGFKG  174

Query  503  RAGFYVDAIGIY  538
            R+G+Y+D+IG +
Sbjct  175  RSGWYLDSIGFH  186



>gb|EAY93469.1| hypothetical protein OsI_15270 [Oryza sativa Indica Group]
Length=150

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  502
            +++ EI GT G +V    +VLRS+K TT  R +GPYG P  G PF F      +I GF  
Sbjct  75   DFVMEISGTTGMWVSGMRNVLRSLKITTLKRTYGPYGNPEAGIPFSFSVDGSDRITGFFV  134

Query  503  RAGFYVDAIGIY  538
            RAGF  DAIG+Y
Sbjct  135  RAGFITDAIGVY  146



>ref|XP_004960459.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=149

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            A E++ EI GT+GPF    ++V+RS+ F TNV + GP+G    +PF     D  ++VGF 
Sbjct  76   AGEFVKEISGTYGPF--GGHTVVRSLTFVTNVGKHGPFGNPGQTPFSVPVQDDARVVGFF  133

Query  500  GRAGFYVDAIGIY  538
            GR+G  +DA+G+Y
Sbjct  134  GRSGSLLDAVGVY  146



>ref|XP_009391787.1| PREDICTED: agglutinin-like [Musa acuminata subsp. malaccensis]
Length=256

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  + G +G  +   Y V++S+ F TN R +GP+G   G+PF   A  G++IVGF  
Sbjct  186  DEYLACLSGRYG--ICGGYLVIKSLTFATNKRTYGPFGVEDGAPFKLDA-GGQRIVGFFA  242

Query  503  RAGFYVDAIGIYSA  544
            RAG ++DAIG+Y+A
Sbjct  243  RAGQFLDAIGVYTA  256



>emb|CAJ38387.1| jacalin-domain protein [Plantago major]
Length=197

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE LT + G   P V     V+RS+ F +N R FGP+G   GSPF F   +G +IVGF G
Sbjct  92   DEVLTSVSGHCCPVVHGGSPVIRSLTFKSNKRTFGPFGVEEGSPFSFPM-EGGQIVGFKG  150

Query  503  RAGFYVDAIGIY  538
            R G++VDAIG +
Sbjct  151  RNGWFVDAIGFH  162



>ref|XP_011001796.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Populus 
euphratica]
Length=591

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 73/146 (50%), Gaps = 12/146 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GG+ WS+     INQIVI          +G+    I+  D+ +  +   GG + 
Sbjct  451  GPWGGQGGNPWSYITNRGINQIVIN---------VGLNIKSISFRDTTDLDSATFGGNNP  501

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  502  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  559

Query  461  FQAPDGKKIVGFIGRAGFYVDAIGIY  538
                +   +VGF GRAG Y+DAIGI+
Sbjct  560  IPINN-NTVVGFHGRAGHYLDAIGIF  584


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 69/147 (47%), Gaps = 12/147 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GGD WS+R +  I +IV+R         +G   S   +D S       GG  + 
Sbjct  11   GPWGGLGGDHWSYRASGGITEIVLRV--------VGNIKSISFKDASGLVSGTFGGRGND  62

Query  281  -lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPF  457
                     I      EYL  I GT+G +      V+ S+ F TN+  +GP+G  +G  F
Sbjct  63   PNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALGETF  120

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 D   +VGF GR G+Y+DA+GI+
Sbjct  121  SIPIAD-SAVVGFHGRCGYYLDALGIF  146


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT I GT+G +      V+ S+ F TN+   GP+G   G+ F     +G  ++GF G
Sbjct  224  SEHLTSITGTYGNYA--GMVVITSLSFITNLTTHGPFGTATGTSFSIPI-EGSVVIGFHG  280

Query  503  RAGFYVDAIGIY  538
            R G+Y+DA+GI+
Sbjct  281  RGGYYLDALGIF  292


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT I GT+G +      V+ S+ F TN+   GP+G   G+ F     +G  ++GF G
Sbjct  370  SEHLTSITGTYGNYA--GMVVITSLSFITNLTTHGPFGTATGTSFSIPI-EGSVVIGFHG  426

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIGI+
Sbjct  427  RGGHYLDAIGIH  438



>ref|XP_010062570.1| PREDICTED: jacalin-related lectin 19 [Eucalyptus grandis]
Length=279

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  + G   P V     V+RS+ F +N R FGP+G   G+PF F  P   +IVGF G
Sbjct  170  DEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGMEHGTPFSF--PSDGRIVGFKG  227

Query  503  RAGFYVDAIGIY  538
            R+G+Y+D+IG +
Sbjct  228  RSGWYLDSIGFH  239



>ref|XP_006301377.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
 gb|EOA34275.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
Length=177

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 57/95 (60%), Gaps = 4/95 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  + G + P V     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   DEYLIGVSGYYCPLVSSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  139

Query  503  RAGFYVDAIGIYSA*VITSSLSSLM---LHWNTSM  598
            R+G+Y+D+IG + +   ++ + + +   +HW T +
Sbjct  140  RSGWYLDSIGFHLSRPKSTKMVNKLRKKIHWLTRI  174



>emb|CDP17400.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  502
            EYLT I GT+G F  +   V+ S+ F TN + +GP+G P+ G  F    PDG  IVGF G
Sbjct  99   EYLTSITGTYGDF--NGLLVIYSLSFVTNQKAYGPFGSPSSGQAFS-SPPDGNVIVGFHG  155

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R+G+Y+DAIGIY     T+SL
Sbjct  156  RSGWYIDAIGIYVQPAPTTSL  176


 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 74/147 (50%), Gaps = 12/147 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G   G+ WS+ PT+ I +I++          +G     I+  D+   I+   GG D 
Sbjct  177  GPWGGPVGNPWSYIPTDGIKEIIMD---------VGRNIRAISFADANGFISGKFGGKDP  227

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPF  457
                 +  I      EYLT I GTFG F  D   V+ S+ F TN + +GP+G  N G  F
Sbjct  228  NNIGKEEKITIQWPSEYLTSIKGTFGNFNGDV--VIYSLSFITNNKTYGPFGSANSGQAF  285

Query  458  HFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                P G  +VGF G +G+++DA+GIY
Sbjct  286  TASPPAGNVVVGFHGMSGWFIDALGIY  312



>emb|CDO97947.1| unnamed protein product [Coffea canephora]
Length=276

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+LT + G   P V     V+R++ F +N R FGPYG   G+PF     +G +IVGF G
Sbjct  157  DEFLTSVSGFVAPVVHGGSPVIRALTFKSNKRTFGPYGVEEGAPFSLPI-EGGQIVGFKG  215

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R+G+Y+D++G + + V T+ +
Sbjct  216  RSGWYLDSLGCHLSRVQTTRV  236



>ref|XP_002888904.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65163.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=176

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G +   VD    V+RS+ F +N + +GPYG   G+PF F   +G +IVG   
Sbjct  81   DEYLTGVSGYYSIVVDSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMSS  139

Query  503  RAGFYVDAIGIY-SA*VITSSLSSLM--LHWNTSMC  601
            R+G+Y+D+IG + S    T  ++ L+  +HW T + 
Sbjct  140  RSGWYLDSIGFHLSRPKSTKMINKLLKKIHWLTRIV  175



>gb|EEC72970.1| hypothetical protein OsI_06866 [Oryza sativa Indica Group]
Length=1072

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E+L E+ GT GPF   S ++  S+   TNVR +GP+G   G+PF         IVGF GR
Sbjct  999   EFLMEVIGTVGPFNVLSEAI-TSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCIVGFFGR  1057

Query  506   AGFYVDAIGIY  538
             +G Y+DA+G+Y
Sbjct  1058  SGTYLDAVGVY  1068



>dbj|BAD23250.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 dbj|BAD23344.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 gb|EAZ22703.1| hypothetical protein OsJ_06375 [Oryza sativa Japonica Group]
Length=1072

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E+L E+ GT GPF   S ++  S+   TNVR +GP+G   G+PF         IVGF GR
Sbjct  999   EFLMEVIGTVGPFNVLSEAI-TSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCIVGFFGR  1057

Query  506   AGFYVDAIGIY  538
             +G Y+DA+G+Y
Sbjct  1058  SGTYLDAVGVY  1068



>ref|XP_010030903.1| PREDICTED: agglutinin alpha chain-like [Eucalyptus grandis]
Length=105

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYLT     FG +    Y+++RS+ F +N R +GPYG  VG  FHF +  GKKIVGF G 
Sbjct  35   EYLTSFSSHFGSYF--GYTIVRSLTFFSNERTYGPYGEEVGEHFHFPSI-GKKIVGFHGS  91

Query  506  AGFYVDAIGIY  538
            +G ++D++G Y
Sbjct  92   SGVWLDSLGAY  102



>pdb|4MQ0|A Chain A, Crystal Structure Of Parkia Biglobosa Seed Lectin (pbl) 
In Complex With Methyl Alpha D-mannopyranoside
Length=446

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 74/154 (48%), Gaps = 25/154 (16%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPI-------GITFSCINEDDSKEtitv  259
            GP G SGGD WS+     INQI+I +G +  +            TF  +N  D+ E  TV
Sbjct  303  GPWGGSGGDPWSYTANEGINQIIIYAGSNIKSIAFKDTSGLDSATFGGVNPKDTGEKNTV  362

Query  260  ggggtdtlvtrtdtviidddADEYLTEICGTFGPF-VDDSYSVLRSIKFTTNVREFGPYG  436
                                  EYLT I GT+G +   D ++ + S+ FTTN+  +GP+G
Sbjct  363  SIKW----------------PSEYLTSIDGTYGQYKFKDVFTTVTSLSFTTNLATYGPFG  406

Query  437  PNVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                + F     +   +VGF GRAG Y+DAIGI+
Sbjct  407  KASLTSFSIPIHN-NMVVGFHGRAGDYLDAIGIF  439


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 73/147 (50%), Gaps = 11/147 (7%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G SGGD WSF+  + I +I+I    +  +    I+F     D S    T GG     
Sbjct  9    GPWGGSGGDHWSFKANHAITEILIHVKDNIKS----ISFKDAGGDIS---GTFGGKDPRE  61

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                 +  I      EYL  I G++G +  +   V+RS+ F TN+  +GP+G   G    
Sbjct  62   NKKGEEKKIGIRWPTEYLKSISGSYGDY--NGILVIRSLSFITNLTTYGPFGSTSGGE-S  118

Query  461  FQAPDGKKIV-GFIGRAGFYVDAIGIY  538
            F  P    +V GF GRAG+Y+DA+GI+
Sbjct  119  FSIPIADSVVVGFHGRAGYYLDALGIF  145


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT I GT+G +    + VL S+ F TNV + GP+G   G+ F  +  +G  + GF G+
Sbjct  223  EHLTSISGTYGNY--KGFEVLTSLSFITNVTKHGPFGIASGTSFS-RPIEGSLVTGFHGK  279

Query  506  AGFYVDAIGIY  538
             G+Y+D+IGIY
Sbjct  280  GGYYLDSIGIY  290



>gb|EMT07330.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=885

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E + EI GTFGP+     S+++S+   TN+R +GP+G   G+PFH +      IVGF G 
Sbjct  813  ELVLEISGTFGPY-GQFPSIIKSLMLVTNLRTYGPFGQLHGTPFHSRVKKNGTIVGFFGC  871

Query  506  AGFYVDAIGIY  538
            +G ++DAIG+Y
Sbjct  872  SGEFLDAIGVY  882



>gb|AFW60405.1| putative protein kinase superfamily protein [Zea mays]
Length=634

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  226  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  284

Query  506  AGFYVDAIGIYSA  544
            +G Y+ AIG  S 
Sbjct  285  SGQYLYAIGDLSG  297


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  389  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  447

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  448  GRSGRYLNAIGVYTA  462



>ref|XP_008348483.1| PREDICTED: agglutinin-like isoform X1 [Malus domestica]
Length=194

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDS-YS-VLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
            DEY+  + G +   VD   YS ++RS+KF +N R FGP+G + G+PF +   DG KIVG 
Sbjct  89   DEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFGRDQGTPFTYTL-DGGKIVGL  147

Query  497  IGRAGFYVDAIGIY  538
             GR G Y+DAIG +
Sbjct  148  KGRDGLYIDAIGFH  161



>ref|XP_010232948.1| PREDICTED: jacalin-related lectin 19-like [Brachypodium distachyon]
Length=266

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 81/183 (44%), Gaps = 19/183 (10%)
 Frame = +2

Query  8    SNKTCSLSSIPFALKLSSN*ETMAVPIDAV--SGPLGNSGGDFWS--FRPTNKINQIVIR  175
            S   CS  ++P+  K       + V + +V   GP G  GG  W        ++ ++V+R
Sbjct  93   SGSACSAVAMPYHEKAEHERTCVGVRVSSVVAMGPCGGIGGAPWEMDLHGVGRVLKLVVR  152

Query  176  sggsgnnnPIGITFSCINEDDSKEtitvggggtdtlvtrtdtviidddADEYLTEICGTF  355
             G + +   +     C   D  +E  T  GG                  DEYL  + G  
Sbjct  153  HGSAIDAMSV-----CYERDGREEQSTRWGGPGGRRSEICLQ------PDEYLAGVKGHV  201

Query  356  GPFVDDSYSVLRSIKFTTNVRE-FGPYGPNVGSPFHFQAP-DGKKIVGFIGRAGFYVDAI  529
            G +  D+  V+RS+ F TN R  FGPYG   G PF   A   G +I+GF G +G Y+DAI
Sbjct  202  GHY--DNCLVVRSLTFVTNARRSFGPYGKEEGVPFALPAAVAGGRIIGFFGSSGLYLDAI  259

Query  530  GIY  538
            G Y
Sbjct  260  GTY  262



>ref|XP_008348484.1| PREDICTED: agglutinin-like isoform X2 [Malus domestica]
Length=174

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDS-YS-VLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
            DEY+  + G +   VD   YS ++RS+KF +N R FGP+G + G+PF +   DG KIVG 
Sbjct  69   DEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFGRDQGTPFTYTL-DGGKIVGL  127

Query  497  IGRAGFYVDAIGIY  538
             GR G Y+DAIG +
Sbjct  128  KGRDGLYIDAIGFH  141



>gb|KDP40814.1| hypothetical protein JCGZ_24813 [Jatropha curcas]
Length=203

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+L    G + P V     V+RS+   +N R FGPYG   G+PF   + DG  IVGF+G
Sbjct  86   EEFLVSASGHYCPVVYGGSPVIRSLTLKSNRRTFGPYGVEEGTPFTL-SMDGGSIVGFMG  144

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLH  583
            R+G+Y+D+IG +    ++ S S+ +L 
Sbjct  145  RSGWYLDSIGFH----LSRSQSTKLLQ  167



>ref|XP_008656248.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Zea 
mays]
 ref|XP_008656249.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Zea 
mays]
Length=488

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+L  + GT G +     SV+RS+ F TNVR +   G  VG PF  +AP G  IVGF  R
Sbjct  414  EFLVGVSGTTGGYAGLPTSVIRSLTFVTNVRTYRTRGAPVGDPFALEAPAGSCIVGFHAR  473

Query  506  AGFYVDAIGIY  538
            AG ++DA+G+Y
Sbjct  474  AGHFLDALGVY  484



>gb|AFW81812.1| putative protein kinase superfamily protein [Zea mays]
Length=503

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+L  + GT G +     SV+RS+ F TNVR +   G  VG PF  +AP G  IVGF  R
Sbjct  429  EFLVGVSGTTGGYAGLPTSVIRSLTFVTNVRTYRTRGAPVGDPFALEAPAGSCIVGFHAR  488

Query  506  AGFYVDAIGIY  538
            AG ++DA+G+Y
Sbjct  489  AGHFLDALGVY  499



>ref|XP_009608039.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=1307

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG     S+ V++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  54   EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  111

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  112  RCGAYLDAIGVY  123



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG     S+ V++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  85   EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  142

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  143  RCGAYLDAIGVY  154



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG     S+ V++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  101  EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  158

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIG+Y
Sbjct  159  RCGAYLDAIGVY  170



>ref|XP_010232946.1| PREDICTED: uncharacterized protein LOC104583002 [Brachypodium 
distachyon]
Length=250

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+LT + G  G      + V++S+ F +N R +GPYG + G PF   AP G +IVGF G
Sbjct  154  DEHLTCVKGLLGNHAQ--WFVVKSLTFVSNRRTYGPYGEDHGVPFELPAPAGGRIVGFHG  211

Query  503  RAGFYVDAIGIY  538
            R+G  +DAIG Y
Sbjct  212  RSGGLLDAIGTY  223



>gb|KHG23822.1| Agglutinin alpha chain [Gossypium arboreum]
Length=183

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+L  + G + P V     V+RS+ F +N R FGPYG   G+PF F   +G +I GF G
Sbjct  84   EEFLISVTGYYCPVVYGGSPVIRSLTFKSNRRTFGPYGVEEGTPFAFSV-EGARIAGFNG  142

Query  503  RAGFYVDAIG  532
            R+G+YVD+IG
Sbjct  143  RSGWYVDSIG  152



>ref|XP_004297619.2| PREDICTED: agglutinin [Fragaria vesca subsp. vesca]
Length=525

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +2

Query  323  DEYLTEICGTFG--PFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
            DE+L  I G +    ++  +  VLRS+KF +N R FGP+G   G+PF F+  D  +IVGF
Sbjct  301  DEFLVSISGYYCGVTWIVGAPVVLRSLKFESNKRTFGPFGNQFGTPFTFKVKDSDRIVGF  360

Query  497  IGRAGFYVDAIGIYS  541
             GR G Y+DAIG +S
Sbjct  361  KGRKGRYLDAIGFHS  375


 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +2

Query  323  DEYLTEICG--TFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
            +E++  + G  ++ P++  +  V+RS+KF +N R +GP+G  VG+PF F+  DG +IVG 
Sbjct  452  NEFMVTVSGHISWVPWMSGT-RVVRSLKFDSNRRTYGPFGVQVGTPFSFRVKDGDQIVGL  510

Query  497  IGRAGFYVDAIGIYS  541
             GR+G+Y+ AIG Y+
Sbjct  511  RGRSGWYLYAIGFYT  525



>gb|EMS58273.1| hypothetical protein TRIUR3_17900 [Triticum urartu]
Length=304

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E++ E  GTF  +  D+++++ S+KF TN++ +GP+G   G+ F         IVGF 
Sbjct  228  TSEFVKEFSGTFSLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSNIVGFF  287

Query  500  GRAGFYVDAIGIY  538
            GR+G Y+DA+G+Y
Sbjct  288  GRSGIYLDALGVY  300



>ref|XP_004961357.1| PREDICTED: agglutinin-like [Setaria italica]
Length=208

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+LT + G + P       V+RS+ F +N R +GP+G   G+ F F   DG  IVGF G
Sbjct  83   DEHLTGVSGHYSPIAAGGSPVIRSLAFRSNQRAYGPFGVAEGAAFTFPV-DGGVIVGFCG  141

Query  503  RAGFYVDAIGIYSA  544
            R+G+ +DA+G+Y A
Sbjct  142  RSGWQLDAVGLYVA  155



>ref|XP_010654564.1| PREDICTED: jacalin-related lectin 19-like [Vitis vinifera]
Length=198

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E L  + G + P V     V+RS+ F +N R FGP+G   G+PF   + DG +IVGF G
Sbjct  83   EEILISVSGHYCPVVYGGSPVIRSLTFKSNRRTFGPFGVEEGTPFSL-SMDGGRIVGFQG  141

Query  503  RAGFYVDAIGIY  538
            R+G+Y+DAIG +
Sbjct  142  RSGWYLDAIGFH  153



>gb|EMS65594.1| hypothetical protein TRIUR3_06346 [Triticum urartu]
Length=314

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EY+ E+ G++  + D S  VL S+K  TN   +GP+G   G+PF    P+   +VGF GR
Sbjct  239  EYVKELSGSYTMWADFSQIVLTSLKLVTNFNTYGPFGKGAGTPFKADIPENSIVVGFHGR  298

Query  506  AGFYVDAIGIYS  541
            A  +V+AIG+Y+
Sbjct  299  AARFVNAIGVYT  310



>gb|EMT07650.1| Horcolin [Aegilops tauschii]
Length=320

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYLT + G +G F D    V+RS+   +N+R +G YG   G PF   A  G KI+GF  
Sbjct  245  DEYLTSVHGHYGQFKD--TVVIRSLTLVSNLRSYGSYGKEDGVPFALHAGPGGKIIGFHA  302

Query  503  RAGFYVDAIGIY  538
            R+G ++DAIG Y
Sbjct  303  RSGQFLDAIGTY  314



>ref|XP_009622528.1| PREDICTED: agglutinin-like isoform X5 [Nicotiana tomentosiformis]
Length=460

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  315  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  372

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  373  RSGLYLDAIGVY  384


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  329  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  508
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  110  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  167

Query  509  GFYVDAIGIY  538
              Y+DAIG+Y
Sbjct  168  RAYLDAIGVY  177



>ref|XP_009622527.1| PREDICTED: agglutinin-like isoform X4 [Nicotiana tomentosiformis]
Length=490

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  345  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  402

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  403  RSGLYLDAIGVY  414


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  329  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  508
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  140  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  197

Query  509  GFYVDAIGIY  538
              Y+DAIG+Y
Sbjct  198  RAYLDAIGVY  207



>ref|XP_006372325.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
 gb|ERP50122.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
Length=446

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 70/146 (48%), Gaps = 12/146 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GG  WS+     INQIVI          +G     I+  D+    +   GG + 
Sbjct  306  GPWGGRGGSPWSYMTNRGINQIVIH---------VGSNIKSISFRDTTGLDSATFGGENP  356

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  357  NDIGERKTVLINWPSEHLISISGTYGKF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  414

Query  461  FQAPDGKKIVGFIGRAGFYVDAIGIY  538
                +   +VGF GRAG Y+DAIGI+
Sbjct  415  IPI-NNNTVVGFHGRAGHYLDAIGIF  439


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 74/152 (49%), Gaps = 13/152 (9%)
 Frame = +2

Query  89   DAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggg  268
            D   GP G  GGD W +R ++ I  IV+R  G             I+  D++  ++   G
Sbjct  7    DVKLGPWGGLGGDRWCYRASDGITGIVLRVEG---------NIKSISFKDTRGLVSGTFG  57

Query  269  gtdt--lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPN  442
            GT         +  I      EYL  I GT+G +     +V+ S+ FTTN+   GP+G  
Sbjct  58   GTGNDPNDRGEEKKIAIQWPTEYLKSISGTYGRY-KGVLAVITSLSFTTNLTTHGPFGTA  116

Query  443  VGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
             G PF     DG  +VGF GR G+Y+DA+G++
Sbjct  117  PGEPFSIPIADG-VVVGFHGRCGYYLDALGVF  147


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT I GT+G +      V+ S+ F TN+  +GP+G   G+ F     +G  ++GF G
Sbjct  225  SEHLTSITGTYGDYA--GMVVITSLAFQTNLTTYGPFGNATGTSFSIPI-EGSVVIGFHG  281

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIGI+
Sbjct  282  RGGHYLDAIGIH  293



>ref|XP_006663456.1| PREDICTED: disease resistance protein RPM1-like [Oryza brachyantha]
Length=1102

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E++ E+ GT+GPF     SV+ S++  TN+R +GP+G   G+ F  +      IVGF G 
Sbjct  1030  EFVKEVSGTYGPFFSFP-SVITSLQLRTNIRSYGPFGEPKGTTFRTRVKQNGSIVGFFGH  1088

Query  506   AGFYVDAIGIY  538
             +  Y+DAIG+Y
Sbjct  1089  STVYIDAIGVY  1099



>emb|CBI35988.3| unnamed protein product [Vitis vinifera]
Length=210

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E L  + G + P V     V+RS+ F +N R FGP+G   G+PF   + DG +IVGF G
Sbjct  95   EEILISVSGHYCPVVYGGSPVIRSLTFKSNRRTFGPFGVEEGTPFSL-SMDGGRIVGFQG  153

Query  503  RAGFYVDAIGIY  538
            R+G+Y+DAIG +
Sbjct  154  RSGWYLDAIGFH  165



>gb|KJB70346.1| hypothetical protein B456_011G068300 [Gossypium raimondii]
Length=183

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+L  + G + P V     V+RS+ F +N R FGPYG   G+PF F   +G ++ GF G
Sbjct  84   EEFLISVTGYYCPVVYGGSPVIRSLTFKSNRRTFGPYGVEEGTPFAFSV-EGARVAGFNG  142

Query  503  RAGFYVDAIG  532
            R+G+YVD+IG
Sbjct  143  RSGWYVDSIG  152



>ref|XP_009127966.1| PREDICTED: agglutinin [Brassica rapa]
Length=176

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 4/96 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   EEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-NGGRIVGMNG  139

Query  503  RAGFYVDAIGIY-SA*VITSSLSSLM--LHWNTSMC  601
            R+G+Y+D+IG + S    T  +  L   +HW T M 
Sbjct  140  RSGWYLDSIGFHLSRPKSTKVIHKLRKKIHWFTRMV  175



>ref|XP_006663484.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Oryza brachyantha]
Length=1366

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E L E+ GTFG F+    +++ S+ F TN R +GPYG   G+PF         IVGF GR
Sbjct  980   EILVEVSGTFGRFIG-FQNIITSLTFVTNTRSYGPYGQRKGTPFDIPVQGSGCIVGFFGR  1038

Query  506   AGFYVDAIGIY  538
             AG+ VDAIGIY
Sbjct  1039  AGWCVDAIGIY  1049


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = +2

Query  320   ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
             + E++T + GT G +   S  V+ SI   TNV  +GP+G   G PF+F      +IVGF 
Sbjct  1133  SSEFITRVSGTIGSYNTPS-DVVTSITLVTNVGCYGPFGQENGIPFNFPVQGNGRIVGFF  1191

Query  500   GRAGFYVDAIGIY  538
             G A  YVDAIG+Y
Sbjct  1192  GHADLYVDAIGVY  1204


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNV-REFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+L ++ GTFGPF  +  +V+ S+ F TN    +GP+G   G+PF+        IVGF G
Sbjct  1292  EFLVKVLGTFGPF-GEFPNVITSLTFVTNTDHHYGPFGQGGGTPFYGPMSGHGSIVGFFG  1350

Query  503   RAGFYVDAIGIY  538
             R G  ++AIG Y
Sbjct  1351  RKGPCIEAIGFY  1362



>ref|XP_010428208.1| PREDICTED: jacalin-related lectin 19-like isoform X3 [Camelina 
sativa]
Length=177

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   EEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  139

Query  503  RAGFYVDAIGIY-SA*VITSSLSSLM--LHWNTSMC  601
            R+G+Y+D+IG + S    T ++  L   +HW T + 
Sbjct  140  RSGWYLDSIGFHLSRPKSTKTVDKLRKKIHWLTRIV  175



>ref|XP_010428207.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Camelina 
sativa]
Length=218

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  122  EEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  180

Query  503  RAGFYVDAIGIY-SA*VITSSLSSLM--LHWNTSMC  601
            R+G+Y+D+IG + S    T ++  L   +HW T + 
Sbjct  181  RSGWYLDSIGFHLSRPKSTKTVDKLRKKIHWLTRIV  216



>ref|XP_009622526.1| PREDICTED: agglutinin-like isoform X3 [Nicotiana tomentosiformis]
Length=539

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  394  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  451

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  452  RSGLYLDAIGVY  463


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  329  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  508
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  189  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  246

Query  509  GFYVDAIGIY  538
              Y+DAIG+Y
Sbjct  247  RAYLDAIGVY  256


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  341  ICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRAGFYV  520
            I GTFG     SYSV++ + F TN + +GP+G   G+PF     +G  IVGF GR G Y+
Sbjct  10   IKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRCGAYL  67

Query  521  DAIGIY  538
            DAIG+Y
Sbjct  68   DAIGVY  73



>ref|XP_010088386.1| hypothetical protein L484_008121 [Morus notabilis]
 gb|EXB34860.1| hypothetical protein L484_008121 [Morus notabilis]
Length=193

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V     V+RS+   +N R FGPYG   G+PF F    G  IVGF G
Sbjct  84   EEYLVSVSGYYCPVVHGGSPVIRSLTLKSNKRTFGPYGVEEGTPFSFPI-QGGLIVGFKG  142

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLH  583
            R G+Y+DAIG +   +++ + S+ ++ 
Sbjct  143  RNGWYLDAIGFH---IVSHAQSTKLIE  166



>gb|EAY80990.1| hypothetical protein OsI_36172 [Oryza sativa Indica Group]
Length=1081

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E +TE+ GT GPF     SV+ S++  TN+R +GP+G   G+ F  +      IVGF GR
Sbjct  1009  EIVTEVSGTCGPF-SQFPSVVTSLQLVTNLRSYGPFGQAKGTKFRTRVKQNGSIVGFFGR  1067

Query  506   AGFYVDAIGIY  538
             +  Y+DAIG+Y
Sbjct  1068  STIYLDAIGVY  1078



>ref|XP_010428206.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Camelina 
sativa]
Length=224

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  128  EEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  186

Query  503  RAGFYVDAIGIY-SA*VITSSLSSLM--LHWNTSMC  601
            R+G+Y+D+IG + S    T ++  L   +HW T + 
Sbjct  187  RSGWYLDSIGFHLSRPKSTKTVDKLRKKIHWLTRIV  222



>ref|XP_010267066.1| PREDICTED: jacalin-related lectin 19 [Nelumbo nucifera]
Length=205

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+LT + G + P V     V+RS+ F +N   FGP+G   G PF F   DG  I+GF G
Sbjct  83   EEFLTTVSGHYSPVVHGGTPVIRSLTFKSNQGSFGPFGVEEGMPFSFPM-DGGSIIGFWG  141

Query  503  RAGFYVDAIG  532
            R G+Y+DAIG
Sbjct  142  RNGWYLDAIG  151



>ref|XP_010060992.1| PREDICTED: jacalin-related lectin 3 [Eucalyptus grandis]
 gb|KCW67893.1| hypothetical protein EUGRSUZ_F01603 [Eucalyptus grandis]
Length=598

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE LT I GT GP +    +++RSI F TN  + GP+G   G+ F  ++ +G KI+GF G
Sbjct  314  DEVLTHITGTCGPLMSMGPTIIRSIAFHTNRGKHGPFGEERGASFTSKSKEG-KIIGFHG  372

Query  503  RAGFYVDAIGIY  538
            R G ++DAIGI+
Sbjct  373  RGGLFIDAIGIH  384


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+L  + G +G   D    ++RS+ F +N + +GPYG   G  F F +  G KIVGF G
Sbjct  79   DEFLISVHGHYGKINDWGPILVRSLTFESNRKTYGPYGVQQGGSFSFPSTTG-KIVGFHG  137

Query  503  RAGFYVDAIGIY  538
            +AG+Y+DAIG+Y
Sbjct  138  KAGWYLDAIGVY  149


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 16/91 (18%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSY---SVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVG  493
            +E LT I G +GP   D +     +RS+ F T+  ++GP+G  VG+ F     +GK +VG
Sbjct  505  NEVLTCISGYYGPVGKDEWPQPQFIRSLTFHTSRGKYGPFGEEVGTFFTSTTTEGK-VVG  563

Query  494  FIGRAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            F GR+  Y+DAIG++            M HW
Sbjct  564  FHGRSSLYLDAIGVH------------MQHW  582



>ref|XP_009784520.1| PREDICTED: uncharacterized protein LOC104232941, partial [Nicotiana 
sylvestris]
Length=1047

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP-NVGSPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG     S+ V++S+ F TN + +GP+G  + G+PF     +G  IVGF G
Sbjct  94   EYLTGINGTFG--YGGSHLVIKSLCFITNAKSYGPFGSKDGGTPFSLVMKEGVAIVGFHG  151

Query  503  RAGFYVDAIGIY  538
             +G Y+DAIG+Y
Sbjct  152  CSGLYLDAIGVY  163



>ref|NP_001148448.1| jasmonate-induced protein [Zea mays]
 gb|ACG31498.1| jasmonate-induced protein [Zea mays]
Length=184

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  493
             E LTE+ GT G  + D ++V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  108  SEVLTELSGTIG--IVDGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAIVG  165

Query  494  FIGRAGFYVDAIGIY  538
            F  RAG Y+DA+G+Y
Sbjct  166  FFARAGVYLDALGVY  180



>gb|KEH39538.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=196

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V     V+RS+ F +N R FGPYG   G+PF F   DG ++VGF G
Sbjct  93   NEYLISVSGHYYPVVRGGTPVIRSLTFKSNQRTFGPYGVEEGTPFTFSI-DGGQVVGFKG  151

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R  +Y+D+I    +   T SL
Sbjct  152  RGDWYLDSIAFTLSSAPTKSL  172



>gb|KEH39536.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=192

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V     V+RS+ F +N R FGPYG   G+PF F   DG ++VGF G
Sbjct  89   NEYLISVSGHYYPVVRGGTPVIRSLTFKSNQRTFGPYGVEEGTPFTFSI-DGGQVVGFKG  147

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R  +Y+D+I    +   T SL
Sbjct  148  RGDWYLDSIAFTLSSAPTKSL  168



>ref|XP_010231090.1| PREDICTED: jacalin-related lectin 19-like isoform X3 [Brachypodium 
distachyon]
Length=224

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 6/79 (8%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP-----NVGSPFHFQAPDGKKI  487
            DE+LT + G +GP      +V+RS+ F T+   +GP+G         +PF F A DG  I
Sbjct  87   DEHLTAVSGRYGPVAQGGAAVIRSLAFRTDRAAYGPFGAGPTADGGTTPFEF-AVDGGVI  145

Query  488  VGFIGRAGFYVDAIGIYSA  544
            VGF GR+G+ +DA+G+Y A
Sbjct  146  VGFCGRSGWQLDAVGVYLA  164



>gb|KEH39537.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=181

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V     V+RS+ F +N R FGPYG   G+PF F   DG ++VGF G
Sbjct  78   NEYLISVSGHYYPVVRGGTPVIRSLTFKSNQRTFGPYGVEEGTPFTFSI-DGGQVVGFKG  136

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R  +Y+D+I    +   T SL
Sbjct  137  RGDWYLDSIAFTLSSAPTKSL  157



>ref|XP_002893064.1| hypothetical protein ARALYDRAFT_472198 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69323.1| hypothetical protein ARALYDRAFT_472198 [Arabidopsis lyrata subsp. 
lyrata]
Length=1490

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  1198  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQIDEG-KVVGFLGR  1256

Query  506   AGFYVDAIGIYSA*VITSSLSSL  574
              G ++D+IG++   V+   +SSL
Sbjct  1257  EGLFLDSIGVH---VMECKISSL  1276


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             EYL  I GT+G F       +RS+ F +N R++GP+G   G+ F      G KIVGF G+
Sbjct  971   EYLISINGTYGSFDVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSKIVGFHGK  1029

Query  506   AGFYVDAIGIYSA*VITSS--LSSLMLHWNTS  595
             AG+Y+DAIG++   V   +   S ++LH + S
Sbjct  1030  AGWYLDAIGVHIQPVPKENNPSSKILLHSHQS  1061


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  323   DEYLTEICGTFGPFVD-DSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
             +E +T I G +GP  + D Y+V++S+ F T+  ++GPYG   G+ F      G K++GF 
Sbjct  1397  NETITCISGYYGPLNNSDRYNVVKSLSFYTSRGKYGPYGEETGTFFTSTTTQG-KVLGFH  1455

Query  500   GRAGFYVDAIGIY  538
             GR+  ++DAIG++
Sbjct  1456  GRSSSHLDAIGVH  1468



>ref|XP_009338132.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338133.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
Length=764

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  + G +        +++RS+KF +N R FGP+G   G+ F +   +G KIVG  G
Sbjct  664  DEYLVSVTGNYCLLAYGGTAIIRSLKFQSNRRTFGPFGIQEGTTFTYNV-EGGKIVGLKG  722

Query  503  RAGFYVDAIGIY  538
            R G+Y+DAIG +
Sbjct  723  RNGWYIDAIGFH  734



>gb|KFK41744.1| hypothetical protein AALP_AA2G166700 [Arabis alpina]
Length=176

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P +     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   EEYLIGVSGYYCPVIHSGTPVIRSMTFKSNKQVYGPYGIEQGTPFTFSV-NGGRIVGMNG  139

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLH  583
            R+G+Y+D+IG +    ++   S+ M+H
Sbjct  140  RSGWYLDSIGFH----LSRPKSTKMIH  162



>ref|XP_009768586.1| PREDICTED: jacalin-related lectin 3-like [Nicotiana sylvestris]
Length=225

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 10/79 (13%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG--------SPFHFQAPDGK  481
            EYLT I GTFG   D S  V++S+ F TN + +GP+G + G        +PF     +G 
Sbjct  125  EYLTGINGTFGH--DGSDLVIKSLCFITNAKSYGPFGSSYGPFGSMVGGTPFSLVMKEGV  182

Query  482  KIVGFIGRAGFYVDAIGIY  538
             IVGF GR+G Y+DAIG+Y
Sbjct  183  AIVGFHGRSGLYLDAIGVY  201



>ref|XP_009588771.1| PREDICTED: agglutinin-like [Nicotiana tomentosiformis]
Length=345

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  502
            EYLT I GT G     S+ V++S+ F TN + +GP+G    G+PF     +G  IVGF G
Sbjct  84   EYLTGIKGTLGHH--GSHLVVKSLSFITNAKNYGPFGTEGGGTPFSLVMKEGGAIVGFHG  141

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  142  RSGLYLDAIGVY  153


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDS-YSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E L  I G + P  D+     +R I F TN  ++GPYG  +G+ F   A  G KIVGF G
Sbjct  271  EILVGIEGFYSPVDDNGGLDTIRQIAFYTNKGKYGPYGTEIGTYFSSSAARG-KIVGFHG  329

Query  503  RAGFYVDAIGIY  538
            ++G +++AIG++
Sbjct  330  KSGVFLNAIGVH  341



>ref|XP_007024409.1| Mannose-binding lectin superfamily protein [Theobroma cacao]
 gb|EOY27031.1| Mannose-binding lectin superfamily protein [Theobroma cacao]
Length=298

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+L  + G + P V     V+RS+ F +N R FGPYG   G+PF F   +G +I GF G
Sbjct  195  EEFLISVSGHYCPVVHGGGPVIRSLTFKSNQRTFGPYGVEEGTPFTFSM-EGGRIAGFNG  253

Query  503  RAGFYVDAIG  532
            R+G+Y+D+IG
Sbjct  254  RSGWYLDSIG  263



>ref|XP_010231089.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Brachypodium 
distachyon]
Length=225

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 6/79 (8%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP-----NVGSPFHFQAPDGKKI  487
            DE+LT + G +GP      +V+RS+ F T+   +GP+G         +PF F A DG  I
Sbjct  88   DEHLTAVSGRYGPVAQGGAAVIRSLAFRTDRAAYGPFGAGPTADGGTTPFEF-AVDGGVI  146

Query  488  VGFIGRAGFYVDAIGIYSA  544
            VGF GR+G+ +DA+G+Y A
Sbjct  147  VGFCGRSGWQLDAVGVYLA  165



>gb|AFW82809.1| hypothetical protein ZEAMMB73_630227 [Zea mays]
Length=195

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E++ E+ GT+G F  +  + L S++F T+ R +GP+G   G+ F   AP G  +VGF G
Sbjct  121  NEHIREVSGTYGTF--EGATTLTSLRFITSTRAWGPWGTENGTRFCITAPIGSSVVGFYG  178

Query  503  RAGF-YVDAIGIY  538
            RAG   VDAIG+Y
Sbjct  179  RAGTRLVDAIGVY  191



>ref|NP_001185041.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|F4HQX1.1|JAL3_ARATH RecName: Full=Jacalin-related lectin 3; AltName: Full=Mannose-binding 
lectin superfamily protein [Arabidopsis thaliana]
 gb|AEE29890.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=601

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  310  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQMDEG-KVVGFLGR  368

Query  506  AGFYVDAIGIYSA*VITSSLSSL  574
             G ++D+IG++   V+   +SSL
Sbjct  369  EGLFLDSIGVH---VMECKISSL  388


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F       +RS+ F +N R++GP+G + G+ F      G KI+GF G+
Sbjct  83   EYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIGFHGK  141

Query  506  AGFYVDAIGIYSA*VITSS--LSSLMLHWNTS  595
            AG+Y+DAIG+++  +   +   S ++LH + S
Sbjct  142  AGWYLDAIGVHTQPIPKENNPSSKILLHSHQS  173


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVD-DSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            DE +T I G +GP  + D Y+V++S+ F T+   +GPYG   G+ F      G K++GF 
Sbjct  509  DESITCISGYYGPLNNSDRYNVVKSLSFYTSRGRYGPYGEETGTFFTSTTTQG-KVLGFH  567

Query  500  GRAGFYVDAIGIY  538
            GR+ F++DAIG++
Sbjct  568  GRSSFHLDAIGVH  580



>gb|EMT18893.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=809

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E L E+ GT G +     +V+ S+   T+ R +GP+G   G PF  +A     I+GF GR
Sbjct  736  EILKEVSGTVGSY-GALTNVITSLTLVTSARTYGPFGKGDGIPFSMEAASNSSIIGFFGR  794

Query  506  AGFYVDAIGIYS  541
            +G+Y+DAIG+Y+
Sbjct  795  SGWYLDAIGVYT  806



>ref|XP_011015046.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
 ref|XP_011015047.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 70/146 (48%), Gaps = 12/146 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GG  WS+     INQIVI          +G     I+  D+    +   GG + 
Sbjct  305  GPWGGRGGSPWSYITNRGINQIVIH---------VGSNIKSISFRDTTGLDSATFGGENP  355

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  356  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  413

Query  461  FQAPDGKKIVGFIGRAGFYVDAIGIY  538
                +   +VGF GRAG Y+DAIGI+
Sbjct  414  IPI-NNNTVVGFHGRAGHYLDAIGIF  438


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT I GT+G +      V+ S+ F TN+  +GP+G   G+ F     +G  + GF G
Sbjct  224  SEHLTSITGTYGDYA--GMVVITSLAFQTNLTTYGPFGNATGTSFSIPI-EGSVVTGFHG  280

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIGI+
Sbjct  281  RGGHYLDAIGIH  292


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 63/153 (41%), Gaps = 24/153 (16%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnP-------IGITFSCINEDDSKEtitv  259
            GP G  GGD WS+R +  I +IV+R  G+  +         +  TF     D +      
Sbjct  11   GPWGGLGGDRWSYRASGGITEIVLRVEGNIKSISFKDASGLVSGTFGGTGNDPNDRGKEK  70

Query  260  ggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP  439
                                  E+L  I GT G        V+ S+ F TN+  +GP+G 
Sbjct  71   KIAIQW--------------PSEHLKSISGTCGRC--KGLLVITSLSFITNLTTYGPFGT  114

Query  440  NVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 F     D   +VGF GR G+Y+DA+GI+
Sbjct  115  AARETFSIPIAD-STVVGFHGRCGYYLDALGIF  146



>ref|NP_001117315.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 gb|AAG12566.1|AC007797_26 Unknown protein [Arabidopsis thaliana]
 gb|AEE29889.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=571

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  280  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQMDEG-KVVGFLGR  338

Query  506  AGFYVDAIGIYSA*VITSSLSSL  574
             G ++D+IG++   V+   +SSL
Sbjct  339  EGLFLDSIGVH---VMECKISSL  358


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F       +RS+ F +N R++GP+G + G+ F      G KI+GF G+
Sbjct  53   EYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIGFHGK  111

Query  506  AGFYVDAIGIYSA*VITSS--LSSLMLHWNTS  595
            AG+Y+DAIG+++  +   +   S ++LH + S
Sbjct  112  AGWYLDAIGVHTQPIPKENNPSSKILLHSHQS  143


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 14/89 (16%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVD-DSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            DE +T I G +GP  + D Y+V++S+ F T+   +GPYG   G+ F      G K++GF 
Sbjct  479  DESITCISGYYGPLNNSDRYNVVKSLSFYTSRGRYGPYGEETGTFFTSTTTQG-KVLGFH  537

Query  500  GRAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            GR+ F++DAIG++            M HW
Sbjct  538  GRSSFHLDAIGVH------------MQHW  554



>ref|XP_004964114.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=118

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E++ EI  TFG F  D   V+ S+KF TNVR FGP+   +G+PF         IVGF  
Sbjct  45   SEFVKEISRTFGTF--DGAIVVTSLKFVTNVRTFGPWSRGIGTPFSVPVQSRSGIVGFFA  102

Query  503  RAGFYVDAIGIY  538
              G Y+DAIG++
Sbjct  103  HVGKYLDAIGVH  114



>ref|NP_849691.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 gb|AAL32575.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL91614.1| At1g19720/F14P1_33 [Arabidopsis thaliana]
 gb|AAN15429.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE29888.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=595

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  304  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQMDEG-KVVGFLGR  362

Query  506  AGFYVDAIGIYSA*VITSSLSSL  574
             G ++D+IG++   V+   +SSL
Sbjct  363  EGLFLDSIGVH---VMECKISSL  382


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F       +RS+ F +N R++GP+G + G+ F      G KI+GF G+
Sbjct  77   EYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIGFHGK  135

Query  506  AGFYVDAIGIYSA*VITSS--LSSLMLHWNTS  595
            AG+Y+DAIG+++  +   +   S ++LH + S
Sbjct  136  AGWYLDAIGVHTQPIPKENNPSSKILLHSHQS  167


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVD-DSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            DE +T I G +GP  + D Y+V++S+ F T+   +GPYG   G+ F      G K++GF 
Sbjct  503  DESITCISGYYGPLNNSDRYNVVKSLSFYTSRGRYGPYGEETGTFFTSTTTQG-KVLGFH  561

Query  500  GRAGFYVDAIGIY  538
            GR+ F++DAIG++
Sbjct  562  GRSSFHLDAIGVH  574



>ref|XP_004984089.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=151

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            A EY+TE+ GT GP + D+   + S+KF TN   +GP+G   G+PF+    D   +V   
Sbjct  77   ASEYVTEVAGTIGP-IGDAPHTISSLKFVTNRATYGPFGRGAGTPFNVPL-DNASVVAMF  134

Query  500  GRAGFYVDAIGIY  538
             RAG Y+DAIG Y
Sbjct  135  ARAGDYLDAIGFY  147



>ref|XP_010231088.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Brachypodium 
distachyon]
Length=259

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 6/79 (8%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPY--GPNVG---SPFHFQAPDGKKI  487
            DE+LT + G +GP      +V+RS+ F T+   +GP+  GP      +PF F A DG  I
Sbjct  122  DEHLTAVSGRYGPVAQGGAAVIRSLAFRTDRAAYGPFGAGPTADGGTTPFEF-AVDGGVI  180

Query  488  VGFIGRAGFYVDAIGIYSA  544
            VGF GR+G+ +DA+G+Y A
Sbjct  181  VGFCGRSGWQLDAVGVYLA  199



>ref|XP_011015045.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Populus 
euphratica]
Length=591

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 70/146 (48%), Gaps = 12/146 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GG  WS+     INQIVI          +G     I+  D+    +   GG + 
Sbjct  451  GPWGGRGGSPWSYITNRGINQIVIH---------VGSNIKSISFRDTTGLDSATFGGENP  501

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  502  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  559

Query  461  FQAPDGKKIVGFIGRAGFYVDAIGIY  538
                +   +VGF GRAG Y+DAIGI+
Sbjct  560  IPINN-NTVVGFHGRAGHYLDAIGIF  584


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT I GT+G +      V+ S+ F TN+  +GP+G   G+ F     +G  + GF G
Sbjct  224  SEHLTSITGTYGDYA--GMVVITSLAFQTNLTTYGPFGNATGTSFSIPI-EGSVVTGFHG  280

Query  503  RAGFYVDAIGIY  538
            R G+Y+DA+GI+
Sbjct  281  RGGYYLDALGIF  292


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E+LT I GT+G +      V+ S+ F TN+  +GP+G   G+ F     +G  + GF G
Sbjct  370  SEHLTSITGTYGDYA--GMVVITSLAFQTNLTTYGPFGNATGTSFSIPI-EGSVVTGFHG  426

Query  503  RAGFYVDAIGIY  538
            R G Y+DAIGI+
Sbjct  427  RGGHYLDAIGIH  438


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 63/153 (41%), Gaps = 24/153 (16%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnP-------IGITFSCINEDDSKEtitv  259
            GP G  GGD WS+R +  I +IV+R  G+  +         +  TF     D +      
Sbjct  11   GPWGGLGGDRWSYRASGGITEIVLRVEGNIKSISFKDASGLVSGTFGGTGNDPNDRGKEK  70

Query  260  ggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP  439
                                  E+L  I GT G        V+ S+ F TN+  +GP+G 
Sbjct  71   KIAIQW--------------PSEHLKSISGTCGRC--KGLLVITSLSFITNLTTYGPFGT  114

Query  440  NVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
                 F     D   +VGF GR G+Y+DA+GI+
Sbjct  115  AARETFSIPIAD-STVVGFHGRCGYYLDALGIF  146



>tpg|DAA60181.1| TPA: hypothetical protein ZEAMMB73_326702 [Zea mays]
Length=297

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVGF  496
            E LTE+ GT G    D ++V+ SIKF T+++ +GP+G       +PF      G  IVGF
Sbjct  171  EVLTELSGTIGNV--DGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAIVGF  228

Query  497  IGRAGFYVDAIGIYSA*VITSSLSSLMLHWNT  592
              RAG Y+DA+G+Y A ++   +S +   ++T
Sbjct  229  FARAGVYLDALGVYDANILDVFVSRVRQTFDT  260



>ref|XP_002893063.1| jacalin lectin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69322.1| jacalin lectin family protein [Arabidopsis lyrata subsp. lyrata]
Length=596

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  304  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQIDEG-KVVGFLGR  362

Query  506  AGFYVDAIGIYSA*VITSSLSSL  574
             G ++D+IG++   V+   +SSL
Sbjct  363  EGLFLDSIGVH---VMECKISSL  382


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  I GT+G F       +RS+ F +N R++GP+G   G+ F      G KIVGF G+
Sbjct  77   EYLISINGTYGSFDVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSKIVGFHGK  135

Query  506  AGFYVDAIGIYSA*VITSS--LSSLMLHWNTS  595
            AG+Y+DAIG++   V   +   S ++LH + S
Sbjct  136  AGWYLDAIGVHIQPVPKENNPSSKILLHSHQS  167



>ref|XP_009400545.1| PREDICTED: agglutinin alpha chain [Musa acuminata subsp. malaccensis]
Length=200

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYLT I G + P       V+RS+ F +N R FGP+G   G PF     +G  IVGF G
Sbjct  82   EEYLTTISGHYCPMAYGGSPVIRSLTFKSNQRTFGPFGVQDGIPFTLPM-EGGMIVGFSG  140

Query  503  RAGFYVDAIG  532
            R G+Y+DAIG
Sbjct  141  RCGWYLDAIG  150



>ref|XP_004986922.1| PREDICTED: horcolin-like [Setaria italica]
Length=132

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LTE+ GTF          + S+ F TN+R+ GP+G   G+PF     DG +IV   GR
Sbjct  55   EFLTEVSGTFAYIGTQPTDAVTSLTFVTNLRKHGPFGDVDGTPFSVPVRDGGRIVALFGR  114

Query  506  AGFYVDAIGIY  538
               Y+DAIG+Y
Sbjct  115  GWDYIDAIGVY  125



>ref|XP_003597652.1| Agglutinin alpha chain [Medicago truncatula]
Length=761

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V     V+RS+ F +N R FGPYG   G+PF F + DG ++VGF G
Sbjct  658  NEYLISVSGHYYPVVRGGTPVIRSLTFKSNQRTFGPYGVEEGTPFTF-SIDGGQVVGFKG  716

Query  503  RAGFYVDAIGIYSA*VITSSL  565
            R  +Y+D+I    +   T SL
Sbjct  717  RGDWYLDSIAFTLSSAPTKSL  737



>ref|XP_003577374.2| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Brachypodium 
distachyon]
Length=588

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GP+      V++S+ F T    +GP+G   G+PF         IVGF  R
Sbjct  191  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  250

Query  506  AGFYVDAIGIY  538
            AG+Y+DA GIY
Sbjct  251  AGWYLDAFGIY  261


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVL-RSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
            + E+LT + GT GPF   S  V+  S+   TN   +GP+G   G+ F         IVGF
Sbjct  344  SSEFLTGVRGTTGPFDPASSDVIVTSLTLITNTHSYGPFGQGRGTSFQIPLWGKGSIVGF  403

Query  497  IGRAGFYVDAIGIY  538
             G +  Y++AIG+Y
Sbjct  404  FGCSESYINAIGVY  417



>emb|CAE76026.1| B1292H11.12 [Oryza sativa Japonica Group]
 gb|EAZ29534.1| hypothetical protein OsJ_13607 [Oryza sativa Japonica Group]
Length=183

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNV-REFGPYG----PNVGSPFHFQAPDGKK  484
            ADE +T + GT G F D    V+ S+ F TN  + +GPYG       G+PF     +G  
Sbjct  102  ADEQVTSVEGTIGRFRDVDEPVITSLTFRTNAGKTYGPYGGASDKQAGTPFSIPVDNGGV  161

Query  485  IVGFIGRAGFYVDAIGIY  538
            +VGF GRAG+ +DAIG+Y
Sbjct  162  VVGFWGRAGWLIDAIGVY  179



>ref|XP_004291831.1| PREDICTED: jacalin-related lectin 3 [Fragaria vesca subsp. vesca]
Length=642

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E LT I GTFGP +    +V++S+ F T  ++ GPYG   G+ F  Q  +G KIVG  G
Sbjct  317  NEILTHITGTFGPVMGMGPNVIKSMSFHTTKKKHGPYGEEQGTQFSTQLREG-KIVGIHG  375

Query  503  RAGFYVDAIGIYS  541
            R G ++DAIG+++
Sbjct  376  RTGLFLDAIGVHA  388


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E+LT   G +G   +     LRSI F +N R +GP+G   G+ F      G KIVGF G
Sbjct  80   EEFLTSFHGYYGKISEWGTVSLRSITFKSNKRSYGPFGMEQGTYFSLPVTTGNKIVGFHG  139

Query  503  RAGFYVDAIGIY  538
            ++G+YVDAIG +
Sbjct  140  KSGWYVDAIGAH  151



>ref|XP_006473572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X2 [Citrus sinensis]
Length=1252

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+LT + G +G   D     +RS+ F +N + +GP+G   G+ F F    G KIVGF G
Sbjct  712  DEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSFPMTGG-KIVGFHG  770

Query  503  RAGFYVDAIGIYSA*VI--TSSLSSLMLH  583
            R G+Y+DAIGIY   V+   SS +  ML 
Sbjct  771  RCGWYLDAIGIYLKSVVKKVSSNTKAMLQ  799


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT+I GT+GP +    +++RS+ F T   + GP+G   G  F  +  +G KIVGF GR
Sbjct  966   EILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  1024

Query  506   AGFYVDAIGIY  538
              G ++DAIG+Y
Sbjct  1025  DGLFLDAIGVY  1035


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E LT I G +GP   D+   V+RS+ F T+  ++GP+G  VG+ F     +G K+VGF G
Sbjct  1162  EVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGEEVGTFFTSTTTEG-KVVGFHG  1220

Query  503   RAGFYVDAIGIY  538
             R+ FY+DAIG++
Sbjct  1221  RSSFYLDAIGVH  1232



>ref|XP_010237569.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Brachypodium 
distachyon]
Length=690

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + GT GP+      V++S+ F T    +GP+G   G+PF         IVGF  R
Sbjct  293  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  352

Query  506  AGFYVDAIGIY  538
            AG+Y+DA GIY
Sbjct  353  AGWYLDAFGIY  363


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVL-RSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
            + E+LT + GT GPF   S  V+  S+   TN   +GP+G   G+ F         IVGF
Sbjct  446  SSEFLTGVRGTTGPFDPASSDVIVTSLTLITNTHSYGPFGQGRGTSFQIPLWGKGSIVGF  505

Query  497  IGRAGFYVDAIGIY  538
             G +  Y++AIG+Y
Sbjct  506  FGCSESYINAIGVY  519



>ref|XP_010477196.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X3 [Camelina sativa]
Length=1240

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT + GT+GP V    +V++S+ F TN  + GP+G   G  F  +  +G K+VGF+GR
Sbjct  950   EVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-KVVGFLGR  1008

Query  506   AGFYVDAIGIYSA*VITSSLSSL  574
              G ++DAIG++   V+   +SSL
Sbjct  1009  EGLFLDAIGVH---VMECKISSL  1028


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F     + +RS+   +N R++GP+G   G+ F      G KI+GF G+
Sbjct  723  EYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKSGSKIIGFHGK  781

Query  506  AGFYVDAIGIY  538
            AG+Y+DAIG++
Sbjct  782  AGWYIDAIGVH  792


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +2

Query  323   DEYLTEICGTFGPFVD-DSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
             +E LT I G +GP  + D  +V++S+ F T+  ++GPYG   G+ F      G K++GF 
Sbjct  1148  NETLTCISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEECGTFFTSTTTHG-KVLGFH  1206

Query  500   GRAGFYVDAIGIY  538
             GR G  +DAIG++
Sbjct  1207  GRCGCNLDAIGVH  1219



>ref|XP_002461768.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
 gb|EER98289.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
Length=361

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E +TE+ GT G F D++  V+ SIKF TN++ +GP+G    +PF      G  IVGF  
Sbjct  232  SEVVTEVSGTVGNFYDNT--VITSIKFVTNLQTYGPWGDGQDAPFTIPVQPGSGIVGFFA  289

Query  503  RAGFYVDAIGIYS  541
            RAG  +DAIG+Y+
Sbjct  290  RAGDCLDAIGVYA  302



>emb|CDY48032.1| BnaA02g16250D [Brassica napus]
Length=230

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G   P V     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  135  EEYLIGVSGYCCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-NGGRIVGMNG  193

Query  503  RAGFYVDAIGIY-SA*VITSSLSSL--MLHWNTSM  598
            R+G+Y+D+IG + S    T  +  L   +HW T M
Sbjct  194  RSGWYLDSIGFHLSRPKSTKVIHKLRKKIHWLTRM  228



>ref|XP_008244775.1| PREDICTED: LOW QUALITY PROTEIN: agglutinin-like [Prunus mume]
Length=343

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            DE+L  + G + P +      ++RS+KF +N R FGPYG   G+PF F   DG KIVG  
Sbjct  245  DEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGKIVGLK  303

Query  500  GRAGFYVDAIGIY  538
            GR+G+Y+DAIG +
Sbjct  304  GRSGWYLDAIGFH  316


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            DEYL    G + P +      ++RS+KF +N R FGPYG   G+PF F   DG +IVG  
Sbjct  89   DEYLVGASGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGQIVGLK  147

Query  500  GRAGFYVDAIGIY  538
            GR G+Y++AIG +
Sbjct  148  GRDGWYLNAIGFH  160



>gb|KJB58185.1| hypothetical protein B456_009G198200 [Gossypium raimondii]
Length=1244

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +2

Query  323   DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             DE+LT I G +G        ++RS+ F +N + +GP+G   G+ F     +  KIVGF G
Sbjct  990   DEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIEQGTSFSM---NKGKIVGFRG  1046

Query  503   RAGFYVDAIGIYSA*VITSSLSSLMLH  583
             R+G+Y+DAIG+YS  V+  + S  ++H
Sbjct  1047  RSGWYLDAIGVYSKPVLKLNPSKPIVH  1073



>gb|KJB58186.1| hypothetical protein B456_009G198200 [Gossypium raimondii]
Length=1512

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +2

Query  323   DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             DE+LT I G +G        ++RS+ F +N + +GP+G   G+ F     +  KIVGF G
Sbjct  990   DEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIEQGTSFSM---NKGKIVGFRG  1046

Query  503   RAGFYVDAIGIYSA*VITSSLSSLMLH  583
             R+G+Y+DAIG+YS  V+  + S  ++H
Sbjct  1047  RSGWYLDAIGVYSKPVLKLNPSKPIVH  1073


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT I GTF P +    +V+RS+ F TN  + GPYG   G  F  +  +G KIVGF+GR
Sbjct  1226  EILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDEQGPSFTNKMNEG-KIVGFLGR  1284

Query  506   AGFYVDAIGIY  538
              G ++DA+G++
Sbjct  1285  EGLFLDAVGVH  1295


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYS-VLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E L  I G +G   ++  S V+RS+ F T+  ++GP+G  VG+ F      GK +VGF G
Sbjct  1422  EVLICISGYYGSINEEEKSKVIRSLTFYTSRGKYGPFGEEVGTYFTSTTTQGK-VVGFHG  1480

Query  503   RAGFYVDAIGIY  538
             R   Y+DAIG++
Sbjct  1481  RCSSYLDAIGVH  1492



>ref|XP_004979669.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Setaria 
italica]
Length=844

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + G+ G F +   +V+ S+ F TNVR +GP+G   G  FH        IVGF GR
Sbjct  616  EFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFFGR  674

Query  506  AGFYVDAIGIYS  541
            AG Y+DAIG+Y+
Sbjct  675  AGRYLDAIGVYT  686


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+L  + G+ G F +    V+ S+ F TN R +GP+G   G PFH Q      IVGF G 
Sbjct  402  EFLIGVSGSIGSF-NGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFFGH  460

Query  506  AGFYVDAIGIYS  541
            +  Y++AIG Y+
Sbjct  461  SRRYLEAIGFYT  472



>ref|XP_004979670.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Setaria 
italica]
Length=823

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + G+ G F +   +V+ S+ F TNVR +GP+G   G  FH        IVGF GR
Sbjct  595  EFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFFGR  653

Query  506  AGFYVDAIGIYS  541
            AG Y+DAIG+Y+
Sbjct  654  AGRYLDAIGVYT  665


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+L  + G+ G F +    V+ S+ F TN R +GP+G   G PFH Q      IVGF G 
Sbjct  402  EFLIGVSGSIGSF-NGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFFGH  460

Query  506  AGFYVDAIGIYS  541
            +  Y++AIG Y+
Sbjct  461  SRRYLEAIGFYT  472



>ref|XP_010498396.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Camelina sativa]
Length=1235

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT + GT+GP V    +V++S+ F TN  + GP+G   G  F  +  +G K+VGF+GR
Sbjct  945   EVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-KVVGFLGR  1003

Query  506   AGFYVDAIGIYSA*VITSSLSSL  574
              G ++DAIG++   V+   +SSL
Sbjct  1004  EGLFLDAIGVH---VMECKISSL  1023


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 76/172 (44%), Gaps = 12/172 (7%)
 Frame = +2

Query  23   SLSSIPFALKLSSN*ETMAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnP  202
            +L+SI  A  L  N +    P  A  GP G   G  W       + QI+I          
Sbjct  628  TLASIILAHGLMGNIDEGKKP--ASVGPWGGQSGHAWDDGMYTTVRQIIIGH--------  677

Query  203  IGITFSCINEDDSKEtitvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYS  382
             G +   I  +  K   +V          +    +  D   EYL  + GT+G F     +
Sbjct  678  -GSSIDSIQVEYEKNGSSVWSEKRGGKGGKKIDNVKLDYPHEYLISVNGTYGSFDAWGNT  736

Query  383  VLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRAGFYVDAIGIY  538
             +RS+   +N R++GP+G   G+ F      G KI+GF G+AG+Y+DAIG++
Sbjct  737  CVRSLTLESNHRKYGPFGCESGTFFAL-PKSGSKIIGFHGKAGWYIDAIGVH  787



>ref|XP_011074623.1| PREDICTED: jacalin-related lectin 3 [Sesamum indicum]
Length=670

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+L  + G +G   +  + ++RS+ F +N R++GP+G   G+ F      G KIVGF+G
Sbjct  79   DEFLISVHGYYGSLQERGHVIIRSLTFESNKRKYGPFGVEKGTYFTSSTTHG-KIVGFVG  137

Query  503  RAGFYVDAIGIY  538
            +AG+Y+DAIG Y
Sbjct  138  KAGWYLDAIGFY  149


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (55%), Gaps = 14/88 (16%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDS-YSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E LT + G +GP   +    V++S+ F T+ R +GP+G  +G+ F     +GK +VGF G
Sbjct  579  EVLTCVSGYYGPIKKEQGTKVIQSLTFHTSRRTYGPFGQELGTYFASGTTEGK-VVGFHG  637

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            R+  Y+DAIG++            M HW
Sbjct  638  RSSMYLDAIGVH------------MQHW  653


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + G   P +     V++S+ F T   ++GPYG   G  F  +  +G  +VGF GR
Sbjct  324  EILTHLTGYHAPTMIMGPDVIKSLTFHTTKGKYGPYGEEQGEFFSTKLKEGSMVVGFHGR  383

Query  506  AGFYVDAIGIY  538
             G +VDA+G++
Sbjct  384  KGLFVDAVGVH  394



>ref|XP_004979671.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Setaria 
italica]
Length=793

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LT + G+ G F +   +V+ S+ F TNVR +GP+G   G  FH        IVGF GR
Sbjct  565  EFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFFGR  623

Query  506  AGFYVDAIGIYS  541
            AG Y+DAIG+Y+
Sbjct  624  AGRYLDAIGVYT  635


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+L  + G+ G F +    V+ S+ F TN R +GP+G   G PFH Q      IVGF G 
Sbjct  351  EFLIGVSGSIGSF-NGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFFGH  409

Query  506  AGFYVDAIGIYS  541
            +  Y++AIG Y+
Sbjct  410  SRRYLEAIGFYT  421



>gb|EMS53468.1| hypothetical protein TRIUR3_21407 [Triticum urartu]
Length=135

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+ T + G +G F  D   V+RS+ F +N R FGPYG   G PF   A  G KI+GF  
Sbjct  54   DEHFTGVVGHYGEF--DGSFVVRSLTFVSNARSFGPYGQEDGVPFALPAAGG-KILGFHA  110

Query  503  RAGFYVDAIGIY  538
            R+G  +DA+G Y
Sbjct  111  RSGRRLDALGTY  122



>ref|XP_002510454.1| hypothetical protein RCOM_1595950 [Ricinus communis]
 gb|EEF52641.1| hypothetical protein RCOM_1595950 [Ricinus communis]
Length=540

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E LT ICG +G F  +DS SV++S+ F TN  ++GP+G  VG+ F     +G KIVGF G
Sbjct  447  ETLTSICGYYGSFTGEDSNSVIKSLTFYTNKGKYGPFGEEVGTFFTSSNTEG-KIVGFHG  505

Query  503  RAGFYVDAIGIY  538
            R+G Y++AIG++
Sbjct  506  RSGCYLNAIGVH  517


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVL-RSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            DEYL  + G +G  V+    VL RS+ F TN R++GP+G   G+ F F    G+ +VGF 
Sbjct  83   DEYLVSVSGHYGSVVEYYGPVLVRSLMFQTNRRKYGPFGIQQGTQFSFPLTGGQ-VVGFH  141

Query  500  GRAGFYVDAIGIY  538
            GR+ +Y+D+IG+Y
Sbjct  142  GRSSWYLDSIGVY  154


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + G +G  +    +V++S+ F TN R++GP+G   G  F    P+   +VGF GR
Sbjct  277  EILTHVTGYYGSTILRGPTVVKSLTFHTNKRKYGPFGDEQGISFS-SGPNNGIVVGFHGR  335

Query  506  AGFYVDAIGIYSA  544
             G+++D+IG++ A
Sbjct  336  KGWFIDSIGVHVA  348



>ref|XP_009608047.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104102120 
[Nicotiana tomentosiformis]
Length=1799

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  502
            EYL  I GTFG +    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  67   EYLKGINGTFGCYY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  124

Query  503  RAGFYVDAIGIY  538
            R+  Y++AIG+Y
Sbjct  125  RSELYLNAIGVY  136



>gb|KDO84683.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=528

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+LT + G +G   D     +RS+ F +N + +GP+G   G+ F F    G KIVGF G
Sbjct  79   DEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSFPMTGG-KIVGFHG  137

Query  503  RAGFYVDAIGIYSA*VI--TSSLSSLMLH  583
            R G+Y+DAIGIY   V+   SS +  ML 
Sbjct  138  RCGWYLDAIGIYLKSVVKKVSSNTKAMLQ  166


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT+I GT+GP +    +++RS+ F T   + GP+G   G  F  +  +G KIVGF GR
Sbjct  333  EILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  391

Query  506  AGFYVDAIGIY  538
             G ++DAIG+Y
Sbjct  392  DGLFLDAIGVY  402



>gb|ABA94728.1| Jacalin-like lectin domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ12138.1| hypothetical protein OsJ_02021 [Oryza sativa Japonica Group]
Length=837

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            + E+L  + GT GPF   S  V+ S+ F TNVR +GP+G   G+PF        KIVGF 
Sbjct  762  SSEFLVRVFGTIGPF-RASRCVVTSVTFVTNVRSYGPFGQGGGTPFDVPMQSNGKIVGFF  820

Query  500  GRAGFYVDAIGIY  538
            G A  YV+A+G+Y
Sbjct  821  GHARSYVEALGVY  833


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+L E+ GT G F +   +V+ S+   TN   +G +G   G PF         IVGF  R
Sbjct  444  EFLLEVSGTIGRFANSRSNVITSLTLVTNEDRYGHFGTERGDPFCTTLQTNCSIVGFFAR  503

Query  506  AGFYVDAIGIY  538
            A  Y+ AIG+Y
Sbjct  504  ASRYMHAIGVY  514



>ref|XP_006838705.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
 gb|ERN01274.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
Length=610

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E LT + G +GP      +++RS+ F TN++++GP+G   G+ F F    G K+VGF G
Sbjct  80   EEVLTWLSGHYGPMSSGCPTIIRSLTFQTNLKKYGPFGVQQGTHFSFTMSGG-KVVGFHG  138

Query  503  RAGFYVDAIGIY  538
            R+G+++D+IG++
Sbjct  139  RSGWHLDSIGLH  150


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT I G +G        V++S+ F T   ++GPYG   G  F  Q+  G +IVGF GR
Sbjct  321  EILTYITGNYGAAFLMGPMVIKSLTFHTTKGQYGPYGDQQGMSFSSQSVAG-RIVGFHGR  379

Query  506  AGFYVDAIGIY  538
            +G+Y+DAIG++
Sbjct  380  SGWYLDAIGVH  390


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 14/89 (16%)
 Frame = +2

Query  323  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            +E LT I G +G    DD   V++S+ F T+  ++GPYG  +G+ F     +G K+VGF 
Sbjct  517  NEVLTCITGYYGAVARDDRLEVIKSLTFCTSRGKYGPYGEELGTYFTSNRTEG-KVVGFH  575

Query  500  GRAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            GR+G Y+ AIG++            M HW
Sbjct  576  GRSGSYLYAIGVH------------MQHW  592



>ref|XP_009614721.1| PREDICTED: jacalin-related lectin 19 [Nicotiana tomentosiformis]
Length=221

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYLT + G + P V     V+RS+ F++N R FGP+G   G+ F     +G +IVGF GR
Sbjct  87   EYLTGVSGYYCPVVYGGSPVIRSLTFSSNRRTFGPFGVEEGTRFSLPM-EGGQIVGFKGR  145

Query  506  AGFYVDAIGIYSA*VITSSLSSL  574
            +G+Y+DAI  Y A + T+++  +
Sbjct  146  SGWYLDAICCYIAKIKTTTVLQM  168



>ref|XP_010477195.1| PREDICTED: jacalin-related lectin 3-like isoform X2 [Camelina 
sativa]
Length=573

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + GT+GP V    +V++S+ F TN  + GP+G   G  F  +  +G K+VGF+GR
Sbjct  283  EVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-KVVGFLGR  341

Query  506  AGFYVDAIGIYSA*VITSSLSSL  574
             G ++DAIG++   V+   +SSL
Sbjct  342  EGLFLDAIGVH---VMECKISSL  361


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F     + +RS+   +N R++GP+G   G+ F      G KI+GF G+
Sbjct  56   EYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKSGSKIIGFHGK  114

Query  506  AGFYVDAIGIY  538
            AG+Y+DAIG++
Sbjct  115  AGWYIDAIGVH  125


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 14/89 (16%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVD-DSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            +E LT I G +GP  + D  +V++S+ F T+  ++GPYG   G+ F      G K++GF 
Sbjct  481  NETLTCISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEECGTFFTSTTTHG-KVLGFH  539

Query  500  GRAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            GR G  +DAIG++            M HW
Sbjct  540  GRCGCNLDAIGVH------------MQHW  556



>ref|XP_010477194.1| PREDICTED: jacalin-related lectin 3-like isoform X1 [Camelina 
sativa]
Length=624

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + GT+GP V    +V++S+ F TN  + GP+G   G  F  +  +G K+VGF+GR
Sbjct  334  EVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-KVVGFLGR  392

Query  506  AGFYVDAIGIYSA*VITSSLSSL  574
             G ++DAIG++   V+   +SSL
Sbjct  393  EGLFLDAIGVH---VMECKISSL  412


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F     + +RS+   +N R++GP+G   G+ F      G KI+GF G+
Sbjct  107  EYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKSGSKIIGFHGK  165

Query  506  AGFYVDAIGIY  538
            AG+Y+DAIG++
Sbjct  166  AGWYIDAIGVH  176


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVD-DSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            +E LT I G +GP  + D  +V++S+ F T+  ++GPYG   G+ F      G K++GF 
Sbjct  532  NETLTCISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEECGTFFTSTTTHG-KVLGFH  590

Query  500  GRAGFYVDAIGIY  538
            GR G  +DAIG++
Sbjct  591  GRCGCNLDAIGVH  603



>gb|KDO84682.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=619

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+LT + G +G   D     +RS+ F +N + +GP+G   G+ F F    G KIVGF G
Sbjct  79   DEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSFPMTGG-KIVGFHG  137

Query  503  RAGFYVDAIGIYSA*VI--TSSLSSLMLH  583
            R G+Y+DAIGIY   V+   SS +  ML 
Sbjct  138  RCGWYLDAIGIYLKSVVKKVSSNTKAMLQ  166


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT+I GT+GP +    +++RS+ F T   + GP+G   G  F  +  +G KIVGF GR
Sbjct  333  EILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  391

Query  506  AGFYVDAIGIY  538
             G ++DAIG+Y
Sbjct  392  DGLFLDAIGVY  402


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 14/88 (16%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSY-SVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E LT I G +GP   D    V+RS+ F T+  ++GP+G  VG+ F     +GK +VGF G
Sbjct  529  EVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTSTTTEGK-VVGFHG  587

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            R+ FY+DAIG++            M HW
Sbjct  588  RSSFYLDAIGVH------------MQHW  603



>gb|ABA94732.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=597

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+LTEI GT GP+V     V++S+   TN   +GP+G   G+ FH    +G  IVGF GR
Sbjct  362  EFLTEISGTTGPYVCAVADVVKSLTLVTNSGSYGPFGQGGGTAFHTSQSNG-SIVGFFGR  420

Query  506  AGFYVDAIGIY  538
            AG ++ +IG+Y
Sbjct  421  AGGFLHSIGVY  431


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNV-REFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E++  + GT G F     +V+ S+KFTTN+ R +GPYG   G+PF     D   IVGF G
Sbjct  522  EHIKGLSGTVGSF-GMLQNVITSLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVGFFG  580

Query  503  RAGFYVDAIGIY  538
            RAG  V+A+G+Y
Sbjct  581  RAGPCVEAVGVY  592



>ref|XP_006473571.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X1 [Citrus sinensis]
Length=619

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+LT + G +G   D     +RS+ F +N + +GP+G   G+ F F    G KIVGF G
Sbjct  79   DEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSFPMTGG-KIVGFHG  137

Query  503  RAGFYVDAIGIYSA*VI--TSSLSSLMLH  583
            R G+Y+DAIGIY   V+   SS +  ML 
Sbjct  138  RCGWYLDAIGIYLKSVVKKVSSNTKAMLQ  166


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT+I GT+GP +    +++RS+ F T   + GP+G   G  F  +  +G KIVGF GR
Sbjct  333  EILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  391

Query  506  AGFYVDAIGIY  538
             G ++DAIG+Y
Sbjct  392  DGLFLDAIGVY  402


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 14/88 (16%)
 Frame = +2

Query  326  EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E LT I G +GP   D+   V+RS+ F T+  ++GP+G  VG+ F     +G K+VGF G
Sbjct  529  EVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGEEVGTFFTSTTTEG-KVVGFHG  587

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            R+ FY+DAIG++            M HW
Sbjct  588  RSSFYLDAIGVH------------MQHW  603



>ref|XP_006435072.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
 gb|ESR48312.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
Length=619

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+LT + G +G   D     +RS+ F +N + +GP+G   G+ F F    G KIVGF G
Sbjct  79   DEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSFPMTGG-KIVGFHG  137

Query  503  RAGFYVDAIGIYSA*VI--TSSLSSLMLH  583
            R G+Y+DAIGIY   V+   SS +  ML 
Sbjct  138  RCGWYLDAIGIYLKSVVKKVSSNTKAMLQ  166


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT+I GT+GP +    +++RS+ F T   + GP+G   G  F  +  +G KIVGF GR
Sbjct  333  EILTQITGTYGPLMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  391

Query  506  AGFYVDAIGIY  538
             G ++DAIG+Y
Sbjct  392  DGLFLDAIGVY  402


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 14/88 (16%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSY-SVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E LT I G +GP   D    V+RS+ F T+  ++GP+G  VG+ F     +GK +VGF G
Sbjct  529  EVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTSTTTEGK-VVGFHG  587

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            R+ FY+DAIG++            M HW
Sbjct  588  RSSFYLDAIGVH------------MQHW  603



>gb|EMS51533.1| hypothetical protein TRIUR3_05238 [Triticum urartu]
Length=304

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE+LT + G +G        V+RS+ F T    +GP+G   G+PF F A +G  IVG  G
Sbjct  173  DEHLTAVSGRYGAVAPGGSPVIRSLAFRTERAAYGPFGAAEGTPFEF-AVEGGVIVGLCG  231

Query  503  RAGFYVDAIGIY  538
            R+G+ +DA+G+Y
Sbjct  232  RSGWQLDAVGMY  243



>ref|XP_009602425.1| PREDICTED: mannose/glucose-specific lectin-like, partial [Nicotiana 
tomentosiformis]
Length=123

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 56/92 (61%), Gaps = 4/92 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNV-GSPFHFQAPDGKKIVGFIG  502
            EYLT I GTFG +   S+SV++S+ F TN + +GP+G    G+PF F    G  IVGF G
Sbjct  9    EYLTGIKGTFGCY--GSHSVIKSLCFITNSKNYGPFGSEAGGTPFSF-VLKGVAIVGFHG  65

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHWNTSM  598
             +G  ++AIG+Y   ++   + S  +H + S+
Sbjct  66   CSGVLLEAIGVYLQKLMVEEIESRDVHTSFSL  97



>ref|XP_010459648.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Camelina sativa]
 ref|XP_010459649.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Camelina sativa]
Length=570

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT + GT+GP V    +V++S+ F TN  + GP+G   G  F  +  +G K+VGF+GR
Sbjct  280  EVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-KVVGFLGR  338

Query  506  AGFYVDAIGIYSA*VITSSLSSL  574
             G ++DAIG++   V+   +SSL
Sbjct  339  EGLFLDAIGVH---VMECKISSL  358


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F     + +RS+   +N R++GP+G   G+ F      G KI+GF G+
Sbjct  53   EYLISVNGTYGSFDAWGNTCVRSLTLESNHRKYGPFGCESGTFFAL-PKSGSKIIGFHGK  111

Query  506  AGFYVDAIGIY  538
            AG+Y+DAIG++
Sbjct  112  AGWYIDAIGVH  122



>gb|KDP38566.1| hypothetical protein JCGZ_04491 [Jatropha curcas]
Length=545

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E LT +CG +G    DD  +V+RS+ F TN  ++GP+G  VGS F     +G KIVGF G
Sbjct  449  EILTSVCGYYGSLTGDDCNTVIRSLTFYTNKGKYGPFGEEVGSFFTSAKTEG-KIVGFHG  507

Query  503  RAGFYVDAIGIY  538
            R+G Y++AIG++
Sbjct  508  RSGCYLNAIGVH  519


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  I G +G  VD    ++RS+ F +N R++GP+G  +G+ F F    G K++GF G
Sbjct  81   DEYLVTIIGHYGSVVDYGPILVRSLVFESNRRKYGPFGIQMGTDFSFPLTGG-KVIGFHG  139

Query  503  RAGFYVDAIGIY  538
            R  +Y+D+IG+Y
Sbjct  140  RCSWYLDSIGVY  151


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKK-IVGFIG  502
            E LT I G +G  +    +V++S+ F TN R++GP+G   G  F     +  + IVGF G
Sbjct  276  EILTRITGYYGSTILRGPTVVKSLTFHTNKRKYGPFGDEQGISFSSAGSNNNEMIVGFHG  335

Query  503  RAGFYVDAIGIYSA*VITSS  562
            R G+++D+IG++S  ++ S+
Sbjct  336  RKGWFIDSIGVHSRPLVLSN  355



>gb|EAZ25557.1| hypothetical protein OsJ_09383 [Oryza sativa Japonica Group]
Length=126

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E++T++ GT GPF   S SV+ SI FTTN   +GP+G   G+ F         IVGF G
Sbjct  52   SEFVTKVYGTIGPFGKFS-SVITSIHFTTNADRYGPFGQGTGTRFEAPMHSDGSIVGFFG  110

Query  503  RAGFYVDAIGIY  538
            R   YVDAIG Y
Sbjct  111  RTSSYVDAIGFY  122



>ref|XP_011001803.1| PREDICTED: mannose/glucose-specific lectin-like [Populus euphratica]
Length=446

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 69/146 (47%), Gaps = 12/146 (8%)
 Frame = +2

Query  101  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  280
            GP G  GG  WS+     INQIVI          +G     I+  D+    +   GG + 
Sbjct  306  GPWGGRGGSPWSYMTNRGINQIVIH---------VGSNIKSISFRDTTGLDSATFGGENP  356

Query  281  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  460
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+ F 
Sbjct  357  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTAFS  414

Query  461  FQAPDGKKIVGFIGRAGFYVDAIGIY  538
                +   +VGF GRAG Y+DAIGI+
Sbjct  415  IPINN-NTVVGFHGRAGHYLDAIGIF  439



>ref|XP_008651439.1| PREDICTED: jasmonate-induced protein isoform X1 [Zea mays]
 gb|ACL53153.1| unknown [Zea mays]
 tpg|DAA60180.1| TPA: beta-glucosidase aggregating factor 1 [Zea mays]
Length=306

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 5/75 (7%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  493
             E LTE+ GT G    D ++V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  230  SEVLTELSGTIGNV--DGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAIVG  287

Query  494  FIGRAGFYVDAIGIY  538
            F  RAG Y+DA+G+Y
Sbjct  288  FFARAGVYLDALGVY  302



>gb|ACN33395.1| unknown [Zea mays]
 gb|AFW82811.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_630227 [Zea 
mays]
Length=325

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +E++ E+ GT+G F  +  + L S++F T+ R +GP+G   G+ F   AP G  +VGF G
Sbjct  251  NEHIREVSGTYGTF--EGATTLTSLRFITSTRAWGPWGTENGTRFCITAPIGSSVVGFYG  308

Query  503  RAGF-YVDAIGIY  538
            RAG   VDAIG+Y
Sbjct  309  RAGTRLVDAIGVY  321



>gb|EMT23136.1| hypothetical protein F775_18655 [Aegilops tauschii]
Length=118

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            A  Y+TEI GT G F  D   ++ S+K  T+      YG   G+PF     DG KIVGF 
Sbjct  45   ATNYVTEISGTVGKFGTDD--IVTSLKIVTSKGVTKTYGSGTGTPFRVPVLDGGKIVGFF  102

Query  500  GRAGFYVDAIGIY  538
            GRAG ++DAIG Y
Sbjct  103  GRAGAFLDAIGFY  115



>emb|CDX82115.1| BnaC02g21750D [Brassica napus]
Length=250

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            +EYL  + G + P V     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  155  EEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-NGGRIVGMNG  213

Query  503  RAGFYVDAIGIY-SA*VITSSLSSLM--LHWNTSM  598
            R+ +Y+D+IG + S    T  +  L   +HW T M
Sbjct  214  RSSWYLDSIGFHLSRPKSTKVIHKLRKKIHWFTRM  248



>ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1218

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  + G +G         +RS+ F +N R +GP+G   G+ F F    G +IVGF G
Sbjct  701  DEYLASVSGHYGSLNQWGPVFVRSLTFQSNKRTYGPFGVEQGTYFSFPMTGG-RIVGFHG  759

Query  503  RAGFYVDAIGIY  538
            + G++VDAIGIY
Sbjct  760  KGGYFVDAIGIY  771


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT I GT+GP +    ++++S+ F TN  + GP+G   G  F  + P+G KIVGF G+
Sbjct  932  EILTHISGTYGPLMFMGPNIIKSLTFYTNKGKHGPFGDEQGPSFSTK-PNGGKIVGFHGK  990

Query  506  AGFYVDAIGI  535
             G ++DAIG+
Sbjct  991  EGLFLDAIGV  1000


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +2

Query  326   EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E LT I G +GP   D+  +V++S+ F T+  ++GP+G  +G+ F     +GK +VGF G
Sbjct  1128  EVLTRISGYYGPASRDERPTVVKSLTFYTSRGQYGPFGEEIGTFFTSTTTEGK-VVGFHG  1186

Query  503   RAGFYVDAIGIY  538
             R G Y+DAIG++
Sbjct  1187  RCGAYLDAIGVH  1198



>ref|XP_007216928.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
 gb|EMJ18127.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
Length=351

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = +2

Query  323  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            DE+L  + G + P +      ++RS+KF +N R FGPYG   G+PF F   DG KIVG  
Sbjct  253  DEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGKIVGLK  311

Query  500  GRAGFYVDAIGIYSA*VITSSL  565
            GR G+Y+DAIG + +   T  L
Sbjct  312  GRDGWYLDAIGFHVSPPQTKKL  333


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +2

Query  323  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            DE+L  + G + P +      ++RS+KF +N R FGPYG   G+PF F   DG +IVG  
Sbjct  98   DEHLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGQIVGLK  156

Query  500  GRAGFYVDAIGIYSA*VITSSLSSLM  577
            GR G+Y+DAIG + +   T +  S+ 
Sbjct  157  GRDGWYLDAIGFHVSPPPTKNSQSIQ  182



>ref|XP_009588746.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009588747.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=1341

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGS-PFHFQAPDGKKIVGFIG  502
            EYL  I GTFG +    +SV++S+ F TN + +GP+G   G  PF     +G  IVGF G
Sbjct  103  EYLKGIKGTFGYYY--GHSVIKSLCFITNAKNYGPFGCEAGGIPFSLVMKEGVAIVGFHG  160

Query  503  RAGFYVDAIGIY  538
            R+  Y++AIG+Y
Sbjct  161  RSRLYLNAIGVY  172



>ref|XP_009588743.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588744.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588745.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=1363

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGS-PFHFQAPDGKKIVGFIG  502
            EYL  I GTFG +    +SV++S+ F TN + +GP+G   G  PF     +G  IVGF G
Sbjct  125  EYLKGIKGTFGYYY--GHSVIKSLCFITNAKNYGPFGCEAGGIPFSLVMKEGVAIVGFHG  182

Query  503  RAGFYVDAIGIY  538
            R+  Y++AIG+Y
Sbjct  183  RSRLYLNAIGVY  194



>ref|XP_006838698.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
 gb|ERN01267.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
Length=149

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 7/71 (10%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DE +  + G F P       ++RS  F+TN R  GPYG  +G+PF F   DG K+VGF G
Sbjct  21   DETIMSLSGHFEP------KLMRSPSFSTNRRTSGPYGLQIGTPFSFSMTDG-KVVGFHG  73

Query  503  RAGFYVDAIGI  535
            RA  Y++A+G+
Sbjct  74   RASDYLNAMGL  84



>gb|AAM46813.1| hessian fly response gene 1 protein [Triticum aestivum]
Length=345

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDS--YSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  496
             E +TE+ GT G F +D+  Y+ + S+  TTN R +GP+G    +PF     D   IVGF
Sbjct  265  SEIVTEVSGTVGIFAEDNVEYNAIASLTITTNHRPYGPFGETQSTPFSVPVQDNNNIVGF  324

Query  497  IGRAGFYVDAIGIY  538
               AG YV+A+G+Y
Sbjct  325  FACAGKYVEALGVY  338



>gb|AGT16237.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
 gb|AGT16239.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
Length=461

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+L    GT GPF +    V+ S+   TN R +GP+G   G PF         IVGF G 
Sbjct  357  EFLMGAYGTRGPFTNSPADVVTSLTLVTNARSYGPFGHGGGRPFQVPMQGNSSIVGFFGC  416

Query  506  AGFYVDAIGIY  538
            AG Y+DAIG+Y
Sbjct  417  AGSYIDAIGVY  427



>ref|NP_001141303.1| uncharacterized protein LOC100273394 [Zea mays]
 gb|ACF86025.1| unknown [Zea mays]
Length=306

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  493
             E LTE+ GT G    D  +V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  230  SEVLTELSGTIGNV--DGLTVITSIKFVTSLKTYGPFGAWGDGSDTPFTIPVQQGSAIVG  287

Query  494  FIGRAGFYVDAIGIY  538
            F  RAG Y+DA+G+Y
Sbjct  288  FFARAGIYLDAVGVY  302



>ref|XP_003615697.1| Myrosinase-binding protein-like protein [Medicago truncatula]
 gb|AES98655.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=604

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 71/150 (47%), Gaps = 12/150 (8%)
 Frame = +2

Query  92   AVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvgggg  271
            A  GP G +GG  W     + + Q+V+           G     I  +  K+  ++    
Sbjct  16   ASVGPWGGNGGSRWDDGIYSGVRQLVVVH---------GTGIDSIQIEYDKKGSSIWSEK  66

Query  272  tdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGS  451
                       +  D  DE+LT + G +G      ++++RS+ F +N + +GP+G   G+
Sbjct  67   HGGTGGNKTDKVKLDYPDEFLTSVHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGVEQGT  126

Query  452  PFHFQAP-DGKKIVGFIGRAGFYVDAIGIY  538
              +F  P  G KIVGF GR G+Y+DAIG+Y
Sbjct  127  --YFSVPMTGAKIVGFHGRCGWYLDAIGVY  154


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 14/88 (16%)
 Frame = +2

Query  326  EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            E LT I G +G    D+ ++V++S+ F T+  ++GPYG  VG  F     +G K+VGF G
Sbjct  515  EVLTCISGYYGSITKDEKHTVIKSLTFHTSRGQYGPYGEEVGKFFTSTTTEG-KVVGFHG  573

Query  503  RAGFYVDAIGIYSA*VITSSLSSLMLHW  586
            R+  Y+DAIGI+            M HW
Sbjct  574  RSSLYLDAIGIH------------MQHW  589


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E LT I G  GP +    +V+RS+ F T  R++GP+G   G+ F  +  +G KIVG  GR
Sbjct  318  EVLTYISGYHGPLMYMGPAVIRSLTFHTTKRKYGPFGEEQGTYFTTKVKEG-KIVGIHGR  376

Query  506  AGFYVDAIGIY  538
             G ++DA G++
Sbjct  377  KGLFLDAFGVH  387



>ref|XP_006654724.1| PREDICTED: agglutinin-like [Oryza brachyantha]
Length=200

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +2

Query  323  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNV-GSPFHFQAPDGKKIVGF  496
            +EY+T + G + P         +RS+ FTTN RE+GP+G    G+PF F   DG  +VGF
Sbjct  76   EEYVTTVSGHYAPVAAHGGEPAIRSLAFTTNRREYGPFGAAAEGTPFTFPV-DGGAVVGF  134

Query  497  IGRAGFYVDAIGIYSA  544
             GR+G  +DA+G++ A
Sbjct  135  WGRSGRQLDAVGVHVA  150



>gb|ABJ97445.1| beta-glucosidase aggregating factor 1 [Zea mays]
Length=306

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  493
             E LTE+ GT G    D  +V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  230  SEVLTELSGTIGNV--DGLTVITSIKFVTSLKTYGPFGAWGNGSDTPFAIPVQQGSAIVG  287

Query  494  FIGRAGFYVDAIGIY  538
            F  RAG Y+DA+G+Y
Sbjct  288  FFARAGVYLDALGVY  302



>ref|NP_001104964.1| beta-glucosidase aggregating factor precursor [Zea mays]
 gb|AAF71261.2|AF232008_1 beta-glucosidase aggregating factor precursor [Zea mays]
Length=306

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  493
             E LTE+ GT G    D  +V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  230  SEVLTELSGTIGNV--DGLTVITSIKFVTSLKTYGPFGAWGNGSDTPFAIPVQQGSAIVG  287

Query  494  FIGRAGFYVDAIGIY  538
            F  RAG Y+DA+G+Y
Sbjct  288  FFARAGVYLDALGVY  302



>ref|XP_002467725.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
 gb|EER94723.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
Length=149

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
            A EY+TE+ G+ GP  D ++++  S+KF TN   +GP+G   G+PF+    +   +VG  
Sbjct  74   AHEYVTEVAGSVGPIGDLTHTI-TSLKFVTNRGTYGPFGRGDGTPFNVPVLNNGSVVGMF  132

Query  500  GRAGFYVDAIGIY  538
             RA  Y+DAIG Y
Sbjct  133  ARADQYLDAIGFY  145



>gb|EAY90359.1| hypothetical protein OsI_11939 [Oryza sativa Indica Group]
Length=150

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             EY+ E+ G+ GP  D ++ V+ S+K  TN R  GP+G   G+PF     +   +VGF  
Sbjct  76   SEYVKEVHGSVGPIGDYTH-VVTSLKLVTNQRTIGPFGNGAGTPFAVPVLNNGSVVGFFA  134

Query  503  RAGFYVDAIGIY  538
            RAG Y+++IGIY
Sbjct  135  RAGPYLESIGIY  146



>ref|XP_008677993.1| PREDICTED: mannose/glucose-specific lectin-like isoform X5 [Zea 
mays]
Length=703

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  458  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  516

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  517  GRSGRYLNAIGVYTA  531



>ref|XP_004980504.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=128

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
             E++ E+ GT+G F     +V+ S    TN+  +GP+G   G+PFH +      IVGF G
Sbjct  52   SEFVKEVSGTYGRF-SHLPNVITSFTLVTNLCSYGPFGQPSGTPFHTRVDRTGSIVGFFG  110

Query  503  RAGFYVDAIGIY  538
            R+G Y+DAIG+Y
Sbjct  111  RSGKYLDAIGVY  122



>ref|XP_008677995.1| PREDICTED: mannose/glucose-specific lectin-like isoform X7 [Zea 
mays]
Length=680

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  499
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  435  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  493

Query  500  GRAGFYVDAIGIYSA  544
            GR+G Y++AIG+Y+A
Sbjct  494  GRSGRYLNAIGVYTA  508



>gb|AGT16242.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
Length=561

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            E+L    GT GPF +    V+ S+   TN R +GP+G   G PF         IVGF G 
Sbjct  457  EFLMGAYGTRGPFTNSPADVVTSLTLVTNARSYGPFGHGGGRPFQVPMQGNSSIVGFFGC  516

Query  506  AGFYVDAIGIY  538
            AG Y+DAIG+Y
Sbjct  517  AGSYIDAIGVY  527



>ref|XP_010537548.1| PREDICTED: LOW QUALITY PROTEIN: jacalin-related lectin 19 [Tarenaya 
hassleriana]
Length=178

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  323  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  502
            DEYL  +   + P V    SV+R + F +N RE+G YG   G+PF F   +G +I+G  G
Sbjct  83   DEYLISMSRYYCPVVHXGSSVIRVLTFKSNKREYGTYGVEQGTPFIFSV-EGGRIIGLNG  141

Query  503  RAGFYVDAIG  532
            R+G Y+D+IG
Sbjct  142  RSGXYLDSIG  151



>gb|AAZ73661.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73662.1| At1g19715, partial [Arabidopsis thaliana]
Length=175

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F       +RS+ F +N R++GP+G + G+ F      G KI+GF G+
Sbjct  8    EYLISVNGTYGSFDVWGTICIRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIGFHGK  66

Query  506  AGFYVDAIGIYSA*VITSS--LSSLMLHWNTSMC  601
            AG+Y+DAIG+++  +   +   S ++LH + S  
Sbjct  67   AGWYLDAIGVHTQPIPKENNPSSKILLHSHQSFS  100



>gb|AAZ73664.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73665.1| At1g19715, partial [Arabidopsis thaliana]
Length=172

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F       +RS+ F +N R++GP+G + G+ F      G KI+GF G+
Sbjct  8    EYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIGFHGK  66

Query  506  AGFYVDAIGIYSA*VITSS--LSSLMLHWNTSMC  601
            AG+Y+DAIG+++  +   +   S ++LH + S  
Sbjct  67   AGWYLDAIGVHTQPIPKENNPSSKILLHSHQSFS  100



>ref|XP_006306414.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
 gb|EOA39312.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
Length=1361

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  326   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
             E LT + GT+GP +    +V++S+ F TN  + GP+G   G  F  +  +G ++VGF+GR
Sbjct  1071  EVLTHVTGTYGPLIYMGPNVIKSLTFRTNKGKHGPFGEEQGPSFTHKMDEG-RVVGFLGR  1129

Query  506   AGFYVDAIGIYSA*VITSSLSSL  574
              G ++D+IG++   V+   +SSL
Sbjct  1130  EGLFLDSIGVH---VMECKISSL  1149


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  505
            EYL  + GT+G F       +RS+   +N R++GP+G   G+ F      G KI+GF G+
Sbjct  844  EYLISVSGTYGSFDAWGNICVRSLTLESNHRKYGPFGVESGTFFAL-PKSGTKIIGFHGK  902

Query  506  AGFYVDAIGIY  538
            AG+Y DAIG++
Sbjct  903  AGWYTDAIGVH  913



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370