BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I21

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364843.1|  PREDICTED: TMV resistance protein N-like           177   2e-47   Solanum tuberosum [potatoes]
ref|XP_004233763.1|  PREDICTED: TMV resistance protein N-like           174   2e-46   Solanum lycopersicum
ref|XP_009803658.1|  PREDICTED: TMV resistance protein N-like           172   5e-46   Nicotiana sylvestris
ref|XP_009622249.1|  PREDICTED: TMV resistance protein N-like           169   7e-45   Nicotiana tomentosiformis
ref|XP_010646550.1|  PREDICTED: disease resistance protein RPS4-like  78.6    2e-14   Vitis vinifera
ref|XP_007199034.1|  hypothetical protein PRUPE_ppa018060mg           75.1    2e-12   
ref|XP_006360469.1|  PREDICTED: TMV resistance protein N-like         74.7    3e-12   Solanum tuberosum [potatoes]
emb|CBI39355.3|  unnamed protein product                              72.8    4e-12   Vitis vinifera
emb|CAN76615.1|  hypothetical protein VITISV_040107                   73.9    6e-12   Vitis vinifera
ref|XP_002273047.2|  PREDICTED: TMV resistance protein N-like         73.9    7e-12   Vitis vinifera
ref|XP_004237202.1|  PREDICTED: TMV resistance protein N-like         73.9    7e-12   Solanum lycopersicum
ref|XP_008231886.1|  PREDICTED: TMV resistance protein N-like iso...  73.2    1e-11   Prunus mume [ume]
ref|XP_008231887.1|  PREDICTED: TMV resistance protein N-like iso...  72.8    1e-11   Prunus mume [ume]
ref|XP_010645918.1|  PREDICTED: inactive disease resistance prote...  72.0    2e-11   
ref|XP_010645869.1|  PREDICTED: putative disease resistance prote...  72.4    2e-11   Vitis vinifera
ref|XP_010657771.1|  PREDICTED: TMV resistance protein N-like iso...  72.8    2e-11   Vitis vinifera
ref|XP_010646551.1|  PREDICTED: TMV resistance protein N-like         72.4    2e-11   
ref|XP_010665417.1|  PREDICTED: TMV resistance protein N-like         72.4    2e-11   Vitis vinifera
ref|XP_010657770.1|  PREDICTED: TMV resistance protein N-like iso...  72.4    2e-11   
emb|CBI40966.3|  unnamed protein product                              72.4    2e-11   Vitis vinifera
ref|XP_009358304.1|  PREDICTED: TMV resistance protein N-like         71.2    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_002514796.1|  hypothetical protein RCOM_1077370                70.9    6e-11   
emb|CAN68630.1|  hypothetical protein VITISV_003859                   70.9    7e-11   Vitis vinifera
emb|CBI34029.3|  unnamed protein product                              67.4    7e-11   Vitis vinifera
emb|CBI18506.3|  unnamed protein product                              70.1    8e-11   Vitis vinifera
emb|CBI25016.3|  unnamed protein product                              67.0    9e-11   Vitis vinifera
ref|XP_008373276.1|  PREDICTED: TMV resistance protein N-like         70.1    1e-10   Malus domestica [apple tree]
ref|XP_010665235.1|  PREDICTED: TMV resistance protein N-like         69.7    1e-10   
gb|KDP31604.1|  hypothetical protein JCGZ_14829                       69.7    2e-10   Jatropha curcas
emb|CBI35541.3|  unnamed protein product                              66.2    2e-10   Vitis vinifera
ref|XP_007201559.1|  hypothetical protein PRUPE_ppa017840mg           69.3    2e-10   
ref|XP_009343129.1|  PREDICTED: TMV resistance protein N-like         68.9    3e-10   
ref|XP_010657776.1|  PREDICTED: TMV resistance protein N-like         67.8    4e-10   Vitis vinifera
emb|CAN66453.1|  hypothetical protein VITISV_004613                   68.6    4e-10   Vitis vinifera
gb|KDO41149.1|  hypothetical protein CISIN_1g041975mg                 67.8    4e-10   Citrus sinensis [apfelsine]
ref|XP_010648148.1|  PREDICTED: TMV resistance protein N-like         68.2    4e-10   Vitis vinifera
emb|CAN76072.1|  hypothetical protein VITISV_004552                   67.0    5e-10   Vitis vinifera
ref|XP_010645953.1|  PREDICTED: TMV resistance protein N-like         68.2    6e-10   
emb|CAN64645.1|  hypothetical protein VITISV_042806                   67.8    6e-10   Vitis vinifera
emb|CDP04904.1|  unnamed protein product                              67.8    7e-10   Coffea canephora [robusta coffee]
ref|XP_002521767.1|  leucine-rich repeat-containing protein, puta...  67.8    7e-10   
ref|XP_010645852.1|  PREDICTED: TMV resistance protein N-like         67.8    7e-10   
emb|CBI23849.3|  unnamed protein product                              67.0    1e-09   Vitis vinifera
ref|XP_010657788.1|  PREDICTED: TMV resistance protein N-like iso...  66.6    1e-09   
ref|XP_010657787.1|  PREDICTED: TMV resistance protein N-like iso...  66.6    1e-09   
ref|XP_002272667.2|  PREDICTED: TMV resistance protein N-like iso...  66.6    1e-09   
ref|XP_010657789.1|  PREDICTED: TMV resistance protein N-like iso...  66.6    2e-09   
ref|XP_009343065.1|  PREDICTED: TMV resistance protein N-like         64.3    2e-09   
ref|XP_009336515.1|  PREDICTED: TMV resistance protein N-like         65.9    2e-09   
emb|CAN68108.1|  hypothetical protein VITISV_013549                   65.9    2e-09   Vitis vinifera
ref|XP_010665420.1|  PREDICTED: TMV resistance protein N-like         65.9    3e-09   Vitis vinifera
gb|AEE43928.1|  TIR-NBS-LRR resistance protein muRdr1D                65.9    3e-09   Rosa multiflora [Japanese rose]
ref|XP_008245424.1|  PREDICTED: TMV resistance protein N-like         65.1    3e-09   
ref|XP_004290249.2|  PREDICTED: TMV resistance protein N-like         65.9    3e-09   Fragaria vesca subsp. vesca
ref|XP_009347942.1|  PREDICTED: TMV resistance protein N-like         65.9    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_008381892.1|  PREDICTED: TMV resistance protein N-like         64.7    4e-09   
emb|CAN64759.1|  hypothetical protein VITISV_033530                   65.5    4e-09   Vitis vinifera
ref|XP_008358303.1|  PREDICTED: TMV resistance protein N-like         64.3    5e-09   
ref|XP_010661243.1|  PREDICTED: TMV resistance protein N-like iso...  65.1    5e-09   
ref|XP_010661240.1|  PREDICTED: TMV resistance protein N-like iso...  65.1    6e-09   Vitis vinifera
ref|XP_009360768.1|  PREDICTED: TMV resistance protein N-like         64.7    6e-09   Pyrus x bretschneideri [bai li]
ref|XP_008382170.1|  PREDICTED: TMV resistance protein N-like         64.7    7e-09   
emb|CDP07825.1|  unnamed protein product                              64.3    8e-09   Coffea canephora [robusta coffee]
ref|XP_010665286.1|  PREDICTED: TMV resistance protein N-like         64.3    9e-09   Vitis vinifera
ref|XP_009360758.1|  PREDICTED: TMV resistance protein N-like         64.3    1e-08   
ref|XP_002531928.1|  leucine-rich repeat-containing protein, puta...  63.9    1e-08   
ref|XP_008237404.1|  PREDICTED: TMV resistance protein N-like         63.9    1e-08   Prunus mume [ume]
ref|XP_002272079.2|  PREDICTED: TMV resistance protein N              63.9    1e-08   Vitis vinifera
ref|XP_008237406.1|  PREDICTED: TMV resistance protein N-like         63.9    1e-08   Prunus mume [ume]
ref|XP_010646556.1|  PREDICTED: putative disease resistance prote...  63.5    1e-08   
ref|XP_007200714.1|  hypothetical protein PRUPE_ppa015500m1g          62.4    1e-08   
ref|XP_009342855.1|  PREDICTED: TMV resistance protein N-like iso...  63.2    2e-08   
ref|XP_009342856.1|  PREDICTED: TMV resistance protein N-like iso...  63.2    2e-08   
ref|XP_008352780.1|  PREDICTED: TMV resistance protein N-like         63.2    2e-08   
ref|XP_007201594.1|  hypothetical protein PRUPE_ppa021490mg           63.2    2e-08   
ref|XP_008237417.1|  PREDICTED: TMV resistance protein N-like         63.2    2e-08   Prunus mume [ume]
ref|XP_008222884.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  63.2    2e-08   
ref|XP_008222859.1|  PREDICTED: TMV resistance protein N-like         62.8    2e-08   
ref|XP_007200796.1|  hypothetical protein PRUPE_ppa024688mg           62.8    2e-08   
emb|CAN61853.1|  hypothetical protein VITISV_027841                   62.8    3e-08   Vitis vinifera
ref|XP_008237565.1|  PREDICTED: TMV resistance protein N-like         62.4    3e-08   
ref|XP_011458231.1|  PREDICTED: TMV resistance protein N-like iso...  62.4    4e-08   Fragaria vesca subsp. vesca
ref|XP_004290247.1|  PREDICTED: TMV resistance protein N-like iso...  62.4    4e-08   Fragaria vesca subsp. vesca
ref|XP_011458232.1|  PREDICTED: TMV resistance protein N-like iso...  62.4    4e-08   Fragaria vesca subsp. vesca
ref|XP_010665287.1|  PREDICTED: TMV resistance protein N-like         62.4    4e-08   
emb|CBI18504.3|  unnamed protein product                              61.6    4e-08   Vitis vinifera
ref|XP_009360662.1|  PREDICTED: TMV resistance protein N-like iso...  62.0    4e-08   Pyrus x bretschneideri [bai li]
ref|XP_009368494.1|  PREDICTED: TMV resistance protein N-like         62.0    5e-08   
ref|XP_009360660.1|  PREDICTED: TMV resistance protein N-like iso...  62.0    5e-08   Pyrus x bretschneideri [bai li]
gb|KHG22298.1|  TMV resistance N                                      61.6    5e-08   Gossypium arboreum [tree cotton]
emb|CBI39197.3|  unnamed protein product                              61.2    5e-08   Vitis vinifera
ref|XP_008357215.1|  PREDICTED: TMV resistance protein N-like         61.6    6e-08   
ref|XP_003634611.2|  PREDICTED: TMV resistance protein N-like         61.6    6e-08   
emb|CBI23256.3|  unnamed protein product                              61.2    6e-08   Vitis vinifera
ref|XP_010263207.1|  PREDICTED: TMV resistance protein N-like iso...  61.6    6e-08   
ref|XP_002277693.2|  PREDICTED: TMV resistance protein N-like         61.6    7e-08   
ref|XP_008368131.1|  PREDICTED: TMV resistance protein N-like         61.6    7e-08   Malus domestica [apple tree]
ref|XP_009340808.1|  PREDICTED: uncharacterized protein LOC103932885  59.3    7e-08   
emb|CAN66451.1|  hypothetical protein VITISV_004611                   60.8    9e-08   Vitis vinifera
ref|XP_008237531.1|  PREDICTED: TMV resistance protein N-like         60.8    1e-07   
ref|XP_010646557.1|  PREDICTED: disease resistance protein RPS4-like  60.5    1e-07   
ref|XP_010645905.1|  PREDICTED: TMV resistance protein N-like         60.8    1e-07   Vitis vinifera
ref|XP_010645849.1|  PREDICTED: disease resistance protein RPS4-like  60.8    1e-07   Vitis vinifera
ref|XP_009336840.1|  PREDICTED: uncharacterized protein LOC103929372  58.2    1e-07   
ref|XP_006491517.1|  PREDICTED: uncharacterized protein LOC102619067  57.8    1e-07   Citrus sinensis [apfelsine]
emb|CBI40964.3|  unnamed protein product                              60.1    1e-07   Vitis vinifera
emb|CAN71924.1|  hypothetical protein VITISV_006193                   60.8    1e-07   Vitis vinifera
gb|KDP41808.1|  hypothetical protein JCGZ_26826                       59.7    1e-07   Jatropha curcas
emb|CDP20963.1|  unnamed protein product                              60.5    1e-07   Coffea canephora [robusta coffee]
emb|CBI40960.3|  unnamed protein product                              60.5    1e-07   Vitis vinifera
ref|XP_007199341.1|  hypothetical protein PRUPE_ppa024336mg           60.5    2e-07   
ref|XP_011469998.1|  PREDICTED: TMV resistance protein N-like iso...  60.5    2e-07   Fragaria vesca subsp. vesca
ref|XP_004307741.2|  PREDICTED: TMV resistance protein N-like iso...  60.5    2e-07   Fragaria vesca subsp. vesca
ref|XP_010657779.1|  PREDICTED: TMV resistance protein N-like iso...  60.5    2e-07   
ref|XP_010657777.1|  PREDICTED: TMV resistance protein N-like iso...  60.5    2e-07   
ref|XP_003635135.2|  PREDICTED: uncharacterized protein LOC100853815  60.5    2e-07   
ref|XP_008237597.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  60.1    2e-07   
emb|CDP20074.1|  unnamed protein product                              60.1    2e-07   Coffea canephora [robusta coffee]
ref|XP_010658914.1|  PREDICTED: TMV resistance protein N-like         60.1    2e-07   
ref|XP_010106413.1|  TMV resistance protein N                         60.1    2e-07   
ref|XP_007199198.1|  hypothetical protein PRUPE_ppa021587mg           59.7    2e-07   
gb|KHG11425.1|  Protein maelstrom                                     57.8    2e-07   Gossypium arboreum [tree cotton]
ref|XP_006478776.1|  PREDICTED: TMV resistance protein N-like         59.7    2e-07   
ref|XP_006442968.1|  hypothetical protein CICLE_v10018524mg           59.7    3e-07   Citrus clementina [clementine]
ref|XP_007199627.1|  hypothetical protein PRUPE_ppa016158mg           59.7    3e-07   
emb|CDP07826.1|  unnamed protein product                              59.7    3e-07   Coffea canephora [robusta coffee]
ref|XP_009360663.1|  PREDICTED: TMV resistance protein N-like iso...  59.3    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_008356042.1|  PREDICTED: TMV resistance protein N-like         59.3    3e-07   
ref|XP_009343054.1|  PREDICTED: TMV resistance protein N-like         59.3    3e-07   Pyrus x bretschneideri [bai li]
gb|KDO43807.1|  hypothetical protein CISIN_1g0018051mg                58.9    3e-07   Citrus sinensis [apfelsine]
emb|CDP20945.1|  unnamed protein product                              59.3    3e-07   Coffea canephora [robusta coffee]
ref|XP_010665089.1|  PREDICTED: TMV resistance protein N-like         59.3    3e-07   Vitis vinifera
ref|XP_008392312.1|  PREDICTED: TMV resistance protein N-like         59.3    3e-07   
ref|XP_006388190.1|  hypothetical protein POPTR_0293s00200g           58.5    4e-07   
emb|CDP20545.1|  unnamed protein product                              57.4    4e-07   Coffea canephora [robusta coffee]
ref|XP_008245719.1|  PREDICTED: TMV resistance protein N-like         58.9    5e-07   
ref|XP_010665272.1|  PREDICTED: TMV resistance protein N-like         58.9    5e-07   
ref|XP_008359692.1|  PREDICTED: TMV resistance protein N-like         58.9    5e-07   
ref|XP_008365707.1|  PREDICTED: TMV resistance protein N-like         58.5    5e-07   
ref|XP_003607597.1|  NBS resistance protein                           58.5    6e-07   
ref|XP_008237742.1|  PREDICTED: TMV resistance protein N-like         58.5    6e-07   
emb|CDP07823.1|  unnamed protein product                              58.5    6e-07   Coffea canephora [robusta coffee]
ref|XP_008380886.1|  PREDICTED: TMV resistance protein N-like         58.5    6e-07   
ref|XP_007199428.1|  hypothetical protein PRUPE_ppa026529mg           58.5    6e-07   
ref|XP_006491534.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  58.5    6e-07   
ref|XP_006491536.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  58.5    6e-07   Citrus sinensis [apfelsine]
ref|XP_009368501.1|  PREDICTED: TMV resistance protein N-like         58.5    7e-07   
gb|AES89794.2|  disease resistance protein (TIR-NBS-LRR class)        58.5    7e-07   Medicago truncatula
emb|CDP21222.1|  unnamed protein product                              58.2    7e-07   Coffea canephora [robusta coffee]
ref|XP_008373290.1|  PREDICTED: TMV resistance protein N-like         57.8    7e-07   
ref|XP_002523474.1|  TMV resistance protein N, putative               58.2    8e-07   
emb|CDY10733.1|  BnaA05g12030D                                        58.2    8e-07   Brassica napus [oilseed rape]
ref|XP_008237536.1|  PREDICTED: TMV resistance protein N-like         58.2    9e-07   Prunus mume [ume]
ref|XP_008237860.1|  PREDICTED: TMV resistance protein N-like         57.8    9e-07   Prunus mume [ume]
ref|XP_011468890.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  57.8    9e-07   Fragaria vesca subsp. vesca
ref|XP_006442188.1|  hypothetical protein CICLE_v10022183mg           55.8    1e-06   
ref|XP_009113872.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  57.8    1e-06   
ref|XP_008382496.1|  PREDICTED: uncharacterized protein LOC103445285  55.5    1e-06   
gb|KDO37804.1|  hypothetical protein CISIN_1g039311mg                 57.8    1e-06   Citrus sinensis [apfelsine]
ref|XP_008381726.1|  PREDICTED: TMV resistance protein N-like         57.8    1e-06   
gb|KDO40706.1|  hypothetical protein CISIN_1g036772mg                 57.4    1e-06   Citrus sinensis [apfelsine]
ref|XP_008237763.1|  PREDICTED: TMV resistance protein N-like         57.8    1e-06   
ref|XP_008237864.1|  PREDICTED: TMV resistance protein N-like         57.4    1e-06   
ref|XP_007199069.1|  hypothetical protein PRUPE_ppa018765mg           57.4    1e-06   
ref|XP_006470766.1|  PREDICTED: TMV resistance protein N-like         57.4    1e-06   
ref|XP_008243697.1|  PREDICTED: TMV resistance protein N-like         57.4    1e-06   Prunus mume [ume]
ref|XP_010665280.1|  PREDICTED: uncharacterized protein LOC104882720  56.6    1e-06   Vitis vinifera
ref|XP_006491604.1|  PREDICTED: TMV resistance protein N-like         57.4    1e-06   
ref|XP_009340812.1|  PREDICTED: putative disease resistance prote...  57.0    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_009366533.1|  PREDICTED: TMV resistance protein N-like         56.6    2e-06   
ref|XP_008365841.1|  PREDICTED: TMV resistance protein N-like         57.0    2e-06   
ref|XP_009340810.1|  PREDICTED: TMV resistance protein N-like iso...  57.0    2e-06   Pyrus x bretschneideri [bai li]
gb|KDP26905.1|  hypothetical protein JCGZ_18063                       57.0    2e-06   Jatropha curcas
ref|XP_007227167.1|  hypothetical protein PRUPE_ppa023967mg           57.0    2e-06   
ref|XP_009340809.1|  PREDICTED: TMV resistance protein N-like iso...  57.0    2e-06   
ref|XP_010645917.1|  PREDICTED: disease resistance protein RPS4-like  55.5    2e-06   
gb|KDO47983.1|  hypothetical protein CISIN_1g044579mg                 57.0    2e-06   Citrus sinensis [apfelsine]
ref|XP_006492798.1|  PREDICTED: TMV resistance protein N-like         57.0    2e-06   Citrus sinensis [apfelsine]
ref|XP_008237366.1|  PREDICTED: TMV resistance protein N-like         56.6    2e-06   
ref|XP_007199048.1|  hypothetical protein PRUPE_ppa018338mg           56.6    2e-06   
ref|XP_011458726.1|  PREDICTED: TMV resistance protein N-like iso...  56.6    2e-06   Fragaria vesca subsp. vesca
ref|XP_011458731.1|  PREDICTED: TMV resistance protein N-like iso...  56.6    2e-06   Fragaria vesca subsp. vesca
ref|XP_008366223.1|  PREDICTED: uncharacterized protein LOC103429872  54.7    3e-06   
ref|XP_006441763.1|  hypothetical protein CICLE_v10023653mg           56.2    3e-06   
ref|XP_008350156.1|  PREDICTED: TMV resistance protein N-like         56.2    3e-06   
ref|XP_008339192.1|  PREDICTED: TMV resistance protein N-like         56.2    3e-06   
emb|CDX86729.1|  BnaA09g21190D                                        56.2    3e-06   
ref|XP_006442147.1|  hypothetical protein CICLE_v10018573mg           56.2    3e-06   
emb|CAN75296.1|  hypothetical protein VITISV_010423                   56.2    3e-06   Vitis vinifera
ref|XP_009114646.1|  PREDICTED: TMV resistance protein N              56.2    4e-06   
ref|XP_006387238.1|  hypothetical protein POPTR_1446s00200g           55.8    4e-06   
gb|AHG28999.1|  NBS-LRR protein                                       55.8    4e-06   Cicer arietinum [garbanzo]
emb|CAN68293.1|  hypothetical protein VITISV_015601                   56.2    4e-06   Vitis vinifera
gb|KDO40441.1|  hypothetical protein CISIN_1g006695mg                 55.8    4e-06   Citrus sinensis [apfelsine]
emb|CDY26389.1|  BnaA02g23810D                                        55.8    4e-06   Brassica napus [oilseed rape]
gb|KDP25810.1|  hypothetical protein JCGZ_22532                       55.8    4e-06   Jatropha curcas
ref|XP_009597696.1|  PREDICTED: TMV resistance protein N-like iso...  55.8    4e-06   Nicotiana tomentosiformis
ref|XP_009597713.1|  PREDICTED: TMV resistance protein N-like iso...  55.8    4e-06   
gb|KDO36493.1|  hypothetical protein CISIN_1g046284mg                 55.8    4e-06   Citrus sinensis [apfelsine]
gb|AEE43931.1|  TIR-NBS-LRR resistance protein muRdr1G                55.8    4e-06   Rosa multiflora [Japanese rose]
ref|XP_006443097.1|  hypothetical protein CICLE_v10023324mg           54.3    4e-06   
ref|XP_006442158.1|  hypothetical protein CICLE_v10018611mg           55.8    4e-06   Citrus clementina [clementine]
ref|XP_011470001.1|  PREDICTED: TMV resistance protein N-like iso...  55.8    5e-06   Fragaria vesca subsp. vesca
gb|AEE43926.1|  TIR-NBS-LRR resistance protein muRdr1B                55.8    5e-06   Rosa multiflora [Japanese rose]
ref|XP_009345930.1|  PREDICTED: TMV resistance protein N-like         55.8    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_009360786.1|  PREDICTED: TMV resistance protein N-like         55.5    5e-06   
ref|XP_004308990.1|  PREDICTED: TMV resistance protein N-like iso...  55.8    5e-06   Fragaria vesca subsp. vesca
ref|XP_009368502.1|  PREDICTED: TMV resistance protein N-like         55.5    5e-06   
gb|KHG21792.1|  putative WRKY transcription factor 19 -like protein   55.1    5e-06   Gossypium arboreum [tree cotton]
ref|XP_008243638.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  55.5    5e-06   
ref|XP_008364337.1|  PREDICTED: uncharacterized protein LOC103428024  54.7    6e-06   
gb|AGF69193.1|  TMV resistance protein N-like protein 7               55.5    6e-06   Vitis labrusca [Concord grape]
ref|XP_009353079.1|  PREDICTED: uncharacterized protein LOC103944368  53.5    6e-06   
ref|XP_010665419.1|  PREDICTED: TMV resistance protein N-like         55.5    6e-06   
ref|XP_004237584.1|  PREDICTED: TMV resistance protein N-like         55.5    6e-06   Solanum lycopersicum
ref|XP_006421210.1|  hypothetical protein CICLE_v100041741mg          55.5    6e-06   
gb|KDO39975.1|  hypothetical protein CISIN_1g0014581mg                55.1    7e-06   Citrus sinensis [apfelsine]
ref|XP_008356222.1|  PREDICTED: TMV resistance protein N-like         55.1    7e-06   
ref|NP_192938.1|  TIR-NBS-LRR class disease resistance protein        55.1    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002523481.1|  TMV resistance protein N, putative               55.1    8e-06   
ref|XP_010087622.1|  TMV resistance protein N                         55.1    8e-06   
ref|XP_007199227.1|  hypothetical protein PRUPE_ppa022016mg           55.1    8e-06   
ref|XP_006492471.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    8e-06   Citrus sinensis [apfelsine]
emb|CDX94478.1|  BnaC09g23580D                                        55.1    9e-06   
ref|XP_006492768.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  54.7    9e-06   
ref|XP_010646043.1|  PREDICTED: disease resistance protein RPS4-like  54.7    9e-06   
ref|XP_011457954.1|  PREDICTED: TMV resistance protein N-like         53.9    9e-06   Fragaria vesca subsp. vesca
ref|XP_008353544.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  54.7    9e-06   
emb|CDX86732.1|  BnaA09g21220D                                        54.7    9e-06   
ref|XP_010419801.1|  PREDICTED: TMV resistance protein N-like iso...  54.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010110663.1|  TMV resistance protein N                         54.7    1e-05   
ref|XP_010419800.1|  PREDICTED: TMV resistance protein N-like iso...  54.7    1e-05   Camelina sativa [gold-of-pleasure]
gb|KHG05418.1|  TMV resistance N                                      54.3    1e-05   Gossypium arboreum [tree cotton]
ref|XP_010419802.1|  PREDICTED: TMV resistance protein N-like iso...  54.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_004292702.2|  PREDICTED: TMV resistance protein N-like         54.7    1e-05   Fragaria vesca subsp. vesca
ref|XP_006289237.1|  hypothetical protein CARUB_v10002693mg           54.7    1e-05   Capsella rubella
ref|XP_006353757.1|  PREDICTED: TMV resistance protein N-like         54.7    1e-05   Solanum tuberosum [potatoes]
ref|XP_010665230.1|  PREDICTED: TMV resistance protein N-like         54.3    1e-05   
emb|CBI31343.3|  unnamed protein product                              54.3    1e-05   Vitis vinifera
emb|CAN72519.1|  hypothetical protein VITISV_024695                   53.9    1e-05   Vitis vinifera
ref|XP_006441734.1|  hypothetical protein CICLE_v10018550mg           54.3    1e-05   Citrus clementina [clementine]
ref|XP_010645915.1|  PREDICTED: TMV resistance protein N-like         54.3    1e-05   Vitis vinifera
ref|XP_009760755.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  54.3    1e-05   Nicotiana sylvestris
ref|XP_006494203.1|  PREDICTED: putative disease resistance prote...  53.9    1e-05   
ref|XP_010433874.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010419804.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  54.3    1e-05   
ref|XP_008339119.1|  PREDICTED: TMV resistance protein N-like         54.3    1e-05   
emb|CAN68384.1|  hypothetical protein VITISV_018351                   54.3    1e-05   Vitis vinifera
ref|XP_009794567.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    2e-05   Nicotiana sylvestris
ref|XP_009794566.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    2e-05   Nicotiana sylvestris
ref|XP_009368281.1|  PREDICTED: TMV resistance protein N-like         53.9    2e-05   
ref|XP_009794564.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    2e-05   Nicotiana sylvestris
ref|XP_011470424.1|  PREDICTED: TMV resistance protein N-like         53.9    2e-05   Fragaria vesca subsp. vesca
ref|XP_006376184.1|  hypothetical protein POPTR_0013s10630g           53.9    2e-05   
gb|KDO38795.1|  hypothetical protein CISIN_1g0413351mg                53.5    2e-05   Citrus sinensis [apfelsine]
gb|KDP26903.1|  hypothetical protein JCGZ_18061                       52.0    2e-05   Jatropha curcas
gb|AFP55562.1|  TIR-NBS-LRR                                           53.9    2e-05   Rosa rugosa [Japanese rose]
ref|XP_010645913.1|  PREDICTED: disease resistance protein RPS4-like  53.5    2e-05   
ref|XP_010645835.1|  PREDICTED: disease resistance protein RPS4-like  53.5    2e-05   Vitis vinifera
ref|XP_002514805.1|  ATP binding protein, putative                    53.5    2e-05   
ref|XP_009348637.1|  PREDICTED: TMV resistance protein N-like         53.5    2e-05   
ref|XP_010455633.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  53.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006413965.1|  hypothetical protein EUTSA_v10027412mg           53.5    2e-05   
ref|XP_006491525.1|  PREDICTED: uncharacterized protein LOC102621...  51.6    2e-05   
emb|CBI31344.3|  unnamed protein product                              53.5    2e-05   Vitis vinifera
gb|KDO41018.1|  hypothetical protein CISIN_1g037314mg                 53.5    2e-05   Citrus sinensis [apfelsine]
ref|XP_008387746.1|  PREDICTED: TMV resistance protein N-like         53.5    2e-05   
gb|KHG04105.1|  TMV resistance N                                      52.8    2e-05   Gossypium arboreum [tree cotton]
ref|XP_008345935.1|  PREDICTED: putative disease resistance prote...  53.5    2e-05   
ref|XP_008381702.1|  PREDICTED: TMV resistance protein N-like         53.5    2e-05   
gb|KHG07826.1|  TMV resistance N                                      53.1    2e-05   Gossypium arboreum [tree cotton]
gb|KHG27760.1|  suppressor of npr1-1, constitutive 1 -like protein    53.5    3e-05   Gossypium arboreum [tree cotton]
ref|XP_006441744.1|  hypothetical protein CICLE_v10024507mg           53.5    3e-05   
ref|XP_002325618.2|  hypothetical protein POPTR_0019s12930g           53.1    3e-05   
gb|KDO36073.1|  hypothetical protein CISIN_1g007219mg                 53.1    3e-05   Citrus sinensis [apfelsine]
ref|XP_006582295.1|  PREDICTED: TMV resistance protein N-like iso...  53.1    3e-05   Glycine max [soybeans]
ref|XP_009355622.1|  PREDICTED: uncharacterized protein LOC103946601  52.0    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_010645846.1|  PREDICTED: inactive disease resistance prote...  51.6    3e-05   
gb|AFP55552.1|  TIR-NBS-LRR                                           53.1    3e-05   Rosa rugosa [Japanese rose]
emb|CDP20523.1|  unnamed protein product                              53.1    3e-05   
ref|XP_008235802.1|  PREDICTED: TMV resistance protein N-like         52.8    3e-05   
ref|XP_006478669.1|  PREDICTED: TMV resistance protein N-like iso...  53.1    3e-05   
ref|XP_007201607.1|  hypothetical protein PRUPE_ppa019628mg           53.1    3e-05   
gb|AGH33842.1|  RGH14                                                 53.1    3e-05   
ref|XP_006491526.1|  PREDICTED: uncharacterized protein LOC102621...  50.4    3e-05   
ref|XP_006592481.1|  PREDICTED: uncharacterized protein LOC102660364  51.6    4e-05   
ref|XP_011004904.1|  PREDICTED: TMV resistance protein N-like iso...  52.8    4e-05   
ref|XP_010312671.1|  PREDICTED: uncharacterized protein LOC101265700  53.1    4e-05   
ref|XP_009358924.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  52.8    4e-05   
emb|CBI35552.3|  unnamed protein product                              52.0    4e-05   
ref|XP_011004891.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  52.8    4e-05   
ref|XP_009360790.1|  PREDICTED: TMV resistance protein N-like         52.8    4e-05   
ref|XP_002874741.1|  hypothetical protein ARALYDRAFT_327329           52.8    4e-05   
ref|XP_010665448.1|  PREDICTED: TMV resistance protein N-like         52.8    4e-05   
ref|XP_008459550.1|  PREDICTED: TMV resistance protein N-like         52.8    4e-05   
gb|KHG06036.1|  TMV resistance N                                      52.0    4e-05   
ref|XP_008346275.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  52.8    4e-05   
ref|XP_006492771.1|  PREDICTED: uncharacterized protein LOC102623315  51.6    4e-05   
ref|XP_011004903.1|  PREDICTED: TMV resistance protein N-like iso...  52.8    4e-05   
ref|XP_010646753.1|  PREDICTED: disease resistance protein RPS4-l...  52.0    4e-05   
ref|XP_011466312.1|  PREDICTED: TMV resistance protein N-like iso...  52.8    4e-05   
ref|XP_008342043.1|  PREDICTED: putative disease resistance prote...  52.8    5e-05   
ref|XP_006366334.1|  PREDICTED: TMV resistance protein N-like         52.8    5e-05   
ref|XP_008231898.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  52.4    5e-05   
ref|XP_004305008.1|  PREDICTED: TMV resistance protein N-like iso...  52.8    5e-05   
ref|XP_008245756.1|  PREDICTED: TMV resistance protein N-like         52.4    5e-05   
ref|XP_009630491.1|  PREDICTED: uncharacterized protein LOC104120435  52.8    5e-05   
ref|XP_009336497.1|  PREDICTED: TMV resistance protein N-like         52.4    5e-05   
emb|CAN75658.1|  hypothetical protein VITISV_003715                   52.8    5e-05   
gb|KJB45701.1|  hypothetical protein B456_007G322300                  52.4    5e-05   
gb|AFP55572.1|  TIR-NBS-LRR                                           52.4    5e-05   
ref|XP_008366706.1|  PREDICTED: uncharacterized protein LOC103430351  51.6    5e-05   
ref|XP_009368497.1|  PREDICTED: TMV resistance protein N-like         52.4    6e-05   
ref|NP_199338.1|  protein RESISTANT TO P. SYRINGAE 4                  52.4    6e-05   
ref|XP_008365303.1|  PREDICTED: TMV resistance protein N-like         52.4    6e-05   
ref|XP_010263320.1|  PREDICTED: TMV resistance protein N-like         52.0    6e-05   
ref|XP_011011969.1|  PREDICTED: TMV resistance protein N-like iso...  52.4    7e-05   
ref|XP_011011967.1|  PREDICTED: TMV resistance protein N-like iso...  52.4    7e-05   
gb|KEH27163.1|  disease resistance protein (TIR-NBS-LRR class), p...  52.0    7e-05   
ref|XP_011011966.1|  PREDICTED: TMV resistance protein N-like iso...  52.0    7e-05   
ref|XP_008358366.1|  PREDICTED: uncharacterized protein LOC103422108  50.8    7e-05   
gb|AES76800.2|  disease resistance protein (TIR-NBS-LRR class), p...  52.0    8e-05   
sp|Q9SCX7.1|RPS4R_ARATH  RecName: Full=Inactive disease resistanc...  52.0    8e-05   
sp|Q9SCX6.1|RPS4L_ARATH  RecName: Full=Disease resistance protein...  52.0    8e-05   
sp|C4B7M7.1|RPS4W_ARATH  RecName: Full=Disease resistance protein...  52.0    8e-05   
ref|XP_002325658.2|  hypothetical protein POPTR_0019s09630g           52.0    8e-05   
emb|CAN78931.1|  hypothetical protein VITISV_024045                   52.0    8e-05   
ref|XP_002863505.1|  predicted protein                                52.0    8e-05   
ref|XP_003620582.1|  Elongation factor Ts                             52.0    8e-05   
ref|XP_006442215.1|  hypothetical protein CICLE_v10024552mg           51.6    8e-05   
ref|XP_006442185.1|  hypothetical protein CICLE_v10018526mg           52.0    8e-05   
ref|XP_009373343.1|  PREDICTED: uncharacterized protein LOC103962365  50.8    9e-05   
gb|KDO39755.1|  hypothetical protein CISIN_1g003683mg                 51.6    9e-05   
ref|XP_006441872.1|  hypothetical protein CICLE_v10019116mg           51.6    9e-05   
ref|XP_006478456.1|  PREDICTED: TMV resistance protein N-like iso...  51.6    9e-05   
ref|XP_007023140.1|  Disease resistance protein                       51.6    9e-05   
emb|CDY01603.1|  BnaC07g35930D                                        51.6    9e-05   
ref|XP_008235972.1|  PREDICTED: TMV resistance protein N-like         51.6    9e-05   
ref|XP_010495168.1|  PREDICTED: uncharacterized protein LOC104772229  51.6    9e-05   
ref|XP_007023138.1|  Disease resistance protein                       51.6    9e-05   
ref|XP_010665271.1|  PREDICTED: TMV resistance protein N-like iso...  51.6    9e-05   
ref|XP_010665451.1|  PREDICTED: TMV resistance protein N-like         51.6    9e-05   
ref|XP_010644013.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  51.6    1e-04   
gb|KDO39753.1|  hypothetical protein CISIN_1g003683mg                 51.6    1e-04   
ref|XP_010070575.1|  PREDICTED: TMV resistance protein N-like         51.6    1e-04   
ref|XP_011470169.1|  PREDICTED: TMV resistance protein N-like         51.6    1e-04   
gb|KHG06681.1|  putative WRKY transcription factor 19 -like protein   51.6    1e-04   
ref|XP_011470429.1|  PREDICTED: TMV resistance protein N-like         51.6    1e-04   
ref|XP_009368475.1|  PREDICTED: TMV resistance protein N-like         51.2    1e-04   
ref|XP_006494039.1|  PREDICTED: uncharacterized protein LOC102617...  51.2    1e-04   
ref|XP_008237412.1|  PREDICTED: TMV resistance protein N-like         51.6    1e-04   
gb|KDO39754.1|  hypothetical protein CISIN_1g003683mg                 51.6    1e-04   
gb|KDO39752.1|  hypothetical protein CISIN_1g003683mg                 51.2    1e-04   
emb|CAN78790.1|  hypothetical protein VITISV_027418                   51.6    1e-04   
ref|XP_006494038.1|  PREDICTED: uncharacterized protein LOC102617...  50.8    1e-04   
gb|AEE43925.1|  TIR-NBS-LRR resistance protein muRdr1A                51.2    1e-04   
ref|XP_009779694.1|  PREDICTED: TMV resistance protein N-like         51.2    1e-04   
ref|XP_010665270.1|  PREDICTED: TMV resistance protein N-like iso...  51.2    1e-04   
ref|XP_009335993.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  51.2    1e-04   
ref|XP_004243783.1|  PREDICTED: TMV resistance protein N-like         51.2    1e-04   
ref|XP_003607692.1|  Tir-nbs-lrr resistance protein                   51.2    1e-04   
ref|XP_008377793.1|  PREDICTED: uncharacterized protein LOC103440870  50.8    1e-04   
ref|XP_006396809.1|  hypothetical protein EUTSA_v10028373mg           51.2    1e-04   
gb|KDP23892.1|  hypothetical protein JCGZ_26634                       50.1    1e-04   
emb|CAN78475.1|  hypothetical protein VITISV_009815                   50.4    1e-04   
ref|XP_010665269.1|  PREDICTED: TMV resistance protein N-like iso...  51.2    1e-04   
ref|XP_008382085.1|  PREDICTED: uncharacterized protein LOC103444904  50.8    1e-04   
ref|XP_008377792.1|  PREDICTED: uncharacterized protein LOC103440869  50.8    1e-04   
gb|KDO44265.1|  hypothetical protein CISIN_1g003496mg                 51.2    1e-04   
ref|XP_010665266.1|  PREDICTED: TMV resistance protein N-like iso...  51.2    1e-04   
ref|XP_006494858.1|  PREDICTED: TMV resistance protein N-like iso...  51.2    1e-04   
ref|XP_006495322.1|  PREDICTED: TMV resistance protein N-like         50.8    1e-04   
ref|XP_004292718.1|  PREDICTED: TMV resistance protein N-like iso...  51.2    2e-04   
ref|XP_011458820.1|  PREDICTED: TMV resistance protein N-like iso...  50.8    2e-04   
gb|AHN52026.1|  NBS20                                                 50.8    2e-04   
ref|XP_010455634.1|  PREDICTED: TMV resistance protein N-like         50.8    2e-04   
ref|XP_010108456.1|  TMV resistance protein N                         50.8    2e-04   
gb|AEE43927.1|  TIR-NBS-LRR resistance protein muRdr1C                50.8    2e-04   
ref|XP_006441388.1|  hypothetical protein CICLE_v10018571mg           50.8    2e-04   
ref|XP_004292400.2|  PREDICTED: TMV resistance protein N-like         50.8    2e-04   
gb|KDP25808.1|  hypothetical protein JCGZ_22530                       50.8    2e-04   
ref|XP_006441871.1|  hypothetical protein CICLE_v10024379mg           50.8    2e-04   
ref|XP_006582197.1|  PREDICTED: TMV resistance protein N-like         50.8    2e-04   
ref|XP_007220190.1|  hypothetical protein PRUPE_ppa015427mg           50.8    2e-04   
emb|CBI39274.3|  unnamed protein product                              50.4    2e-04   
emb|CBI35550.3|  unnamed protein product                              50.1    2e-04   
emb|CBI39281.3|  unnamed protein product                              49.3    2e-04   
ref|XP_009355597.1|  PREDICTED: TMV resistance protein N-like iso...  50.4    2e-04   
ref|XP_009355602.1|  PREDICTED: TMV resistance protein N-like iso...  50.4    2e-04   
gb|KDO42839.1|  hypothetical protein CISIN_1g003011mg                 50.4    2e-04   
emb|CAN68030.1|  hypothetical protein VITISV_003124                   50.4    2e-04   
ref|XP_009355599.1|  PREDICTED: TMV resistance protein N-like iso...  50.4    2e-04   
ref|XP_007227381.1|  hypothetical protein PRUPE_ppb015618mg           50.4    2e-04   
ref|XP_006466121.1|  PREDICTED: TMV resistance protein N-like iso...  50.4    2e-04   
ref|XP_006441764.1|  hypothetical protein CICLE_v10023258mg           50.4    2e-04   
ref|XP_010665188.1|  PREDICTED: TMV resistance protein N-like iso...  50.4    2e-04   
ref|XP_009355610.1|  PREDICTED: TMV resistance protein N-like iso...  50.4    2e-04   
ref|XP_006466122.1|  PREDICTED: TMV resistance protein N-like iso...  50.4    2e-04   
ref|XP_006495327.1|  PREDICTED: TMV resistance protein N-like         50.4    2e-04   
emb|CAN83385.1|  hypothetical protein VITISV_004581                   50.4    2e-04   
ref|XP_011469124.1|  PREDICTED: TMV resistance protein N-like         50.4    2e-04   
ref|XP_011458821.1|  PREDICTED: TMV resistance protein N-like iso...  50.4    2e-04   
emb|CDY01606.1|  BnaC07g35960D                                        50.4    2e-04   
ref|XP_007201150.1|  hypothetical protein PRUPE_ppa015450mg           50.4    2e-04   
ref|NP_197290.1|  TIR-NBS-LRR class disease resistance protein        50.4    2e-04   
ref|XP_008235982.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  50.4    2e-04   
gb|KDO45098.1|  hypothetical protein CISIN_1g009084mg                 50.1    2e-04   
dbj|BAB11221.1|  disease resistance protein                           50.4    2e-04   
gb|AES77881.2|  hypothetical protein MTR_7g021420                     49.3    3e-04   
gb|KJB46023.1|  hypothetical protein B456_007G344000                  50.4    3e-04   
ref|XP_009336841.1|  PREDICTED: TMV resistance protein N-like         50.1    3e-04   
ref|XP_008377829.1|  PREDICTED: uncharacterized protein LOC103440911  48.9    3e-04   
ref|XP_007023132.1|  Disease resistance protein, putative             50.1    3e-04   
emb|CDY23141.1|  BnaC09g18950D                                        50.1    3e-04   
ref|XP_008372646.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  50.1    3e-04   
ref|XP_008372648.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  50.1    3e-04   
ref|XP_009340497.1|  PREDICTED: TMV resistance protein N-like         50.1    3e-04   
ref|XP_008392497.1|  PREDICTED: TMV resistance protein N-like         50.1    3e-04   
gb|AFP55548.1|  TIR-NBS-LRR                                           50.1    3e-04   
ref|XP_008219411.1|  PREDICTED: TMV resistance protein N-like         50.1    3e-04   
ref|XP_009345315.1|  PREDICTED: TMV resistance protein N-like         50.1    3e-04   
ref|XP_002277814.2|  PREDICTED: TMV resistance protein N-like         50.1    3e-04   
ref|XP_006492793.1|  PREDICTED: putative disease resistance prote...  50.1    3e-04   
ref|XP_008377712.1|  PREDICTED: uncharacterized protein LOC103440785  49.7    4e-04   
gb|KDO38386.1|  hypothetical protein CISIN_1g044234mg                 49.3    4e-04   
emb|CAN82538.1|  hypothetical protein VITISV_004290                   49.7    4e-04   
ref|XP_009134252.1|  PREDICTED: TMV resistance protein N-like         49.7    4e-04   
ref|XP_007200162.1|  hypothetical protein PRUPE_ppa016630mg           49.7    4e-04   
gb|KDO40698.1|  hypothetical protein CISIN_1g0007802mg                49.7    4e-04   
ref|XP_004141627.1|  PREDICTED: TMV resistance protein N-like         49.7    4e-04   
ref|XP_004492774.1|  PREDICTED: TMV resistance protein N-like iso...  49.7    4e-04   
ref|XP_008222883.1|  PREDICTED: TMV resistance protein N-like         49.7    4e-04   
ref|XP_008347565.1|  PREDICTED: TMV resistance protein N-like         49.7    4e-04   
gb|KDO40699.1|  hypothetical protein CISIN_1g0007802mg                49.7    4e-04   
gb|AAP44391.1|  nematode resistance-like protein                      49.7    4e-04   
gb|AAP44394.1|  nematode resistance-like protein                      49.7    4e-04   
ref|XP_006442182.1|  hypothetical protein CICLE_v100185201mg          49.7    4e-04   
ref|XP_010665340.1|  PREDICTED: TMV resistance protein N-like         49.7    4e-04   
ref|XP_008236147.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  49.7    4e-04   
gb|KGN52644.1|  hypothetical protein Csa_5G648650                     49.7    4e-04   
ref|XP_004288231.2|  PREDICTED: disease resistance protein RPS6-like  49.3    4e-04   
gb|KDO40813.1|  hypothetical protein CISIN_1g0008742mg                49.3    5e-04   
ref|XP_003621663.1|  TMV resistance protein N                         48.9    5e-04   
gb|KDO45460.1|  hypothetical protein CISIN_1g001889mg                 49.7    5e-04   
ref|XP_008237663.1|  PREDICTED: TMV resistance protein N-like         49.3    5e-04   
gb|KCW58787.1|  hypothetical protein EUGRSUZ_H01423                   49.3    5e-04   
ref|XP_008235803.1|  PREDICTED: TMV resistance protein N-like iso...  49.3    5e-04   
ref|XP_010026206.1|  PREDICTED: TMV resistance protein N-like         49.3    5e-04   
gb|AES89895.2|  disease resistance protein (TIR-NBS-LRR class), p...  49.3    5e-04   
ref|XP_003607698.1|  Tir-nbs-lrr resistance protein                   49.3    5e-04   
gb|KDO40660.1|  hypothetical protein CISIN_1g020571mg                 48.5    5e-04   
ref|XP_008235806.1|  PREDICTED: TMV resistance protein N-like iso...  49.3    5e-04   
gb|KHN27789.1|  TMV resistance protein N                              49.3    5e-04   
ref|XP_010657780.1|  PREDICTED: TMV resistance protein N-like iso...  49.3    5e-04   
emb|CBI39202.3|  unnamed protein product                              49.3    6e-04   
ref|XP_009343511.1|  PREDICTED: TMV resistance protein N-like         48.9    6e-04   
emb|CBI17052.3|  unnamed protein product                              49.3    6e-04   
gb|AES89888.2|  disease resistance protein (TIR-NBS-LRR class)        49.3    6e-04   
emb|CAN79645.1|  hypothetical protein VITISV_033789                   49.3    6e-04   
ref|XP_003607691.1|  Tir-nbs-lrr resistance protein                   49.3    6e-04   
ref|XP_006376189.1|  hypothetical protein POPTR_0013s10670g           48.5    7e-04   
ref|NP_001235644.1|  TIR-NBS-LRR type disease resistance protein      49.3    7e-04   
ref|XP_010644028.1|  PREDICTED: uncharacterized protein LOC100261885  49.3    7e-04   
gb|KDP28980.1|  hypothetical protein JCGZ_19531                       48.9    7e-04   
ref|XP_004156244.1|  PREDICTED: TMV resistance protein N-like         48.9    7e-04   
ref|XP_007023130.1|  Disease resistance protein, putative             48.9    7e-04   
ref|XP_010665467.1|  PREDICTED: TMV resistance protein N-like         48.9    7e-04   
gb|KCW58788.1|  hypothetical protein EUGRSUZ_H01423                   48.9    7e-04   
ref|XP_009344801.1|  PREDICTED: TMV resistance protein N-like         48.9    7e-04   
ref|XP_008339190.1|  PREDICTED: TMV resistance protein N-like         48.9    7e-04   
ref|XP_006478374.1|  PREDICTED: TMV resistance protein N-like         48.9    7e-04   
ref|XP_002873860.1|  predicted protein                                48.9    7e-04   
ref|XP_006376195.1|  hypothetical protein POPTR_0013s107402g          48.9    8e-04   
gb|KJB45637.1|  hypothetical protein B456_007G319200                  48.5    8e-04   
ref|XP_007201496.1|  hypothetical protein PRUPE_ppa014797mg           48.9    8e-04   
ref|XP_008235417.1|  PREDICTED: TMV resistance protein N-like         48.9    8e-04   
gb|KDO39455.1|  hypothetical protein CISIN_1g039656mg                 48.9    8e-04   
ref|XP_007201517.1|  hypothetical protein PRUPE_ppa015410mg           48.9    8e-04   
ref|XP_009343508.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  48.5    8e-04   
ref|XP_003556672.1|  PREDICTED: putative disease resistance prote...  48.9    8e-04   
ref|XP_010320698.1|  PREDICTED: TMV resistance protein N-like iso...  48.9    8e-04   
ref|XP_011464790.1|  PREDICTED: TMV resistance protein N-like         48.9    9e-04   
gb|KHN08045.1|  Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1          48.5    9e-04   
gb|ABI34381.1|  Leucine Rich Repeat family protein                    48.5    9e-04   
emb|CAN82897.1|  hypothetical protein VITISV_026993                   48.5    9e-04   
gb|KDO40659.1|  hypothetical protein CISIN_1g020571mg                 48.1    0.001   
ref|XP_010320695.1|  PREDICTED: TMV resistance protein N-like iso...  48.5    0.001   
ref|XP_008347558.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  48.5    0.001   
ref|XP_006389220.1|  hypothetical protein POPTR_0035s00380g           48.5    0.001   
gb|KGN59547.1|  hypothetical protein Csa_3G824920                     48.5    0.001   
gb|ABF81427.1|  TIR-NBS-LRR-TIR type disease resistance protein       48.5    0.001   
ref|XP_009601110.1|  PREDICTED: TMV resistance protein N-like         48.5    0.001   
ref|XP_002521758.1|  TMV resistance protein N, putative               48.5    0.001   
emb|CAN84090.1|  hypothetical protein VITISV_003077                   48.5    0.001   



>ref|XP_006364843.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1230

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 117/163 (72%), Gaps = 2/163 (1%)
 Frame = +1

Query  25    TADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAIS  204
              ADLLL+ LLQG+ST   +FSILI GGKIPEWF  QKMGRS+S+ LP DW  N  G A S
Sbjct  996   AADLLLHLLLQGHSTFYSQFSILIAGGKIPEWFGYQKMGRSISVQLPTDWQDNIAGVAFS  1055

Query  205   VVFEPMAQNSRIGITFKLISQNHKEYTTDS--ISSTTMTGEICESGHVWMGFLSFRLFQL  378
              VFE +   S++G+TFKLIS NH+EYT +S   S+ +  GE  +  H+W+ ++SF LF+L
Sbjct  1056  FVFECLVPKSKLGVTFKLISPNHREYTFESAPASAASKMGEEYKYDHLWIAYISFHLFRL  1115

Query  379   LFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDIV  507
             LFP+   +D +K+  CL+I++R EPW K +RCGI LVYK+D+ 
Sbjct  1116  LFPEFTTEDWSKVCCCLSISLRQEPWTKVRRCGIHLVYKKDLT  1158



>ref|XP_004233763.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1228

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 2/162 (1%)
 Frame = +1

Query  25    TADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAIS  204
              ADLLL  LLQG+ST   +FSILI GGKIP+WF  QKMGRS+S+ LP DW  N  G A S
Sbjct  994   AADLLLQLLLQGHSTFYSQFSILIGGGKIPDWFGYQKMGRSISVQLPTDWQDNIAGVAFS  1053

Query  205   VVFEPMAQNSRIGITFKLISQNHKEYTTDS--ISSTTMTGEICESGHVWMGFLSFRLFQL  378
              VFE +   S++G+TFKLIS NH+EY+ +S   S+ +  GE  +  H+W+ ++SF LF+L
Sbjct  1054  FVFECLVPKSKLGVTFKLISPNHREYSFESAPASAASKMGEEGKYDHLWIAYISFHLFRL  1113

Query  379   LFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             LFP+  ++D TK+  CL+I++R EPW K +RCGI LVYK+D+
Sbjct  1114  LFPEFTIEDWTKVCCCLSISLRQEPWTKARRCGIHLVYKKDL  1155



>ref|XP_009803658.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1237

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 120/173 (69%), Gaps = 5/173 (3%)
 Frame = +1

Query  1     KLCEANKNT----ADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPP  168
             KL E +K T    ADLLL  LLQG+S    RFSILI GGKIP WF  QK+G S+S+ LP 
Sbjct  982   KLHEQSKKTGICAADLLLELLLQGHSIIYGRFSILIAGGKIPVWFDHQKIGGSISVQLPS  1041

Query  169   DWHANFIGFAISVVFEPMAQNSRIGITFKLISQNHKEYT-TDSISSTTMTGEICESGHVW  345
             DW  N +G A+  V +     SR+G+TFKL+S +H+EYT  ++ S+ +  GE+ +S HVW
Sbjct  1042  DWQVNIVGIAVCFVLDSFIPKSRLGVTFKLVSPDHREYTFQNAPSAASKMGEVYDSDHVW  1101

Query  346   MGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             + ++SF LF+LLFPD   +D TK+ G L+I +R +PW K +RCGI+LVYK+D+
Sbjct  1102  ITYISFNLFRLLFPDFTTEDWTKVCGNLSIRIRQDPWTKVRRCGIQLVYKQDL  1154



>ref|XP_009622249.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1238

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 120/173 (69%), Gaps = 5/173 (3%)
 Frame = +1

Query  1     KLCEANKNTA----DLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPP  168
             KL E +K T     DLLL  LLQG+S    RFSIL+ GGKIP WF  QK+G S+S+ LP 
Sbjct  983   KLHEQSKKTGIFAVDLLLELLLQGHSIIYGRFSILVAGGKIPVWFDHQKVGGSISVQLPS  1042

Query  169   DWHANFIGFAISVVFEPMAQNSRIGITFKLISQNHKEYTTDSI-SSTTMTGEICESGHVW  345
             DW  N +G A+  V +     S++G+TFKL+S +H+EYT+++  S+ +  GE+ +S HVW
Sbjct  1043  DWQDNIVGIAVCFVLDSFIPKSKLGVTFKLVSLDHREYTSENAPSAASKMGEVYDSDHVW  1102

Query  346   MGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             + ++SF LF+LLFPD   +D +K+ G L+I +R +PW K +RCGI+LVYK+D+
Sbjct  1103  ITYISFNLFRLLFPDFTTEDWSKVCGSLSIRIRQDPWTKVRRCGIQLVYKQDL  1155



>ref|XP_010646550.1| PREDICTED: disease resistance protein RPS4-like [Vitis vinifera]
Length=284

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 78/158 (49%), Gaps = 22/158 (14%)
 Frame = +1

Query  73   NRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV--FEPMAQNSRIG  243
            N  FS ++PG +IP+WFS Q  GR V+I LPP+W ++NF+GFA+S V  F+ +  +    
Sbjct  97   NIEFSTVVPGSEIPDWFSYQSSGRKVNIELPPNWFNSNFLGFALSAVLGFDALPSHDPNF  156

Query  244  ITFKLIS----QNHKEYTTDSISSTTMTGEICESGHVWMGFL----SFRLFQLLFPDIGV  399
              F L      QN     +D++        + ES H+W+G+     SF+  ++       
Sbjct  157  NVFSLFCIFDFQNSAASYSDNVFHLNSGPALIESDHLWLGYAPVVSSFKWHEV-------  209

Query  400  DDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDIVXE  513
                  F    +A  N      KRCGIRLVY  + V +
Sbjct  210  ----NHFEAAFMAFTNNLALVVKRCGIRLVYSSEDVSD  243



>ref|XP_007199034.1| hypothetical protein PRUPE_ppa018060mg [Prunus persica]
 gb|EMJ00233.1| hypothetical protein PRUPE_ppa018060mg [Prunus persica]
Length=1107

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 81/146 (55%), Gaps = 18/146 (12%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKL  258
             RF IL PG KIPEWFS+Q +G S+++ LP  W    +G A+ VVFE  A  S   + F++
Sbjct  942   RFEILTPGRKIPEWFSNQSLGDSLTVELPTTW----MGIALCVVFEVPADLSEF-LCFRI  996

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
              S + +E +T   S +   G++  S H+W+ FLS + F+ ++  I V     +F   T  
Sbjct  997   TSFS-QEKSTHRFSRSFKIGDVV-SDHLWVIFLSHKQFEKIYGQIKV-----LFT--TDY  1047

Query  439   VRNEPWNKP----KRCGIRLVYKEDI  504
              ++  W       KRCG  LV+++D+
Sbjct  1048  SQDIMWGDKKSCVKRCGFCLVHEQDV  1073



>ref|XP_006360469.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1239

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 88/176 (50%), Gaps = 21/176 (12%)
 Frame = +1

Query  31    DLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISV  207
             D L N +L+G S  +  FSI IPG ++P+WF  + +G S+S+ LP +W+ N F+GFA+ V
Sbjct  982   DSLWNHMLKGLSMVDDEFSICIPGSEVPDWFMYKNLGPSLSVKLPKNWYTNKFMGFALCV  1041

Query  208   VF----EPMAQN-------SRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGF  354
             VF    EP   N       ++  + FKL+  + K         +  + E  +SGH  + +
Sbjct  1042  VFDSFKEPSCMNHGYLKKITQFHLMFKLVRHDGKAGLLFKSIGSVGSEECPDSGHTLLAY  1101

Query  355   LSFRLFQLLFPD--IGVDDCTKIFGCLTIA-VRNEPWNKPKRCGIRLVYKEDIVXE  513
              SF  F   +       +D  +I  C T A V  + W      G+ L+Y+ DI+ E
Sbjct  1102  TSFDNFWSTYEKCVCNPNDWIQIKVCGTDANVAIKGW------GMHLLYENDIINE  1151



>emb|CBI39355.3| unnamed protein product [Vitis vinifera]
Length=332

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 66/144 (46%), Gaps = 4/144 (3%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGITFKL  258
            +  L+PG +IP+WF+ Q +G  V + LPP W+   ++G A  VVF           TF L
Sbjct  166  YQALVPGSRIPKWFTHQSVGSKVIVELPPHWYNTKWMGLAACVVFNFKGAVDGYRGTFPL  225

Query  259  ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                +  Y T S  ++  T  I ES H W  ++S    +  +P    +    +       
Sbjct  226  ACFLNGRYATLSDHNSLWTSSIIESDHTWFAYISRAELEARYPPWTGELSDYMLASFLFL  285

Query  439  VRN---EPWNKPKRCGIRLVYKED  501
            V         + K+CG+RLVY+ED
Sbjct  286  VPEGAVTSHGEVKKCGVRLVYEED  309



>emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera]
Length=1414

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 69/142 (49%), Gaps = 16/142 (11%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPD-WHANFIGFAISVVFEPMAQNSRIGITFK  255
             R+  ++PG +IPEWF+ Q  G S+++ LPP  ++ N IG A   VF P     +IG +  
Sbjct  1070  RYDAVVPGSRIPEWFTHQSEGDSITVELPPGCYNTNSIGLAACAVFHPKFSMGKIGRSAY  1129

Query  256   LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
                     ++ D+ +S   +    ++ H+W G+        L   + + D  K+      
Sbjct  1130  FSVNESGGFSLDNTTSMHFS----KADHIWFGY-------RLISGVDLRDHLKV----AF  1174

Query  436   AVRNEPWNKPKRCGIRLVYKED  501
             A    P    K+CG+RLVY++D
Sbjct  1175  ATSKVPGEVVKKCGVRLVYEQD  1196



>ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010657774.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010657775.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1291

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 69/142 (49%), Gaps = 16/142 (11%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPD-WHANFIGFAISVVFEPMAQNSRIGITFK  255
             R+  ++PG +IPEWF+ Q  G S+++ LPP  ++ N IG A   VF P     +IG +  
Sbjct  1097  RYDAVVPGSRIPEWFTHQSEGDSITVELPPGCYNTNSIGLAACAVFHPKFSMGKIGRSAY  1156

Query  256   LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
                     ++ D+ +S   +    ++ H+W G+        L   + + D  K+      
Sbjct  1157  FSVNESGGFSLDNTTSMHFS----KADHIWFGY-------RLISGVDLRDHLKV----AF  1201

Query  436   AVRNEPWNKPKRCGIRLVYKED  501
             A    P    K+CG+RLVY++D
Sbjct  1202  ATSKVPGEVVKKCGVRLVYEQD  1223



>ref|XP_004237202.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1251

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 21/176 (12%)
 Frame = +1

Query  31    DLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISV  207
             D L N +L+G S  +  FSI IPG ++P+WF  + +G S+S+ LP +W+ N F+GFA+ V
Sbjct  981   DSLWNHMLKGLSMVDDEFSICIPGSEVPDWFMYKNLGPSLSVKLPKNWYTNKFMGFALCV  1040

Query  208   VFEPMAQNSRIG-----------ITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGF  354
             VF+   + S +            + FKL+  + K         +  + E  +SGH  + +
Sbjct  1041  VFDSFKEPSCMNNAYLQKIPGFLVMFKLVRHDGKTGVFFKSIGSVGSEECPDSGHTLLAY  1100

Query  355   LSFRLFQLLFPD--IGVDDCTKIFGCLTIA-VRNEPWNKPKRCGIRLVYKEDIVXE  513
              SF  F  ++       +D  +I  C T A V  + W      G+ L+Y+ DI+ +
Sbjct  1101  ASFDNFWSMYEKHVCNPNDWIQIEVCETDANVAIKGW------GMHLLYENDIIND  1150



>ref|XP_008231886.1| PREDICTED: TMV resistance protein N-like isoform X1 [Prunus mume]
Length=1179

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 83/166 (50%), Gaps = 14/166 (8%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-F  186
             E++ +    +L   LQ  S    RF I+IPG KIP WFS Q++G SVSI + P+W  N +
Sbjct  1011  ESHDHKTFTMLRKYLQRISYPGDRFEIVIPGSKIPWWFSRQRVGSSVSIQVTPNWCDNKW  1070

Query  187   IGFAISVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFR  366
             +G+A+  VF+  +    +     +  Q  KEY    +S+         S H+W+ ++S  
Sbjct  1071  MGYALCAVFQVFSSGWELSCVLDVNGQ--KEYPAPVLSTDVQPV----SDHLWLFYVS--  1122

Query  367   LFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
                + F       C +    LT +  +   +  K+CG RL+Y++D+
Sbjct  1123  -RDITFGTEWQKGCDR----LTFSFESSGPSMVKKCGARLIYEQDV  1163



>ref|XP_008231887.1| PREDICTED: TMV resistance protein N-like isoform X2 [Prunus mume]
 ref|XP_008231888.1| PREDICTED: TMV resistance protein N-like isoform X2 [Prunus mume]
 ref|XP_008231889.1| PREDICTED: TMV resistance protein N-like isoform X2 [Prunus mume]
Length=1137

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 83/166 (50%), Gaps = 14/166 (8%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-F  186
             E++ +    +L   LQ  S    RF I+IPG KIP WFS Q++G SVSI + P+W  N +
Sbjct  969   ESHDHKTFTMLRKYLQRISYPGDRFEIVIPGSKIPWWFSRQRVGSSVSIQVTPNWCDNKW  1028

Query  187   IGFAISVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFR  366
             +G+A+  VF+  +    +     +  Q  KEY    +S+         S H+W+ ++S  
Sbjct  1029  MGYALCAVFQVFSSGWELSCVLDVNGQ--KEYPAPVLSTDVQPV----SDHLWLFYVS--  1080

Query  367   LFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
                + F       C +    LT +  +   +  K+CG RL+Y++D+
Sbjct  1081  -RDITFGTEWQKGCDR----LTFSFESSGPSMVKKCGARLIYEQDV  1121



>ref|XP_010645918.1| PREDICTED: inactive disease resistance protein RPS4-like [Vitis 
vinifera]
 emb|CAN62507.1| hypothetical protein VITISV_028498 [Vitis vinifera]
Length=587

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 86/172 (50%), Gaps = 20/172 (12%)
 Frame = +1

Query  10   EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NF  186
            +++  T+ +++  LL+     N  FSI+ PG  IPEW   Q +G S+ I LP DWH+ +F
Sbjct  370  DSSVTTSPVMMQKLLE-----NIAFSIVFPGTGIPEWIWHQNVGSSIKIQLPTDWHSDDF  424

Query  187  IGFAISVVFEPMAQNSRIGITFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGFL--  357
            +GFA+  V E + +     +   + +  + K++  D       TG I  S HVW+G+   
Sbjct  425  LGFALCSVLEHLPERIICHLNSDVFNYGDLKDFGHD----FHWTGNIVGSEHVWLGYQPC  480

Query  358  -SFRLFQLLFPDIGVDDCTKIFGCLTIAVR--NEPWNKPKRCGIRLVYKEDI  504
               RLFQ   P    ++   I      A R  +   N  K+CG+ L+Y ED+
Sbjct  481  SQLRLFQFNDP----NEWNHIEISFEAAHRFNSSASNVVKKCGVCLIYAEDL  528



>ref|XP_010645869.1| PREDICTED: putative disease resistance protein At4g11170 [Vitis 
vinifera]
 ref|XP_010645870.1| PREDICTED: putative disease resistance protein At4g11170 [Vitis 
vinifera]
Length=1010

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 73/152 (48%), Gaps = 17/152 (11%)
 Frame = +1

Query  61    NSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIP-LPPDWH-ANFIGFAISVVFEPMAQNS  234
             N   N  F IL+PG  IP+WF D+KMG SV+I  LPP+WH  NF+GFA+  VF   A   
Sbjct  869   NLAPNNEFCILLPGSGIPDWFGDRKMGCSVAIEKLPPEWHQVNFLGFAVCFVF---ASEH  925

Query  235   RIGITFKLISQNHKEYT-TDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCT  411
              I     ++S    ++  + + S      E  ES H+W+ +      +   P     D T
Sbjct  926   EIPEHTPVVSCKINDFRFSYAFSCGRGENEFVESDHLWLAYQPRARVENFHP----YDWT  981

Query  412   KI---FGCLTIAVRNEPWNKPKRCGIRLVYKE  498
             +I   F    I  R    NK K C I L+Y +
Sbjct  982   QIKASFEVFGIGTR----NKVKECAISLIYAD  1009



>ref|XP_010657771.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
 ref|XP_010657772.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=1359

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 74/142 (52%), Gaps = 13/142 (9%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFEPMAQNSRIGITFKL  258
             +  ++PG  IPEWF+DQ +G SV++ LPP W+    IG A+  VF P     + G +   
Sbjct  1174  YDAVVPGSSIPEWFTDQSVGCSVTVELPPHWYTTRLIGLAVCAVFHPNISKGKFGRSAYF  1233

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                    ++ D+ +S   +    ++ H+W G+ S  LF ++F    +D     F   + +
Sbjct  1234  SMNESVGFSIDNTASMHFS----KAEHIWFGYRS--LFGVVFSR-SIDHLEVSF---SES  1283

Query  439   VRNEPWNKPKRCGIRLVYKEDI  504
             +R       K+CG+RL++++D+
Sbjct  1284  IR--AGEVVKKCGVRLIFEQDL  1303



>ref|XP_010646551.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010646552.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010646553.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010646554.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010646555.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1158

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 79/156 (51%), Gaps = 24/156 (15%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV--FEPMAQ---NSRI  240
              FS ++PG +IP+WFS Q  G  V+I LPP+W ++NF+GFA+S V  F+P+     N ++
Sbjct  931   EFSTVVPGSEIPDWFSYQSSGNVVNIELPPNWFNSNFLGFALSAVFGFDPLPDYNPNHKV  990

Query  241   GITFKLIS-QNHKEYTTDSISSTTMTGEICESGHVWMGFL----SFRLFQLLFPDIGVDD  405
                F + S QN      D++        + ES H+W+G+     SF+  ++         
Sbjct  991   FCLFCIFSFQNSAASYRDNVFHYNSGPALIESDHLWLGYAPVVSSFKWHEVNH----FKA  1046

Query  406   CTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDIVXE  513
               +I+G   +          KRCGI LVY  + V +
Sbjct  1047  AFQIYGRHFVV---------KRCGIHLVYSSEDVSD  1073



>ref|XP_010665417.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 emb|CAN82909.1| hypothetical protein VITISV_025072 [Vitis vinifera]
Length=1177

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 66/144 (46%), Gaps = 4/144 (3%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGITFKL  258
             +  L+PG +IP+WF+ Q +G  V + LPP W+   ++G A  VVF           TF L
Sbjct  1011  YQALVPGSRIPKWFTHQSVGSKVIVELPPHWYNTKWMGLAACVVFNFKGAVDGYRGTFPL  1070

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                 +  Y T S  ++  T  I ES H W  ++S    +  +P    +    +       
Sbjct  1071  ACFLNGRYATLSDHNSLWTSSIIESDHTWFAYISRAELEARYPPWTGELSDYMLASFLFL  1130

Query  439   VRN---EPWNKPKRCGIRLVYKED  501
             V         + K+CG+RLVY+ED
Sbjct  1131  VPEGAVTSHGEVKKCGVRLVYEED  1154



>ref|XP_010657770.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1374

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 74/142 (52%), Gaps = 13/142 (9%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFEPMAQNSRIGITFKL  258
             +  ++PG  IPEWF+DQ +G SV++ LPP W+    IG A+  VF P     + G +   
Sbjct  1174  YDAVVPGSSIPEWFTDQSVGCSVTVELPPHWYTTRLIGLAVCAVFHPNISKGKFGRSAYF  1233

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                    ++ D+ +S   +    ++ H+W G+ S  LF ++F    +D     F   + +
Sbjct  1234  SMNESVGFSIDNTASMHFS----KAEHIWFGYRS--LFGVVFSR-SIDHLEVSF---SES  1283

Query  439   VRNEPWNKPKRCGIRLVYKEDI  504
             +R       K+CG+RL++++D+
Sbjct  1284  IR--AGEVVKKCGVRLIFEQDL  1303



>emb|CBI40966.3| unnamed protein product [Vitis vinifera]
Length=1201

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 79/156 (51%), Gaps = 24/156 (15%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV--FEPMAQ---NSRI  240
              FS ++PG +IP+WFS Q  G  V+I LPP+W ++NF+GFA+S V  F+P+     N ++
Sbjct  931   EFSTVVPGSEIPDWFSYQSSGNVVNIELPPNWFNSNFLGFALSAVFGFDPLPDYNPNHKV  990

Query  241   GITFKLIS-QNHKEYTTDSISSTTMTGEICESGHVWMGFL----SFRLFQLLFPDIGVDD  405
                F + S QN      D++        + ES H+W+G+     SF+  ++         
Sbjct  991   FCLFCIFSFQNSAASYRDNVFHYNSGPALIESDHLWLGYAPVVSSFKWHEV----NHFKA  1046

Query  406   CTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDIVXE  513
               +I+G   +          KRCGI LVY  + V +
Sbjct  1047  AFQIYGRHFVV---------KRCGIHLVYSSEDVSD  1073



>ref|XP_009358304.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1264

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 79/156 (51%), Gaps = 16/156 (10%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQ-----NSRI  240
             R +++ PG +IP WFSDQ+ G SV+I L PDW    F GFA+S V   +++     + R 
Sbjct  1101  RINVVCPGKEIPNWFSDQREGSSVNIKLCPDWFRKGFSGFALSAVVSGVSKPKNDLSVRA  1160

Query  241   GITFKLISQNHKEYTTDSISSTTMTGEICESGH---VW-MGFLSFRLFQLLFPDI-GVDD  405
                 K + + H+ +T+      +   + C   H   VW   F S  + ++  PD+  + +
Sbjct  1161  NFIVKFMGERHELFTSSFFIPRSSQKDYCYGQHHVYVWNRAFRSEEVAKICSPDVYKLAN  1220

Query  406   CTKIFGCLTIAVRNEPWN----KPKRCGIRLVYKED  501
                +  C  + +R EP +    K + CGIRL+Y +D
Sbjct  1221  EASVEFC-PVVLRREPASYSHMKVESCGIRLLYAQD  1255



>ref|XP_002514796.1| hypothetical protein RCOM_1077370 [Ricinus communis]
 gb|EEF47350.1| hypothetical protein RCOM_1077370 [Ricinus communis]
Length=968

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  76   RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFE  216
            R+F ++IPG  IP+W SDQ  G SV+IPLPP+W  NF+GFA+ +VFE
Sbjct  788  RKFVVIIPGNIIPKWISDQSSGYSVTIPLPPNWFHNFLGFAVGIVFE  834



>emb|CAN68630.1| hypothetical protein VITISV_003859 [Vitis vinifera]
Length=1500

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 86/172 (50%), Gaps = 20/172 (12%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NF  186
             +++  T+ +++  LL+     N  FSI+ PG  IPEW   Q +G S+ I LP DW++ +F
Sbjct  1283  DSSVTTSPVMMQKLLE-----NIAFSIVFPGTGIPEWIWHQNVGSSIKIQLPTDWYSDDF  1337

Query  187   IGFAISVVFEPMAQNSRIGITFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGFL--  357
             +GFA+  V E + +     +   +    + K++  D       TG+I  S HVW+G+   
Sbjct  1338  LGFALCSVLEHLPERIICHLNSDVFDYGDLKDFGHD----FHWTGDIVGSEHVWLGYQPC  1393

Query  358   -SFRLFQLLFPDIGVDDCTKIFGCLTIAVR--NEPWNKPKRCGIRLVYKEDI  504
                RLFQ   P    ++   I      A R  +   N  K+CG+ L+Y ED+
Sbjct  1394  SQLRLFQFNDP----NEWNHIEISFEAAHRFNSSASNVVKKCGVCLIYAEDL  1441



>emb|CBI34029.3| unnamed protein product [Vitis vinifera]
Length=192

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGITFK  255
             +SI++PG  IPEWF    +G SV+I LPP+WH  +F+GFA+  VF         G    
Sbjct  9    EYSIVLPGSTIPEWFQHPSIGSSVTIELPPNWHNKDFLGFALCSVFSLEEDEIIQGSGLV  68

Query  256  LISQNHKE--YTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFP-DIGVDDCTKIFGC  426
              +   +E  Y + SIS T     + E+ H+W+ +      +L+ P    ++   KI   
Sbjct  69   CCNFEFREGPYLSSSISWTHSGDRVIETDHIWLVYQPGA--KLMIPKSSSLNKFRKITAY  126

Query  427  LTIAVRNEPWNKPKRCGIRLVYKED  501
             +++  +   +  K CGI L+Y  D
Sbjct  127  FSLSGAS---HVVKNCGIHLIYARD  148



>emb|CBI18506.3| unnamed protein product [Vitis vinifera]
Length=599

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 76/153 (50%), Gaps = 20/153 (13%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV--FEPMAQNSRIGITF  252
            FSI +PG +IP+W S+Q +G  V+I LPP W  +NF+GFA+  V  FE +A N   G + 
Sbjct  407  FSIFLPGSEIPDWISNQNLGSEVTIELPPHWFESNFLGFAVCCVFAFEDIAPN---GCSS  463

Query  253  KLISQNHKE--------YTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGV--D  402
            +L+ Q   +        +   SI     + +  +S H+W+ +      ++ + D      
Sbjct  464  QLLCQLQSDESHFRGIGHILHSIDCEGNSEDRLKSHHMWLAYKPRGRLRISYGDCPNRWR  523

Query  403  DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
                 FG ++      P N  ++CGI L+Y +D
Sbjct  524  HAKASFGFISCC----PSNMVRKCGIHLIYAQD  552



>emb|CBI25016.3| unnamed protein product [Vitis vinifera]
Length=208

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 73/151 (48%), Gaps = 15/151 (10%)
 Frame = +1

Query  73   NRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NFIGFAISVVFEPMAQNSRIGIT  249
            N  FSI+ PG  IP+W   Q +G S+ I LP DW++ +F+GFA+  V E + +     + 
Sbjct  7    NIAFSIVFPGTGIPDWIWHQNVGSSIKIQLPTDWYSDDFLGFALCSVLEHLPERIICHLN  66

Query  250  FKLISQNH-KEYTTDSISSTTMTGEICESGHVWMGFL---SFRLFQLLFPDIGVDDCTKI  417
              +      K++  D       TG I  S HVW+G+      RLFQ   P    ++   I
Sbjct  67   SDVFDYGDLKDFGHD----FHWTGNIVGSEHVWLGYQPCSQLRLFQFNDP----NEWNHI  118

Query  418  FGCLTIAVR--NEPWNKPKRCGIRLVYKEDI  504
                  A R  +   N  K+CG+ L+Y ED+
Sbjct  119  EISFEAAHRFNSSASNVVKKCGVCLIYAEDL  149



>ref|XP_008373276.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1153

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 74/156 (47%), Gaps = 26/156 (17%)
 Frame = +1

Query  67    TRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQN-----  231
             +R +  +++ PG +IPEWFS+Q +G SV++ LPP    N++G A  +VF+   QN     
Sbjct  972   SRRKAPNVVWPGSEIPEWFSNQSVGNSVNVELPPPSCTNWLGIAFCLVFQDHKQNLANPT  1031

Query  232   --SRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDD  405
                R  I F   S+N   Y    ++ TT  G           F+S  L    FP      
Sbjct  1032  APRRFTIQF---SEN---YLDSLLAITTKVG----------SFVSEHLLVFYFPREQCHR  1075

Query  406   CTKIFGCLTIAVRNE---PWNKPKRCGIRLVYKEDI  504
                +F    + + N     +N  K+CG RLVYK+D+
Sbjct  1076  EQFLFETYFVDIENNVKADFNSVKKCGARLVYKQDL  1111



>ref|XP_010665235.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665237.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1276

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 76/153 (50%), Gaps = 20/153 (13%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV--FEPMAQNSRIGITF  252
             FSI +PG +IP+W S+Q +G  V+I LPP W  +NF+GFA+  V  FE +A N   G + 
Sbjct  1084  FSIFLPGSEIPDWISNQNLGSEVTIELPPHWFESNFLGFAVCCVFAFEDIAPN---GCSS  1140

Query  253   KLISQNHKE--------YTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGV--D  402
             +L+ Q   +        +   SI     + +  +S H+W+ +      ++ + D      
Sbjct  1141  QLLCQLQSDESHFRGIGHILHSIDCEGNSEDRLKSHHMWLAYKPRGRLRISYGDCPNRWR  1200

Query  403   DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
                  FG ++      P N  ++CGI L+Y +D
Sbjct  1201  HAKASFGFISCC----PSNMVRKCGIHLIYAQD  1229



>gb|KDP31604.1| hypothetical protein JCGZ_14829 [Jatropha curcas]
Length=1115

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 76/164 (46%), Gaps = 23/164 (14%)
 Frame = +1

Query  46    SLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NFIGFAISVVFEPM  222
             S LQ  + +  RF +++PG +IP+WFS QKMG SV+I L  +W+   F G A+  VF   
Sbjct  897   SQLQEVTYQGCRFDVIVPGTEIPDWFSQQKMGSSVTIQLTANWYTEKFKGLAVCPVFASF  956

Query  223   --------AQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQL  378
                      Q S I I  KL  +      T             ++ H+WMGF S      
Sbjct  957   DNQDLLTGGQASDIAIYCKL--EAIGSSGTSVFKFLIYRVPSLQADHLWMGFHS------  1008

Query  379   LFPDIGVDDCTKIFGCLTIAVRNEPWN---KPKRCGIRLVYKED  501
                 IG    + +  C ++ V  EP     + K+CG+RLVY ++
Sbjct  1009  ---RIGFGTSSLLNKCHSLRVSFEPSAPGVQVKKCGVRLVYDQN  1049



>emb|CBI35541.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 68/148 (46%), Gaps = 6/148 (4%)
 Frame = +1

Query  70   RNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGI  246
             N  FSI+ PG +IPEW   Q +  S+ I LP DW+  +F GF +  V E      RI  
Sbjct  6    ENIAFSIVFPGSEIPEWIWHQNVRSSIKIELPTDWYNDDFWGFVVCSVLEHFP--GRITC  63

Query  247  TFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGC  426
                    + +   D      + G    S HVW+G+      +LL P I  +D ++I   
Sbjct  64   HLNSDVLGYGKIMKDFGHDLHLKGNNVGSKHVWLGYQPLAHLRLL-PFIDPNDLSQIEIS  122

Query  427  LTIAVR--NEPWNKPKRCGIRLVYKEDI  504
                 R  +   N  K+CG+RL+Y E++
Sbjct  123  FEATNRFNSRASNVVKKCGVRLIYAEEL  150



>ref|XP_007201559.1| hypothetical protein PRUPE_ppa017840mg [Prunus persica]
 gb|EMJ02758.1| hypothetical protein PRUPE_ppa017840mg [Prunus persica]
Length=1167

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 73/143 (51%), Gaps = 14/143 (10%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFEPMAQNSRIGITFK  255
             R+ I+IPG +IP WFS Q++G SVS+ L P WH N + G+A+  VFE       +    K
Sbjct  994   RYEIVIPGTEIPSWFSHQRVGSSVSVQLTPRWHDNKWKGYALCTVFEVFGSGWELNCFLK  1053

Query  256   LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
             +   N KE     +  T +      S H+W+ ++S     L F +     C +    L  
Sbjct  1054  V---NGKEQYPAPLLVTNVQP---LSDHLWLLYIS---RDLTFGNEWQHSCNQ----LIF  1100

Query  436   AVRNEPWNKPKRCGIRLVYKEDI  504
             + ++   +  K+CG RLVY++D+
Sbjct  1101  SFKSSGPSLVKKCGARLVYEQDV  1123



>ref|XP_009343129.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1402

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 86/181 (48%), Gaps = 34/181 (19%)
 Frame = +1

Query  31    DLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQK-MGRSVSIPLPPDWH-ANFIGFAIS  204
             ++L   L QGNS+    F I IPG +IP+WFS Q  +G S++I LPP W+ + F+G+A+ 
Sbjct  954   EMLKKFLHQGNSSARETFQIAIPGSEIPKWFSHQNDVGSSLTIDLPPLWNKSRFMGYALC  1013

Query  205   VVF---EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEIC---------------E  330
              VF   E    +      FK     H  +    +  +    ++C               +
Sbjct  1014  AVFVLDEHCVVDEHDTFHFKTFHATH--HLVCRLKHSGKQLKVCGTQPAFRFSEKFCQVD  1071

Query  331   SGHVWMGFLSFRLFQLLFPDIGVD---DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             S H+WM ++S   +       G+D    C++I        R  P  K K+CG+RL+Y++D
Sbjct  1072  SDHLWMFYVSRDKY------FGMDWHNSCSQIE--FLFETRG-PGLKVKKCGVRLMYEQD  1122

Query  502   I  504
             +
Sbjct  1123  V  1123



>ref|XP_010657776.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=439

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 71/143 (50%), Gaps = 15/143 (10%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFK  255
            R+  ++PG  IPEWF+DQ +G SV++  PP W +   +G A+ VVF P     + G +  
Sbjct  286  RYDAVVPGSSIPEWFTDQSLGCSVTVEPPPHWCNTRLMGLAVCVVFHPNIGMGKFGRSAY  345

Query  256  LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLF-PDIGVDDCTKIFGCLT  432
                    ++  + +S   +    +  H+W G+    L+  +F P I   D  K+    +
Sbjct  346  FSMNESGGFSLHNTASMHFS----KVDHIWFGYRP--LYGGVFSPSI---DHLKV----S  392

Query  433  IAVRNEPWNKPKRCGIRLVYKED  501
             A  N      K+CG+RLV+++D
Sbjct  393  FAGSNRAGEVVKKCGVRLVFEQD  415



>emb|CAN66453.1| hypothetical protein VITISV_004613 [Vitis vinifera]
Length=1441

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 85/172 (49%), Gaps = 20/172 (12%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NF  186
             +++  T+ +++  LL+     N  FSI+ PG  IP+W   Q +G S+ I LP DW++ +F
Sbjct  1224  DSSVTTSPVMMQKLLE-----NIAFSIVFPGTGIPDWIWHQNVGSSIKIQLPTDWYSDDF  1278

Query  187   IGFAISVVFEPMAQNSRIGITFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGFL--  357
             +GFA+  V E + +     +   +    + K++  D       TG I  S HVW+G+   
Sbjct  1279  LGFALCSVLEHLPERIICHLNSDVFDYGDLKDFGHD----FHWTGNIVGSEHVWLGYQPC  1334

Query  358   -SFRLFQLLFPDIGVDDCTKIFGCLTIAVR--NEPWNKPKRCGIRLVYKEDI  504
                RLFQ   P    ++   I      A R  +   N  K+CG+ L+Y ED+
Sbjct  1335  SQLRLFQFNDP----NEWNHIEISFEAAHRFNSSASNVVKKCGVCLIYAEDL  1382



>gb|KDO41149.1| hypothetical protein CISIN_1g041975mg [Citrus sinensis]
Length=543

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (50%), Gaps = 15/151 (10%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSR---IGI  246
            R SI  PG +IPEWFS Q MG SV++ LPP W + NF+GFA+  +F     ++R   +  
Sbjct  383  RGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIFPEFRGDTRNLLVDS  442

Query  247  TFKLISQNHKEYTTDSI----SSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDD--C  408
             FKL +++   +    +    +         ES HV +G+     F +    +G  D  C
Sbjct  443  EFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGY----DFSMDLDGLGGSDKAC  498

Query  409  TKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             + +    +  R E ++  K+CG  L+Y +D
Sbjct  499  IQFYIGNYLDKRTEGFDV-KKCGAHLIYAQD  528



>ref|XP_010648148.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1250

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 80/167 (48%), Gaps = 11/167 (7%)
 Frame = +1

Query  13    ANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFI  189
             A  N A +L    L+ N      +SI++PG  IPEWF    +G SV+I LPP+WH  +F+
Sbjct  1047  AQDNGATIL--EKLRQNFLPEIEYSIVLPGSTIPEWFQHPSIGSSVTIELPPNWHNKDFL  1104

Query  190   GFAISVVFEPMAQNSRIGITFKLISQNHKE--YTTDSISSTTMTGEICESGHVWMGFLSF  363
             GFA+  VF         G      +   +E  Y + SIS T     + E+ H+W+ +   
Sbjct  1105  GFALCSVFSLEEDEIIQGSGLVCCNFEFREGPYLSSSISWTHSGDRVIETDHIWLVYQPG  1164

Query  364   RLFQLLFP-DIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
                +L+ P    ++   KI    +++  +   +  K CGI L+Y  D
Sbjct  1165  A--KLMIPKSSSLNKFRKITAYFSLSGAS---HVVKNCGIHLIYARD  1206



>emb|CAN76072.1| hypothetical protein VITISV_004552 [Vitis vinifera]
Length=380

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 67/148 (45%), Gaps = 6/148 (4%)
 Frame = +1

Query  70   RNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGI  246
            RN  FSI+ PG +IPEW   Q +  S+ I LP DW+  +F GF +  V E      RI  
Sbjct  177  RNIAFSIVFPGSEIPEWXWHQNVRSSIKIELPTDWYNDDFXGFVVCSVLEHFP--GRITC  234

Query  247  TFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGC  426
                    + +   D        G    S HVW+G+      +LL P I  +D ++I   
Sbjct  235  HLNSDVLGYGKIMKDFGHDLHXKGNNVGSKHVWLGYQPLAXLRLL-PFIDPNDLSQIEIS  293

Query  427  LTIAVR--NEPWNKPKRCGIRLVYKEDI  504
                 R  +   N  K+CG+RL+Y E +
Sbjct  294  FEATNRFXSRASNVVKKCGVRLIYAEXL  321



>ref|XP_010645953.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1398

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 86/172 (50%), Gaps = 20/172 (12%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NF  186
             +++  T+ +++  LL+     N  FSI+ PG  IPEW   Q +G S+ I LP +W++ +F
Sbjct  1181  DSSVTTSPVMMQKLLE-----NIAFSIVFPGTGIPEWIWHQNVGSSIKIQLPTNWYSDDF  1235

Query  187   IGFAISVVFEPMAQNSRIGITFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGFL--  357
             +GFA+  V E + +     +   + +  + K++  D       TG I  S HVW+G+   
Sbjct  1236  LGFALCSVLEHLPERIICHLNSDVFNYGDLKDFGHD----FHWTGNIVGSEHVWLGYQPC  1291

Query  358   -SFRLFQLLFPDIGVDDCTKIFGCLTIAVR--NEPWNKPKRCGIRLVYKEDI  504
                RLFQ   P    ++   I      A R  +   N  K+CG+ L+Y ED+
Sbjct  1292  SQLRLFQFNDP----NEWNHIEISFEAAHRFNSSASNVVKKCGVCLIYAEDL  1339



>emb|CAN64645.1| hypothetical protein VITISV_042806 [Vitis vinifera]
Length=754

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 85/172 (49%), Gaps = 20/172 (12%)
 Frame = +1

Query  10   EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-F  186
            +++  T+ +++  LL+     N  FSI+ PG  IPEW   Q +G S+ I LP DW ++ F
Sbjct  537  DSSVTTSPVMMQKLLE-----NIAFSIVFPGTGIPEWIWHQNVGSSIKIQLPTDWXSDXF  591

Query  187  IGFAISVVFEPMAQNSRIGITFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGFL--  357
            +GFA+  V E + +     +   + +  + K++  D       TG I  S HVW+G+   
Sbjct  592  LGFALCSVLEHLPERIICHLNSDVFNYGDLKDFGHD----FHWTGNIVGSEHVWLGYQPC  647

Query  358  -SFRLFQLLFPDIGVDDCTKIFGCLTIAVR--NEPWNKPKRCGIRLVYKEDI  504
               RLFQ   P    ++   I      A R  +   N  K+CG+ L+Y ED+
Sbjct  648  SQLRLFQFNDP----NEWNHIEISFEAAHRFNSXTSNVVKKCGVCLIYAEDL  695



>emb|CDP04904.1| unnamed protein product [Coffea canephora]
Length=1201

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 89/187 (48%), Gaps = 21/187 (11%)
 Frame = +1

Query  4     LCEANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN  183
             L E   +  D   N +L+     +  FSI +PGG+IP WF+ Q  G S+ I LP +W+++
Sbjct  976   LDEQTSSMIDATWNHMLEELLLVDDNFSICLPGGRIPSWFTYQNWGPSIRIKLPSNWYSD  1035

Query  184   -FIGFAISVVFEPMAQNSR----------IGITFKLISQNHKEYTTDSISSTTMTG--EI  324
              F+GFA+  V + +               + I F LI Q  K    D + +    G  + 
Sbjct  1036  EFMGFAVCAVSDLITTTLEGRDLLQKIPGVRIQFNLIDQEEK--ICDGMFTLGYVGSEKK  1093

Query  325   CESGHVWMGFLSFRLFQLLFPDIGVDDCT-KIFGCLTIA--VRNEPWNKPKRCGIRLVYK  495
              +S H  + +LSF    LLF D     C+   + C+ ++  V ++ +   K  GI LVYK
Sbjct  1094  IDSEHTCLAYLSFDEIWLLFFD---KVCSPNEWTCVEVSADVYSKKYMVFKAWGISLVYK  1150

Query  496   EDIVXET  516
             +D+   T
Sbjct  1151  DDVRQNT  1157



>ref|XP_002521767.1| leucine-rich repeat-containing protein, putative [Ricinus communis]
 gb|EEF40577.1| leucine-rich repeat-containing protein, putative [Ricinus communis]
Length=994

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 73/165 (44%), Gaps = 25/165 (15%)
 Frame = +1

Query  46   SLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFE--  216
            S LQ  S    RF +++PG ++P WFS Q +G S+ I L P W+   F G AI + F   
Sbjct  771  SQLQDASYTGCRFDVIVPGTEVPAWFSHQNVGSSLIIQLTPKWYNEKFKGLAICLSFATH  830

Query  217  ------PMAQNSRIGITFKLISQNHKEYT-TDSISSTTMTGEICESGHVWMGFLSFRLFQ  375
                  P   ++ I I  KL +    EYT T S           +S H+WMGF S     
Sbjct  831  ENPHLLPDGLSTDIAIYCKLEAV---EYTSTSSFKFLIYRVPSLKSNHLWMGFHS-----  882

Query  376  LLFPDIGVDDCTKIFGCLTIAVRNE---PWNKPKRCGIRLVYKED  501
                 IG      +  C  + V  E   P  + K CGIR VY +D
Sbjct  883  ----RIGFGKSNWLNNCGYLKVSFESSVPCMEVKYCGIRFVYDQD  923



>ref|XP_010645852.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1245

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 78/169 (46%), Gaps = 15/169 (9%)
 Frame = +1

Query  13    ANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFI  189
             A  N A +L    L  N      +SI++PG  IPEWF    +G S +I LPP+WH  +F+
Sbjct  1041  AQDNVATIL--EKLHQNFLPEIEYSIVLPGSTIPEWFQHPSIGSSETIELPPNWHNKDFL  1098

Query  190   GFAISVVF-----EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGF  354
             GFA+  VF     E +    +I   FK        Y + SIS T     + E+ H+W+ +
Sbjct  1099  GFALCSVFTLEEDEIIQGPGQICCNFKF---REGPYLSSSISWTHSGDRVVETDHIWLVY  1155

Query  355   LSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
                    ++     ++   KI    +++  +      K CGI L+Y +D
Sbjct  1156  QPGAKL-MISKTSSLNKFKKITAYFSLSGASHVM---KNCGIHLIYAQD  1200



>emb|CBI23849.3| unnamed protein product [Vitis vinifera]
Length=868

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 13/141 (9%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKL  258
            +  ++PG  IPEWF+DQ +G SV++ LPP W     +G A+  VF P     + G +   
Sbjct  699  YDAVVPGSSIPEWFTDQSLGCSVTVELPPHWCTTRLMGLAVCFVFHPNIGMGKFGRSEYF  758

Query  259  ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                   ++  + +ST  +    ++ H+W G+      ++  P I   D  K+    + A
Sbjct  759  SMNESGGFSLHNTASTHFS----KADHIWFGYRPL-YGEVFSPSI---DHLKV----SFA  806

Query  439  VRNEPWNKPKRCGIRLVYKED  501
              N      K+CG RLV+++D
Sbjct  807  GSNRAGEVVKKCGARLVFEQD  827



>ref|XP_010657788.1| PREDICTED: TMV resistance protein N-like isoform X3 [Vitis vinifera]
Length=1243

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 13/141 (9%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKL  258
             +  ++PG  IPEWF+DQ +G SV++ LPP W     +G A+  VF P     + G +   
Sbjct  1092  YDAVVPGSSIPEWFTDQSLGCSVTVELPPHWCTTRLMGLAVCFVFHPNIGMGKFGRSEYF  1151

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                    ++  + +ST  +    ++ H+W G+      ++  P I   D  K+    + A
Sbjct  1152  SMNESGGFSLHNTASTHFS----KADHIWFGYRPL-YGEVFSPSI---DHLKV----SFA  1199

Query  439   VRNEPWNKPKRCGIRLVYKED  501
               N      K+CG RLV+++D
Sbjct  1200  GSNRAGEVVKKCGARLVFEQD  1220



>ref|XP_010657787.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=1259

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 13/141 (9%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKL  258
             +  ++PG  IPEWF+DQ +G SV++ LPP W     +G A+  VF P     + G +   
Sbjct  1092  YDAVVPGSSIPEWFTDQSLGCSVTVELPPHWCTTRLMGLAVCFVFHPNIGMGKFGRSEYF  1151

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                    ++  + +ST  +    ++ H+W G+      ++  P I   D  K+    + A
Sbjct  1152  SMNESGGFSLHNTASTHFS----KADHIWFGYRPL-YGEVFSPSI---DHLKV----SFA  1199

Query  439   VRNEPWNKPKRCGIRLVYKED  501
               N      K+CG RLV+++D
Sbjct  1200  GSNRAGEVVKKCGARLVFEQD  1220



>ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010657781.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010657782.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010657783.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010657784.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010657785.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010657786.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1261

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 13/141 (9%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKL  258
             +  ++PG  IPEWF+DQ +G SV++ LPP W     +G A+  VF P     + G +   
Sbjct  1092  YDAVVPGSSIPEWFTDQSLGCSVTVELPPHWCTTRLMGLAVCFVFHPNIGMGKFGRSEYF  1151

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                    ++  + +ST  +    ++ H+W G+      ++  P I   D  K+    + A
Sbjct  1152  SMNESGGFSLHNTASTHFS----KADHIWFGYRPL-YGEVFSPSI---DHLKV----SFA  1199

Query  439   VRNEPWNKPKRCGIRLVYKED  501
               N      K+CG RLV+++D
Sbjct  1200  GSNRAGEVVKKCGARLVFEQD  1220



>ref|XP_010657789.1| PREDICTED: TMV resistance protein N-like isoform X4 [Vitis vinifera]
Length=1070

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 13/141 (9%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKL  258
             +  ++PG  IPEWF+DQ +G SV++ LPP W     +G A+  VF P     + G +   
Sbjct  901   YDAVVPGSSIPEWFTDQSLGCSVTVELPPHWCTTRLMGLAVCFVFHPNIGMGKFGRSEYF  960

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                    ++  + +ST  +    ++ H+W G+      ++  P I   D  K+    + A
Sbjct  961   SMNESGGFSLHNTASTHFS----KADHIWFGYRPL-YGEVFSPSI---DHLKV----SFA  1008

Query  439   VRNEPWNKPKRCGIRLVYKED  501
               N      K+CG RLV+++D
Sbjct  1009  GSNRAGEVVKKCGARLVFEQD  1029



>ref|XP_009343065.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=279

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 70/141 (50%), Gaps = 21/141 (15%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
            + I+ PG  IPEWF++Q +G S+++ LPP   ++++G A  VVF   A+ +    +F++ 
Sbjct  119  YHIVCPGKGIPEWFNNQTVGHSLNVELPPQSCSSWMGIAFCVVF---AKKNYPYYSFEI-  174

Query  262  SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAV  441
                       IS      E   S H+W+ +LS    Q  F     + C  + G      
Sbjct  175  ------KCLPGISCYIYETEHMVSEHLWIFYLSREQCQEQF---SFETCYIVGG------  219

Query  442  RNEPWNKPKRCGIRLVYKEDI  504
             NEP N  K CG RLVYK+D+
Sbjct  220  -NEP-NMVKMCGARLVYKQDL  238



>ref|XP_009336515.1| PREDICTED: TMV resistance protein N-like, partial [Pyrus x bretschneideri]
Length=1082

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 71/149 (48%), Gaps = 14/149 (9%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
              +++IPG +IPEWFS+Q +G S+++ LPP    N++G A  VVF+   QN       +  
Sbjct  918   LNVVIPGSEIPEWFSNQSVGHSINVELPPPSCTNWLGIAFCVVFQDPKQNLANPAALRHY  977

Query  262   SQNHKEYTTDSISSTTMTGEICE--SGHVWMGFLSFRLFQLLFPDIGVDDCTK---IFGC  426
              +    Y+        +   I    S H+W+ +L        + +   +DC +   +F  
Sbjct  978   DRFEIWYSDAHFGHRVLINRIGSVVSKHLWVFYLHH------YRNQRREDCLQEQCLFET  1031

Query  427   LTIAVRNE---PWNKPKRCGIRLVYKEDI  504
                 +  +     N  K+CG RLVY++D+
Sbjct  1032  YFFDIEGQLKADLNMVKKCGARLVYEQDL  1060



>emb|CAN68108.1| hypothetical protein VITISV_013549 [Vitis vinifera]
Length=1236

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 70/146 (48%), Gaps = 20/146 (14%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISV------VFEPMAQNSRI  240
             +  ++PG +IPEWF DQ  G SV++ LPP W+    +G A+        V +P  +  R 
Sbjct  1052  YDAIVPGSRIPEWFVDQSTGSSVTVELPPHWYNTKLMGMAVCAVIGATGVIDPTIEEWRP  1111

Query  241   GITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIF  420
              I FK  S  ++    D+I S +M  +     H W  +LS        P  G     K  
Sbjct  1112  QIYFKCSSVIYQ--GDDAIMSRSMKDD-----HTWFRYLSLCWLHGRTPPFG-----KSR  1159

Query  421   GCLTIAVRN-EPWNKPKRCGIRLVYK  495
             G + ++  + E   + K+CG+RLVY+
Sbjct  1160  GSMVVSFGSWEEKLEVKKCGVRLVYE  1185



>ref|XP_010665420.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1200

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 70/146 (48%), Gaps = 20/146 (14%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISV------VFEPMAQNSRI  240
             +  ++PG +IPEWF DQ  G SV++ LPP W+    +G A+        V +P  +  R 
Sbjct  1016  YDAIVPGSRIPEWFVDQSTGSSVTVELPPHWYNTKLMGMAVCAVIGATGVIDPTIEEWRP  1075

Query  241   GITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIF  420
              I FK  S  ++    D+I S +M  +     H W  +LS        P  G     K  
Sbjct  1076  QIYFKCSSVIYQ--GDDAIMSRSMKDD-----HTWFRYLSLCWLHGRTPPFG-----KSR  1123

Query  421   GCLTIAVRN-EPWNKPKRCGIRLVYK  495
             G + ++  + E   + K+CG+RLVY+
Sbjct  1124  GSMVVSFGSWEEKLEVKKCGVRLVYE  1149



>gb|AEE43928.1| TIR-NBS-LRR resistance protein muRdr1D [Rosa multiflora]
Length=1156

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 76/154 (49%), Gaps = 22/154 (14%)
 Frame = +1

Query  76    RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFEPMAQNSRIGITF  252
             RRF  +IPG +IPEWF +Q +G SV+  LP     N +IGFA+  +F P    S +    
Sbjct  959   RRFRFVIPGSEIPEWFDNQSVGDSVTEKLPSGACNNKWIGFAVCALFVPQDNPSAVPEDP  1018

Query  253   KLISQNHK---EYTTDSISSTTMTGEICESGHVW--MGFLSFRLFQLLF------PDIGV  399
              L+    +    + +D ISS          GH +    F+S  LF L+F      PD   
Sbjct  1019  GLVPDTCEIWCRWNSDGISS---------GGHGFPVKQFVSDHLFLLVFPSPFRNPDYTW  1069

Query  400   DDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             ++  K F  +T AV N    K K+CG+R +Y+ D
Sbjct  1070  NE-VKFFFKVTRAVGNNTCIKVKKCGVRALYEHD  1102



>ref|XP_008245424.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=435

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 77/168 (46%), Gaps = 18/168 (11%)
 Frame = +1

Query  34   LLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVF  213
            L++   LQ        F I+IPG +IPEWF +Q +G SV   LP D ++ ++GFA   +F
Sbjct  205  LMVKKFLQEIPRSLSFFGIVIPGSEIPEWFHNQSVGNSVIETLPSDSNSKWVGFAFCALF  264

Query  214  EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICE--SGHVWMGFLSFRLFQLLFP  387
             P  + S        + Q    Y  ++ +      +I +  S H+W+  LS + F   F 
Sbjct  265  APAQEISATATKPPNLIQFRCLYDLNTFAGPNYVIDIKDVASDHLWLILLSRQHF---FR  321

Query  388  DIGVDDCTKIFGCLTIAVR----------NEPWNKPKRCGIRLVYKED  501
              G     K   C  + +R           + W K K+CG+R +Y++D
Sbjct  322  GSGTYWREK---CCDLKIRFHFVGRTFTGEKAWVKVKKCGVRALYEQD  366



>ref|XP_004290249.2| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011458233.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1129

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 79/163 (48%), Gaps = 14/163 (9%)
 Frame = +1

Query  25    TADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAI  201
             T  +LL   L+G S    RF I+IPG  IP  FS Q++G SVS+ L   W+ N ++G+A+
Sbjct  964   TFTMLLQRYLEGTSDSGDRFEIVIPGSHIPWLFSHQRVGPSVSVDLNSGWNDNKWMGYAL  1023

Query  202   SVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTM-TGEICESGHVWMGFLSFRL-FQ  375
             S VFE       +    +  +   +EY    +S+     GE     H+W+ +++    F 
Sbjct  1024  SAVFEVFGGGWELSCVLE--ANGKQEYPAPLLSTDVQPVGE-----HLWLFYVTRDTSFG  1076

Query  376   LLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
               F     + C      L  + ++      ++CG RL+Y+ED+
Sbjct  1077  TSFGTGWQNSCNN----LMFSFKSSGLCYVRKCGARLIYEEDV  1115



>ref|XP_009347942.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
 ref|XP_009347943.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1182

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 73/147 (50%), Gaps = 26/147 (18%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQN-----SRIGITF  252
             +++PG +IP+WFS+Q +G SVS+ LPP    +++G A  +VF+   QN     + IG   
Sbjct  1012  LVLPGSEIPKWFSNQSVGNSVSLKLPPPSCTDWLGIAFCLVFQDPNQNLANQPAYIGHVI  1071

Query  253   KLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLF---QLLFPDIGVDDCTKIFG  423
             +L++ N +  T   +S            H+W+ +L  +     Q LF        T I  
Sbjct  1072  ELLNNNLRHNTGSLLSE-----------HLWVFYLPRKYCHEEQFLFR-------TYISN  1113

Query  424   CLTIAVRNEPWNKPKRCGIRLVYKEDI  504
                   +   +N  K+CG RLVYK+D+
Sbjct  1114  VRVPEKQYADFNCVKKCGARLVYKQDL  1140



>ref|XP_008381892.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=458

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (47%), Gaps = 14/149 (9%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
              ++IPG +IPEWFS+Q +G S+++ LPP    N++G A  VVF+   QN          
Sbjct  276  LKVVIPGSEIPEWFSNQSVGHSINVELPPPSCTNWLGIAFCVVFQDPKQNLANPAALXHY  335

Query  262  SQNHKEYTTDSISSTTMTGEI--CESGHVWMGFLSFRLFQLLFPDIGVDDCTK---IFGC  426
             +    Y+    S   +   I    S H+W+ +L        + +   +DC +   +F  
Sbjct  336  DRFEIWYSDAHFSHRVLINRIGSXXSEHLWVFYLR------RYRNQRREDCLQEQCLFET  389

Query  427  LTIAVRNE---PWNKPKRCGIRLVYKEDI  504
                +  +     N  K+CG RLVY++D+
Sbjct  390  YFFDIEGQLKADLNMVKKCGARLVYEQDL  418



>emb|CAN64759.1| hypothetical protein VITISV_033530 [Vitis vinifera]
Length=1206

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 72/156 (46%), Gaps = 34/156 (22%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF--EPMAQNSRIGITF  252
             F +++PG  IPEWF  Q MG SV++ LPP W+ A  +G A+  VF  +P+       + +
Sbjct  1040  FHVIVPGSSIPEWFIHQNMGSSVTVELPPHWYNAKLMGLAVCAVFHADPIDWGY---LQY  1096

Query  253   KLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFG---  423
              L    HK  +    + + M G+     HVW G+ S          +G +D    FG   
Sbjct  1097  SLYRGEHKYDSYMLQTWSPMKGD-----HVWFGYQSL---------VGXEDDRMWFGERS  1142

Query  424   ----------CL-TIAVRNEPWNKPKRCGIRLVYKE  498
                       C+ +  V  +P    K+CG+RL Y++
Sbjct  1143  GTXKILFSGHCIKSCJVCVQPEVVVKKCGVRLAYEQ  1178



>ref|XP_008358303.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=506

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (47%), Gaps = 14/149 (9%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
              ++IPG +IPEWFS+Q +G S+++ LPP    N++G A  VVF+   QN          
Sbjct  292  LKVVIPGSEIPEWFSNQSVGHSINVELPPPSCTNWLGIAFCVVFQDPKQNLANPAALXHY  351

Query  262  SQNHKEYTTDSISSTTMTGEI--CESGHVWMGFLSFRLFQLLFPDIGVDDCTK---IFGC  426
             +    Y+    S   +   I    S H+W+ +L        + +   +DC +   +F  
Sbjct  352  DRFEIWYSDAHFSHRVLINRIGSXXSEHLWVFYLRR------YRNQRREDCLQEQCLFET  405

Query  427  LTIAVRNE---PWNKPKRCGIRLVYKEDI  504
                +  +     N  K+CG RLVY++D+
Sbjct  406  XFFDIEGQLKADLNMVKKCGARLVYEQDL  434



>ref|XP_010661243.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=1167

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 34/165 (21%)
 Frame = +1

Query  55    QGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF--EPMA  225
             +G+      F +++PG  IPEWF  Q MG SV++ LPP W+ A  +G A+  VF  +P+ 
Sbjct  983   KGSPVPYNDFHVIVPGSSIPEWFIHQNMGSSVTVELPPHWYNAKLMGLAVCAVFHADPID  1042

Query  226   QNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDD  405
                   + + L    HK  +    + + M G+     HVW G+ S          +G +D
Sbjct  1043  WGY---LQYSLYRGEHKYDSYMLQTWSPMKGD-----HVWFGYQSL---------VGQED  1085

Query  406   CTKIFG-------------CL-TIAVRNEPWNKPKRCGIRLVYKE  498
                 FG             C+ +  V  +P    K+CG+RL Y++
Sbjct  1086  DRMWFGERSGTLKILFSGHCIKSCIVCVQPEVVVKKCGVRLAYEQ  1130



>ref|XP_010661240.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010661241.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010661242.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1215

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 34/165 (21%)
 Frame = +1

Query  55    QGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF--EPMA  225
             +G+      F +++PG  IPEWF  Q MG SV++ LPP W+ A  +G A+  VF  +P+ 
Sbjct  1031  KGSPVPYNDFHVIVPGSSIPEWFIHQNMGSSVTVELPPHWYNAKLMGLAVCAVFHADPID  1090

Query  226   QNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDD  405
                   + + L    HK  +    + + M G+     HVW G+ S          +G +D
Sbjct  1091  WGY---LQYSLYRGEHKYDSYMLQTWSPMKGD-----HVWFGYQSL---------VGQED  1133

Query  406   CTKIFG-------------CL-TIAVRNEPWNKPKRCGIRLVYKE  498
                 FG             C+ +  V  +P    K+CG+RL Y++
Sbjct  1134  DRMWFGERSGTLKILFSGHCIKSCIVCVQPEVVVKKCGVRLAYEQ  1178



>ref|XP_009360768.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=666

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 67/146 (46%), Gaps = 19/146 (13%)
 Frame = +1

Query  88   ILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLISQ  267
            ++ PG +IPEWFS+Q +G S+++ LPP    N++G A  VVF+   Q      T      
Sbjct  443  VVWPGSEIPEWFSNQSVGHSINVELPPPSCTNWLGIAFCVVFQDPKQKLANLATLCHYDY  502

Query  268  NHKEYTTDSISSTTMTGEICESGHVWMGFLSFR-------LFQLLFPDIGVDDCTKIFGC  426
             + ++  D +          ES H+W+ + S         +F+  F DI           
Sbjct  503  FNIQFLGDCLLRWDCKIGSLESEHIWIFYFSRENCHQEQFVFETCFYDI-----------  551

Query  427  LTIAVRNEPWNKPKRCGIRLVYKEDI  504
                 +   +N  K+CG RLVYK+D+
Sbjct  552  -EGGKQKADFNSVKKCGARLVYKQDL  576



>ref|XP_008382170.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1440

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 68/156 (44%), Gaps = 24/156 (15%)
 Frame = +1

Query  97    PGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKLISQNH  273
             PG +IP WFS Q  G S+ I LPPDW + +F+GFA+SVV      N   G+ F   S   
Sbjct  1148  PGSEIPNWFSHQNEGSSIKIKLPPDWFNTDFLGFALSVVVSFDNYNVIRGLNFGCKSNFK  1207

Query  274   KEYTTDSISSTTMTGEICE---------------SGHVWMGFLSFRLFQ-----LLFPDI  393
               Y     S     G   +               + HV++ +  F L +       FP++
Sbjct  1208  NRYGGSHESDREFNGWTTDETIYNLGEQDDYNFNADHVFVWYGDFDLLEGEKSSSPFPNV  1267

Query  394   GVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
               +     +    +   + P  K K+CGIRL+Y +D
Sbjct  1268  VTEPSLDFY---VVDHLDRPEVKVKKCGIRLLYAQD  1300



>emb|CDP07825.1| unnamed protein product [Coffea canephora]
Length=1028

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 84/184 (46%), Gaps = 19/184 (10%)
 Frame = +1

Query  10   EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-F  186
            E   +  D   N +L+     +  FSI +PGG+IP WF+ Q  G S+ I LP +W+++ F
Sbjct  805  EQTSSMIDATWNHMLKELLLVDDNFSICLPGGRIPSWFTYQNWGPSIRIRLPSNWYSDEF  864

Query  187  IGFAISVVFEPMAQN----------SRIGITFKLISQNHKEYTTDSISSTTMTGEICESG  336
            +GFA+  V + +               + I F LI Q  +            + +I  S 
Sbjct  865  MGFAVCAVSDLITTTLEWRDLLQKIPSVRIQFNLIDQEERICNRMFTIGCGGSEKIINSE  924

Query  337  HVWMGFLSFRLFQLLFPD--IGVDDCTKIFGCLTIA--VRNEPWNKPKRCGIRLVYKEDI  504
            H  + +LSF    LL  D     +D T    C+ ++  V ++ +   K  GI LVYK+D+
Sbjct  925  HTCLAYLSFHEIWLLCFDKVCSPNDWT----CIEVSADVYSKKYMVFKAWGISLVYKDDV  980

Query  505  VXET  516
               T
Sbjct  981  RQNT  984



>ref|XP_010665286.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1488

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 70/150 (47%), Gaps = 14/150 (9%)
 Frame = +1

Query  73    NRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITF  252
             N  FSI+ PG +IPEW   Q +G S+ I LP DW+ + +GF++  V E + +     +  
Sbjct  1288  NIAFSIVFPGSEIPEWIWHQHVGSSIKIELPTDWYNDLLGFSLCSVLEHLPERIICRLNS  1347

Query  253   KLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGFL---SFRLFQLLFPDIGVDDCTKIF  420
              +    + K++  D        G      HVW+G+      RLF+   P    +D   I 
Sbjct  1348  DVFDYGDLKDFGHDFHGKGNNVG----PEHVWLGYQPCSQLRLFEFNDP----NDWNLIE  1399

Query  421   GCLTIAVR--NEPWNKPKRCGIRLVYKEDI  504
                  A R  +   N  K+CG+ L+Y ED+
Sbjct  1400  ISFEAAHRFSSSASNVVKKCGVCLIYAEDL  1429



>ref|XP_009360758.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
 ref|XP_009360759.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1165

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 76/162 (47%), Gaps = 28/162 (17%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLISQ  267
             +L PG +IPEWFS Q +G SV++ LPP    N++G A  V+F+ + Q S I     L + 
Sbjct  990   MLCPGSEIPEWFSIQSVGHSVNVELPPPSCTNWLGIAFCVLFQDLNQYSAI-----LAAL  1044

Query  268   NHKEYTTDSISSTTMTGEIC-------ESGHVWMGFLSFR-LFQLLFPDIGVDDCTKIFG  423
             +  +Y      S   +  IC       ES H+W+ +L  R   + +F     D C  +F 
Sbjct  1045  HPNDYFEIRCLSFMDSPGICTKKIRSLESEHLWVFYLPRRDCCEHVFYLRRRDCCEHVFL  1104

Query  424   CLTI---AVRNEP------------WNKPKRCGIRLVYKEDI  504
               T     VR E              N  K+CG RL+YK+D+
Sbjct  1105  FETYFNGGVRREVAQADLMGEAKVYLNYVKKCGARLLYKQDL  1146



>ref|XP_002531928.1| leucine-rich repeat-containing protein, putative [Ricinus communis]
 gb|EEF30442.1| leucine-rich repeat-containing protein, putative [Ricinus communis]
Length=943

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 83/175 (47%), Gaps = 25/175 (14%)
 Frame = +1

Query  22   NTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGR-SVSIPLPPDW-HANFIGF  195
            N   ++L + LQG S     F I+IPG +IP+W S Q +G  S+SI LPP W  + ++GF
Sbjct  713  NIGFMMLRNYLQGLSNPKPGFDIIIPGSEIPDWLSHQSLGDCSISIELPPVWCDSKWMGF  772

Query  196  AISVVF----EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSF  363
            A+  V+    EP      + +T  +  + H        S   M  E+  S  VW+ FLS 
Sbjct  773  ALCAVYVIYQEPALNFIDMDLTCFIKIKGHTWCHELDYSFAEM--ELVGSDQVWLFFLSR  830

Query  364  RLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKP-------KRCGIRLVYKEDIV  507
              F      +G+ DC    G    +   E   K        K+ G+RLVY++D++
Sbjct  831  YEF------LGI-DCQ---GVAKTSSHAEVMFKAHGVGLYVKKFGVRLVYQQDVL  875



>ref|XP_008237404.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
 ref|XP_008237405.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1181

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 75/143 (52%), Gaps = 14/143 (10%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFEPMAQNSRIGITFK  255
             R+ I++PG +IP WFS Q +G SVS+ LP +W  N ++G+A+  VF+       +    K
Sbjct  989   RYEIVMPGSEIPLWFSHQALGSSVSVQLPRNWRDNKWMGYALCTVFQVFGSGWELDCLLK  1048

Query  256   LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
             +   N KE     I +T +      S H+W+ ++S  L       +G +   +    +  
Sbjct  1049  V---NGKEQYPAPILATNVQP---MSDHLWLVYISRDL------SLGKEWQHRRNQLIFS  1096

Query  436   AVRNEPWNKPKRCGIRLVYKEDI  504
              + + P +  K+CG+RL+Y++D+
Sbjct  1097  FISSGP-SFVKKCGVRLIYEQDV  1118



>ref|XP_002272079.2| PREDICTED: TMV resistance protein N [Vitis vinifera]
 emb|CBI18507.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 71/148 (48%), Gaps = 9/148 (6%)
 Frame = +1

Query  73    NRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGIT  249
             N  FS+++PG  IP+W   + MG  V + LP DW+  +F+GFA+  V E +    RI   
Sbjct  1075  NVAFSMILPGSGIPKWIWHRNMGSFVKVKLPTDWYDDDFLGFAVCSVLEHVP--DRIVCH  1132

Query  250   FKLISQNHKEYTTDSISSTTMTGEICESGHVWMGF---LSFRLFQLLFPDIGVDDCTKIF  420
                 + ++ E   D        G    S HVW+G+      R+FQ+  P+       +I 
Sbjct  1133  LSPDTLDYGEL-RDFGHDFHCKGSDVSSEHVWLGYQPCAQLRMFQVNDPNEWSH--MEIS  1189

Query  421   GCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
                T  + +   N  K CG+RL+Y ED+
Sbjct  1190  FEATHRLSSRASNMVKECGVRLIYAEDL  1217



>ref|XP_008237406.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
 ref|XP_008237407.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1181

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 75/143 (52%), Gaps = 14/143 (10%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFEPMAQNSRIGITFK  255
             R+ I++PG +IP WFS Q +G SVS+ LP +W  N ++G+A+  VF+       +    K
Sbjct  989   RYEIVMPGSEIPLWFSHQALGSSVSVQLPRNWRDNKWMGYALCTVFQVFGSGWELDCLLK  1048

Query  256   LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
             +   N KE     I +T +      S H+W+ ++S  L       +G +   +    +  
Sbjct  1049  V---NGKEQYPAPILATNVQP---MSDHLWLVYISRDL------SLGKEWQHRRNQLIFS  1096

Query  436   AVRNEPWNKPKRCGIRLVYKEDI  504
              + + P +  K+CG+RL+Y++D+
Sbjct  1097  FISSGP-SFVKKCGVRLIYEQDV  1118



>ref|XP_010646556.1| PREDICTED: putative disease resistance protein At4g11170 [Vitis 
vinifera]
Length=684

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 67/147 (46%), Gaps = 16/147 (11%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV--FEPMAQNSRIGITF  252
            F ILIPG +IP+WFS Q  G     PLP +W ++NF+GFA+  V   + +       +T+
Sbjct  418  FRILIPGSEIPDWFSHQNKGCKFRKPLPSNWNNSNFLGFALCAVLGLKDLIHQEMHYLTY  477

Query  253  KLISQNHKEYTTDSISS---TTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFG  423
              IS     Y+   +S          + +S H+WM +    L +        DD   I  
Sbjct  478  G-ISSRGGMYSLPRMSDFIPHRFEDGLIKSDHIWMAYAPAPLCK------SWDDSEAITV  530

Query  424  CLTIAVRNEPWNKPKRCGIRLVYKEDI  504
               I+      N  K CG RLVY ED+
Sbjct  531  SFVISGSR---NTVKSCGFRLVYAEDV  554



>ref|XP_007200714.1| hypothetical protein PRUPE_ppa015500m1g, partial [Prunus persica]
 gb|EMJ01913.1| hypothetical protein PRUPE_ppa015500m1g, partial [Prunus persica]
Length=316

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 75/164 (46%), Gaps = 12/164 (7%)
 Frame = +1

Query  34   LLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVF  213
            L+L   LQ          I+IPG +IPEWF++Q +G SV  PLP D ++ ++GFA   +F
Sbjct  125  LMLKKFLQEIPRSLGIIDIIIPGSEIPEWFNNQSVGDSVIEPLPSDSNSTWVGFAFCALF  184

Query  214  EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLF----QLL  381
               A      ITF+ +     +  T +    T+  +   S H+W+  LS + F    +  
Sbjct  185  VATATKHN-SITFRCLCD---DLNTPAGLGYTVAIDYVASDHLWLILLSRQQFFWKPRQR  240

Query  382  FPDIGVDDCTKIFGCLTIAVRNEPWNKP----KRCGIRLVYKED  501
                  + C           R+ P  K     K+CG+R +Y++D
Sbjct  241  PETYWREKCHDQKMRFHFETRSYPGEKTGVKVKKCGVRTLYEQD  284



>ref|XP_009342855.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
Length=655

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 14/157 (9%)
 Frame = +1

Query  37   LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVF  213
            +L   L+G      R+ I++PG +IP WF+ Q+MG  VS+ L P W  N ++G+A+  VF
Sbjct  494  MLQRYLKGVPYAGDRYEIVMPGKEIPGWFTHQRMGPEVSVDLTPQWRDNKWMGYALCAVF  553

Query  214  EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDI  393
            E       +    ++     +EY    +SS         S H+W+ ++S  +    F   
Sbjct  554  EVYGSGWELSGVLEV--NGKEEYPAPLLSSDVQP----VSDHIWLLYVSRGIS---FGTE  604

Query  394  GVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
              + C +    L    ++      K CG RLVY+ D+
Sbjct  605  WQNSCNQ----LNFHFKSSGPCLVKSCGTRLVYESDV  637



>ref|XP_009342856.1| PREDICTED: TMV resistance protein N-like isoform X2 [Pyrus x 
bretschneideri]
Length=652

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 14/157 (9%)
 Frame = +1

Query  37   LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVF  213
            +L   L+G      R+ I++PG +IP WF+ Q+MG  VS+ L P W  N ++G+A+  VF
Sbjct  491  MLQRYLKGVPYAGDRYEIVMPGKEIPGWFTHQRMGPEVSVDLTPQWRDNKWMGYALCAVF  550

Query  214  EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDI  393
            E       +    ++     +EY    +SS         S H+W+ ++S  +    F   
Sbjct  551  EVYGSGWELSGVLEV--NGKEEYPAPLLSSDVQP----VSDHIWLLYVSRGIS---FGTE  601

Query  394  GVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
              + C +    L    ++      K CG RLVY+ D+
Sbjct  602  WQNSCNQ----LNFHFKSSGPCLVKSCGTRLVYESDV  634



>ref|XP_008352780.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1184

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 15/142 (11%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
             + IL PG  IPEWF++Q +G S+++ LPP   ++++G A  VVF    +N  +G    L 
Sbjct  1016  YYILCPGKGIPEWFNNQIVGHSLNVELPPQSCSSWMGIAFCVVFSQPKEN--LGNPAALQ  1073

Query  262   SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLT-IA  438
                 K      IS      E   S H+W+ +LS             + C + F   T   
Sbjct  1074  YYGFKIQCLPGISCWISETEHLVSEHLWIFYLS------------REQCQEQFSFETDYH  1121

Query  439   VRNEPWNKPKRCGIRLVYKEDI  504
              R    N  K CG RLVYK+D+
Sbjct  1122  ARGNGPNMVKMCGARLVYKQDL  1143



>ref|XP_007201594.1| hypothetical protein PRUPE_ppa021490mg [Prunus persica]
 gb|EMJ02793.1| hypothetical protein PRUPE_ppa021490mg [Prunus persica]
Length=1087

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 75/152 (49%), Gaps = 21/152 (14%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSR-----IGI  246
             FSI+IPG +IPEWF++Q +G  +   LP D +  F+GFA+  +F P+ + S      +G 
Sbjct  921   FSIVIPGSEIPEWFNNQSVGDLLIETLPSDSNTKFVGFALCALFVPVHEISATAEEPMGH  980

Query  247   TFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLF---PDIGVDDCTKI  417
             +     +   E     I    +  ++  S H+W+  LS + F L     P+I +      
Sbjct  981   SIYFHCRYDLETNAGPIFIIPVDDDVA-SDHLWLILLSRQHFPLKSNWGPEIEIR-----  1034

Query  418   FGCLTIAVRNEPWNKP----KRCGIRLVYKED  501
                    VR++P  K     K+CG+R +Y++D
Sbjct  1035  ---FHFKVRSKPGKKTLVKGKKCGVRALYEQD  1063



>ref|XP_008237417.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1174

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 72/143 (50%), Gaps = 16/143 (11%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFEPMAQNSRIGITFK  255
             R+ I+IPG KIP WF  Q++G SVS+PL  + H   ++G+A+   F+ +    ++    K
Sbjct  979   RYEIVIPGSKIPSWFCRQRVGSSVSLPL--NLHKQKWMGYALCARFQVLKSGWQLVCVLK  1036

Query  256   LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
             +     +EY     ++         S H+W  ++S  L        G +  T  +  LT 
Sbjct  1037  V--NGKQEYPVPLFAANVTP----LSNHLWFFYVSRDL------SFGTNSRTS-YDQLTF  1083

Query  436   AVRNEPWNKPKRCGIRLVYKEDI  504
             +  +   +  KRCG+RLVY+ED+
Sbjct  1084  SFESSTRSLVKRCGVRLVYEEDL  1106



>ref|XP_008222884.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Prunus mume]
Length=1199

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 73/149 (49%), Gaps = 15/149 (10%)
 Frame = +1

Query  85    SILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NFIGFAISVV--FEPMAQNSRIGITFK  255
             +I  PG  IP WFS Q  G SV I LPPDW + +F+GFA+S+V  + P+    R   +FK
Sbjct  1047  AIKCPGYDIPNWFSHQSEGSSVKIQLPPDWFSTDFLGFALSLVVAYAPLYMKIRWKYSFK  1106

Query  256   LISQNHKEYTTDSISSTTMTGEICESGH---VWMGFLSFRLFQLL----FPDIGVDDCTK  414
               S        +S+ +  + G   +  H   VW     + +F+++     P       T+
Sbjct  1107  -ASNGESHEIKNSLYNPYLFGSSFQDSHEVFVWW----YNVFEVVEAAQIPTAFYKLVTE  1161

Query  415   IFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             ++   +I   +     P++CG+ L+Y ED
Sbjct  1162  VYVDFSIDKYSAYRPIPEKCGVCLLYGED  1190



>ref|XP_008222859.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=722

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 86/180 (48%), Gaps = 18/180 (10%)
 Frame = +1

Query  10   EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANF  186
            E   N A L+L    QG      +F+I+IPG +IP+WFS+Q++G S+ +  PP   ++ +
Sbjct  476  EGCNNIAFLMLQKFRQGVRHSVLKFNIVIPGSEIPDWFSNQRVGDSLMVERPPHLCNSKW  535

Query  187  IGFAISVVFEPMAQNSRIGITFKLISQN------HKEYTTDSISSTTMTGEI------CE  330
            +GF +  VF    +N    + F    ++      + E       S  +  E+        
Sbjct  536  MGFVLCAVF-GAQENPAALLEFDYFGRHPCGILCYLEIAGSYQLSFPIPDEVYHSVGHVA  594

Query  331  SGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLT--IAVRNEPWNKPKRCGIRLVYKEDI  504
            S H+W+ ++S +  +    +   D+C+++        +VRN    K K+ GI LVY ED+
Sbjct  595  SDHLWLLYVSRKYHRC--ENFLKDNCSQVEVLFKPFCSVRNNTCLKLKKYGIHLVYGEDV  652



>ref|XP_007200796.1| hypothetical protein PRUPE_ppa024688mg, partial [Prunus persica]
 gb|EMJ01995.1| hypothetical protein PRUPE_ppa024688mg, partial [Prunus persica]
Length=1065

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 72/154 (47%), Gaps = 16/154 (10%)
 Frame = +1

Query  76   RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFK  255
            + F I+IPG +IPEWFS+Q +G SV   LP D ++ ++GFA   +F P+ + S       
Sbjct  847  KDFRIVIPGSEIPEWFSNQSVGDSVIETLPSDSNSKWVGFAFCSLFVPVEEISATERNTI  906

Query  256  LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFR-LFQLLFPDIGVDDC--TKIFGC  426
            +I   +   T  S S  T       S H+W+  LS   LF         + C   KI   
Sbjct  907  VIFDLNAHVTMASFSDVTDVA----SDHLWLILLSRESLFTGRLGTYWREKCHDRKIRFQ  962

Query  427  LTIAVRNEPWN---------KPKRCGIRLVYKED  501
              +    +  N         K K+CG+R++Y++D
Sbjct  963  FEVQTTYQEENRRVKRKTCLKVKKCGVRILYEQD  996



>emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera]
Length=1244

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 14/102 (14%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV--FEPMAQNSRIGITF  252
             FSI +PG +IP+W S+Q +G  V+I LPP W  +NF+GFA+  V  FE +A N   G + 
Sbjct  982   FSIFLPGSEIPDWISNQNLGSEVTIELPPHWFESNFLGFAVCCVFAFEDIAPN---GCSS  1038

Query  253   KLISQNHKE--------YTTDSISSTTMTGEICESGHVWMGF  354
             +L+ Q   +        +   SI     + +  +S H+W+ +
Sbjct  1039  QLLCQLQSDESHFRGIGHILHSIDCEGNSEDRLKSHHMWLAY  1080



>ref|XP_008237565.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1181

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 69/144 (48%), Gaps = 4/144 (3%)
 Frame = +1

Query  73    NRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITF  252
             + RF I+ P  KIPEWFS+Q +G S+++ LP D    ++G A+  V E  A  S     F
Sbjct  975   DYRFEIVTPRRKIPEWFSNQSLGDSLTVELPLDSCTTWMGIALCAVLEVQADLSE--FNF  1032

Query  253   KLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLT  432
               +S   +      +     TG +  S H+W+ ++  + F+ +   I V   T  F C  
Sbjct  1033  FHVSCFAQGMLPHGVLPKLKTGNVV-SDHLWVIYVPCKQFEKMCGQIKVFFKTSYF-CQD  1090

Query  433   IAVRNEPWNKPKRCGIRLVYKEDI  504
                        K+CG RLV+K+D+
Sbjct  1091  EKRLVYDIQYVKKCGFRLVHKQDV  1114



>ref|XP_011458231.1| PREDICTED: TMV resistance protein N-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1280

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 83/180 (46%), Gaps = 28/180 (16%)
 Frame = +1

Query  22    NTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFA  198
             N A  +L   LQG  +  +RF  LIPG +I E FSDQ +G  +S+ LP  WH N ++G+A
Sbjct  1103  NIALKMLCRFLQGIPSAGKRFETLIPGCEISELFSDQSVGPVISMELPQRWHNNKWMGYA  1162

Query  199   ISVVF-------EPMAQ---------NSRIGITFKLISQNHKEYT-TDSISSTTMTGEIC  327
                          P  Q         NS  G+  ++  +N        S   +   G+I 
Sbjct  1163  FCACLVIRRCLPVPANQLGKWKFGTHNSANGLRCEVKPENLGAIGWCPSFVCSQELGQI-  1221

Query  328   ESGHVWMGFLSFRLFQLLFPDIGVDDCTKI-FGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             ES H+W+ F+S   F   + +     C  I F   T+    E     K+CG+RL+Y++D+
Sbjct  1222  ESEHLWLSFVSGDYFGTAWQET----CRSIEFTFKTLGTGME----VKKCGVRLIYEQDL  1273



>ref|XP_004290247.1| PREDICTED: TMV resistance protein N-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1304

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 83/180 (46%), Gaps = 28/180 (16%)
 Frame = +1

Query  22    NTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFA  198
             N A  +L   LQG  +  +RF  LIPG +I E FSDQ +G  +S+ LP  WH N ++G+A
Sbjct  1127  NIALKMLCRFLQGIPSAGKRFETLIPGCEISELFSDQSVGPVISMELPQRWHNNKWMGYA  1186

Query  199   ISVVF-------EPMAQ---------NSRIGITFKLISQNHKEYT-TDSISSTTMTGEIC  327
                          P  Q         NS  G+  ++  +N        S   +   G+I 
Sbjct  1187  FCACLVIRRCLPVPANQLGKWKFGTHNSANGLRCEVKPENLGAIGWCPSFVCSQELGQI-  1245

Query  328   ESGHVWMGFLSFRLFQLLFPDIGVDDCTKI-FGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             ES H+W+ F+S   F   + +     C  I F   T+    E     K+CG+RL+Y++D+
Sbjct  1246  ESEHLWLSFVSGDYFGTAWQET----CRSIEFTFKTLGTGME----VKKCGVRLIYEQDL  1297



>ref|XP_011458232.1| PREDICTED: TMV resistance protein N-like isoform X3 [Fragaria 
vesca subsp. vesca]
Length=1273

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 83/180 (46%), Gaps = 28/180 (16%)
 Frame = +1

Query  22    NTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFA  198
             N A  +L   LQG  +  +RF  LIPG +I E FSDQ +G  +S+ LP  WH N ++G+A
Sbjct  1096  NIALKMLCRFLQGIPSAGKRFETLIPGCEISELFSDQSVGPVISMELPQRWHNNKWMGYA  1155

Query  199   ISVVF-------EPMAQ---------NSRIGITFKLISQNHKEYT-TDSISSTTMTGEIC  327
                          P  Q         NS  G+  ++  +N        S   +   G+I 
Sbjct  1156  FCACLVIRRCLPVPANQLGKWKFGTHNSANGLRCEVKPENLGAIGWCPSFVCSQELGQI-  1214

Query  328   ESGHVWMGFLSFRLFQLLFPDIGVDDCTKI-FGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             ES H+W+ F+S   F   + +     C  I F   T+    E     K+CG+RL+Y++D+
Sbjct  1215  ESEHLWLSFVSGDYFGTAWQET----CRSIEFTFKTLGTGME----VKKCGVRLIYEQDL  1266



>ref|XP_010665287.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1325

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (47%), Gaps = 13/150 (9%)
 Frame = +1

Query  73    NRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGIT  249
             N  FSI+ PG  IPEW   Q +G  + I LP DW+  +F+GF +  + E + +  RI   
Sbjct  1124  NIAFSIVFPGSGIPEWIWHQNVGSFIKIELPTDWYNDDFLGFVLCSILEHLPE--RIICR  1181

Query  250   FKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFL---SFRLFQLLFPDIGVDDCTKIF  420
                    + ++  D        G+I  S HVW+G+      RLFQ   P    +D   I 
Sbjct  1182  LNSDVFYYGDF-KDIGHDFHWKGDILGSEHVWLGYQPCSQLRLFQFNDP----NDWNYIE  1236

Query  421   GCLTIAVR--NEPWNKPKRCGIRLVYKEDI  504
                  A R  +   N  K+CG+ L+Y ED+
Sbjct  1237  ISFEAAHRFNSSASNVVKKCGVCLIYAEDL  1266



>emb|CBI18504.3| unnamed protein product [Vitis vinifera]
Length=547

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 70/151 (46%), Gaps = 13/151 (9%)
 Frame = +1

Query  70   RNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGI  246
             N  FSI+ PG  IPEW   Q +G  + I LP DW+  +F+GF +  + E + +  RI  
Sbjct  345  ENIAFSIVFPGSGIPEWIWHQNVGSFIKIELPTDWYNDDFLGFVLCSILEHLPE--RIIC  402

Query  247  TFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFL---SFRLFQLLFPDIGVDDCTKI  417
                    + ++  D        G+I  S HVW+G+      RLFQ   P    +D   I
Sbjct  403  RLNSDVFYYGDF-KDIGHDFHWKGDILGSEHVWLGYQPCSQLRLFQFNDP----NDWNYI  457

Query  418  FGCLTIAVR--NEPWNKPKRCGIRLVYKEDI  504
                  A R  +   N  K+CG+ L+Y ED+
Sbjct  458  EISFEAAHRFNSSASNVVKKCGVCLIYAEDL  488



>ref|XP_009360662.1| PREDICTED: TMV resistance protein N-like isoform X2 [Pyrus x 
bretschneideri]
Length=1146

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 14/157 (9%)
 Frame = +1

Query  37    LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVF  213
             +L   L+G      R+ I++PG +IP WF+ Q+MG  VS+ L P W  N ++G+A+  VF
Sbjct  982   MLQIYLKGVPYAGDRYEIVMPGKEIPGWFTHQRMGPEVSVHLTPQWRDNKWMGYALCAVF  1041

Query  214   EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDI  393
             E       +    ++     +EY    +SS         S H+W+ ++S  +    F   
Sbjct  1042  EVYGSGWELSGVLEV--NGKEEYPAPLLSSDVQP----VSDHIWLLYVSRGIS---FGTE  1092

Query  394   GVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
               + C +    L    ++      K CG RLVY+ D+
Sbjct  1093  WQNSCNQ----LNFHFKSSGPCLVKSCGTRLVYESDV  1125



>ref|XP_009368494.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1119

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 75/152 (49%), Gaps = 13/152 (9%)
 Frame = +1

Query  76    RRFSILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVVFEPMAQNSRIGITF  252
             R  +I+IPG +IPEWF++Q MG SV   LP    ++  +GFA+  +  P    S      
Sbjct  942   RYLNIVIPGSEIPEWFNNQSMGDSVIEKLPSHSCNSKLVGFAVCALLAPAQNISAPNRGL  1001

Query  253   KLISQNHKE---YTTDS---ISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDC-T  411
             K    +  E   Y T     IS    T     S H+W+ FLS R+F  L  +   ++C  
Sbjct  1002  KWPGHHRHELVCYPTIRDVLISGMGFTLNKVASDHLWVAFLS-RIF--LSANRWEENCWD  1058

Query  412   KIFGCLTI--AVRNEPWNKPKRCGIRLVYKED  501
             +I  C     AV ++   K K+CG+R VY++D
Sbjct  1059  QIQFCFETRDAVGSKTCLKVKKCGVRPVYEQD  1090



>ref|XP_009360660.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009360661.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
Length=1149

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 14/157 (9%)
 Frame = +1

Query  37    LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVF  213
             +L   L+G      R+ I++PG +IP WF+ Q+MG  VS+ L P W  N ++G+A+  VF
Sbjct  985   MLQIYLKGVPYAGDRYEIVMPGKEIPGWFTHQRMGPEVSVHLTPQWRDNKWMGYALCAVF  1044

Query  214   EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDI  393
             E       +    ++     +EY    +SS         S H+W+ ++S  +    F   
Sbjct  1045  EVYGSGWELSGVLEV--NGKEEYPAPLLSSDVQP----VSDHIWLLYVSRGIS---FGTE  1095

Query  394   GVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
               + C +    L    ++      K CG RLVY+ D+
Sbjct  1096  WQNSCNQ----LNFHFKSSGPCLVKSCGTRLVYESDV  1128



>gb|KHG22298.1| TMV resistance N [Gossypium arboreum]
Length=657

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 87/195 (45%), Gaps = 35/195 (18%)
 Frame = +1

Query  1    KLCEANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRS---VSIPLPPD  171
            KL E N   A +L   + +G   R   + I+IPG +IP+WF++Q    S   + I LPP 
Sbjct  409  KLAEGNDAVA-MLKRCIQEGAKVRTTNYDIIIPGSEIPKWFTNQTDDPSDSIIKIQLPPG  467

Query  172  W--HANFIGFAISVVF-----------EPMAQNSRI-GITFKLISQNHKEYTTDSISSTT  309
            +      +GFA   VF           E ++  S I G  F   S+    Y       +T
Sbjct  468  FLIGRQLVGFAFCCVFFSNFDNKPRRGEHISHTSVIHGRNF---SREFGRYDFHLEGKST  524

Query  310  MTGEICESGHVWMGFL---SFRLFQLLFPDIGVDDCTKIFGCLT----IAVRNEPW---N  459
              GE     H+W+ F+     RLF L F   G +    I   L     I V  + W   +
Sbjct  525  RVGE----DHLWLHFMPCNQLRLFSLAFECKGQEISEFITYVLKESSEIEVFFKIWGFHS  580

Query  460  KPKRCGIRLVYKEDI  504
            K K+CG+R+VYK+D+
Sbjct  581  KLKKCGVRMVYKKDL  595



>emb|CBI39197.3| unnamed protein product [Vitis vinifera]
Length=518

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 13/106 (12%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH--ANFIGFAISVVFEPMAQNSRIGI---  246
            FS + PG +IP+WF     G  ++I +PPDW+  +NF+GFA+S V  P   +SR      
Sbjct  352  FSTVFPGSEIPDWFRHHSQGHEINIEVPPDWYINSNFLGFALSAVMAPQ-HDSRAWYMYC  410

Query  247  ---TFKLISQNHKEYTTDSISSTTMTGEICESGHVWMG----FLSF  363
               T  L S +H+  +     +  +     ES HVW+     FLSF
Sbjct  411  DLDTHDLNSNSHRICSFFGSWTYQLQHTPIESDHVWLAYVPSFLSF  456



>ref|XP_008357215.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1174

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 69/140 (49%), Gaps = 14/140 (10%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLISQ  267
             I+ PG  IPEWF++Q +G S+++ LPP   ++++G A  VVF   AQ  R G    L   
Sbjct  1007  IVCPGNGIPEWFNNQTVGHSLNLELPPQSCSSWMGIAFCVVF---AQ--RKGNPDALQYY  1061

Query  268   NHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGC-LTIAVR  444
               +   +  IS      E   S H+W+ +LS    Q  F     + C    GC L + + 
Sbjct  1062  GFEIQLSPEISFRIFGEEHLMSEHLWIFYLSREDCQEPF---SFETCYDAGGCRLKVGL-  1117

Query  445   NEPWNKPKRCGIRLVYKEDI  504
                 N  K CG RLVYK+D+
Sbjct  1118  ----NMVKMCGARLVYKQDL  1133



>ref|XP_003634611.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=700

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 67/151 (44%), Gaps = 12/151 (8%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFE-PMAQNSRIGITFK  255
            +  L+ G +IP+WF+ +  G  V   LPP W+    +G A  VVF    A +  +G TF 
Sbjct  526  YQALVQGSRIPKWFTHRSEGSKVIAELPPHWYNTKLMGLAACVVFNFKGAVDGYLG-TFP  584

Query  256  LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIF-----  420
            L       Y T S  ++  T  I ES H W  ++S    +  +P    +    +      
Sbjct  585  LACFLDGHYATLSDHNSLWTSSIIESDHTWFAYISRAELEAPYPPWFGELSDYMLASFLF  644

Query  421  ----GCLTIAVRNEPWNKPKRCGIRLVYKED  501
                G +T         + K+CG+R+VY+ED
Sbjct  645  LVPEGAVTSDDEVTSHGEVKKCGVRIVYEED  675



>emb|CBI23256.3| unnamed protein product [Vitis vinifera]
Length=513

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 64/140 (46%), Gaps = 8/140 (6%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNS--RIGITF  252
            +SILIPG +IP+W   + MG SVS  LPPDW   N +G A+  VF   A  +  R G   
Sbjct  340  YSILIPGSRIPKWAWHENMGASVSATLPPDWLDDNLLGIALCGVFALEAGETIQRPGGIC  399

Query  253  KLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLT  432
                     Y + SIS T     + E+ HVWM +     F             K +  L+
Sbjct  400  CNFECREGPYFSHSISWTHSGDRVVETDHVWMVYQPRTQFVKSKSICARFKHIKAYFSLS  459

Query  433  IAVRNEPWNKPKRCGIRLVY  492
             A      ++ K+C IRL+Y
Sbjct  460  GAS-----HEVKKCAIRLIY  474



>ref|XP_010263207.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263208.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1186

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 67/150 (45%), Gaps = 8/150 (5%)
 Frame = +1

Query  73    NRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITF  252
             +R+  I  PGG IP+WF+ Q+MG S+SI  PP          IS V+      + +   F
Sbjct  1018  SRKLDIFFPGGDIPDWFNSQRMGSSISICFPPVLDIKIQSLIISAVYATDEDINFLRYVF  1077

Query  253   KLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGC--  426
              +   N  +     ++  +  G +    H+W+  + +  F+++    G D       C  
Sbjct  1078  HVHIINKTKNLKWRLNPKSHEGRMTCQPHLWVSHIPY--FEIMDCLEGGDQVEISIYCEN  1135

Query  427   ----LTIAVRNEPWNKPKRCGIRLVYKEDI  504
                   ++VR     K K+CGI L+Y+ D+
Sbjct  1136  DCDQREVSVRTVQEPKVKKCGIHLIYEPDV  1165



>ref|XP_002277693.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1140

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 13/106 (12%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH--ANFIGFAISVVFEPMAQNSRIGI---  246
             FS + PG +IP+WF     G  ++I +PPDW+  +NF+GFA+S V  P   +SR      
Sbjct  975   FSTVFPGSEIPDWFRHHSQGHEINIEVPPDWYINSNFLGFALSAVMAPQ-HDSRAWYMYC  1033

Query  247   ---TFKLISQNHKEYTTDSISSTTMTGEICESGHVWMG----FLSF  363
                T  L S +H+  +     +  +     ES HVW+     FLSF
Sbjct  1034  DLDTHDLNSNSHRICSFFGSWTYQLQHTPIESDHVWLAYVPSFLSF  1079



>ref|XP_008368131.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1190

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 70/148 (47%), Gaps = 19/148 (13%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQN--SRIGITFKLI  261
             I+ PG +IPEWFS+Q +G SV++ LPP    N++G A  VVFE   QN  +   +     
Sbjct  1010  IVSPGSEIPEWFSNQSVGHSVNVELPPPSCNNWLGIAFCVVFEDPKQNLANSAALICPYT  1069

Query  262   SQNHKEYTTDSISS-TTMTGEICESG-----HVWMGFLSFRLFQLLFPDIGVDDCTKIFG  423
              + + E+    +     +T   C+ G     H+W+ +L  +L Q            +I  
Sbjct  1070  LRQYDEFQIGVLPCFPNVTSRRCKVGSLVSEHLWVFYLPSKLCQ----------AEQISF  1119

Query  424   CLTIAVRNEP-WNKPKRCGIRLVYKEDI  504
                     EP  N  K+CG  LVY++D+
Sbjct  1120  TTFYDYEREPGLNVVKKCGACLVYEQDL  1147



>ref|XP_009340808.1| PREDICTED: uncharacterized protein LOC103932885 [Pyrus x bretschneideri]
Length=235

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 75/161 (47%), Gaps = 14/161 (9%)
 Frame = +1

Query  61   NSTRNRRFSILIPGGKIPEWFS--DQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQ-  228
            N   N   SI+ PG +IP WFS   Q  G SV I LPPDW      GFA+SVV   ++  
Sbjct  18   NPYGNPCVSIVCPGNEIPNWFSFGYQSEGSSVHIKLPPDWFRTGLSGFALSVVVSCVSNC  77

Query  229  ----NSRIGITFKLISQNHKEYTT-DSISSTTMTGEICESGHVWM---GFLSFRLFQLLF  384
                  R     KL+ ++H+ +T+   I    + G   +  HV++    F+S  + +   
Sbjct  78   QGDLRVRASFNVKLLGESHELFTSLFYIPIRRLNGYCYDRHHVYVWNKAFISEEVAKKCS  137

Query  385  PDIG--VDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
            PD+    ++ +  F       ++ P  K ++CGI   Y ED
Sbjct  138  PDVYKLANEASVEFYLPKFYEQHTPGAKVEKCGICPFYVED  178



>emb|CAN66451.1| hypothetical protein VITISV_004611 [Vitis vinifera]
Length=616

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 72/148 (49%), Gaps = 15/148 (10%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFE---PMAQNSRIGIT  249
            FS++IPG +IP+W  +Q     + + LPP W ++N + FA +VV+    P++  S   ++
Sbjct  424  FSLVIPGRRIPDWIRNQDCSSKIELELPPSWFNSNVLAFAFAVVYNFPLPLSHRSSGWVS  483

Query  250  FKL-ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFP-DIGVDDCTKIFG  423
                   +H  +       TT+ G + ES H+W       L  + FP  I  D+  +I  
Sbjct  484  ADCNFYSHHSSWHYAVYPQTTLRGGL-ESDHLW-------LLCVPFPSSINFDEVIRIKA  535

Query  424  CLTIAVRNEPWNKPKRCGIRLVYKEDIV  507
               I +R       K+CGI LVY+ + V
Sbjct  536  SFDILLRIGVC-AIKKCGIDLVYRNEEV  562



>ref|XP_008237531.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1228

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 70/145 (48%), Gaps = 10/145 (7%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
             F I+ PG +IPEWFS Q  G S+++ LPPD    ++G A+  VFE  A  S     +  I
Sbjct  994   FEIVTPGREIPEWFSSQSSGDSLTVELPPDSCTTWMGIALCAVFEVQADLS--DFHYSEI  1051

Query  262   SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLT---  432
             S + +E      S     GE+  S H+W+ ++    F+     I V   T  + C     
Sbjct  1052  SCSAQELLYGVFSKYFKKGEVV-SPHLWVIYVHREQFETKCGQIKVLLTTNYY-CYDRIR  1109

Query  433   -IAVRNEPWNKPKRCGIRLVYKEDI  504
              I  ++  W    + G RLV+++D+
Sbjct  1110  RIYEKSGTWE--MKFGFRLVHEQDV  1132



>ref|XP_010646557.1| PREDICTED: disease resistance protein RPS4-like [Vitis vinifera]
Length=538

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 53/109 (49%), Gaps = 25/109 (23%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH--ANFIGFAISVVFEPMAQNSRIGITFK  255
            FS + PG +IP+WF     G  ++I +PPDW+  +NF+GFA+S V  P   +SR    + 
Sbjct  371  FSTVFPGSEIPDWFRHHSQGHEINIEVPPDWYINSNFLGFALSAVMAPQ-HDSRAWCMY-  428

Query  256  LISQNHKEYTTDSISSTTMTGEIC---------------ESGHVWMGFL  357
                   +  T  ++S + +  IC               ES HVW+ ++
Sbjct  429  ------CDLDTHDLNSNSNSHRICSFFGSWTYQLQRTPIESDHVWLAYV  471



>ref|XP_010645905.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010645906.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1129

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 83/179 (46%), Gaps = 26/179 (15%)
 Frame = +1

Query  7     CEANKNTADLLLNSLLQGNSTRNRRFS----------ILIPGGKIPEWFSDQKMGRSVSI  156
             C + K  +  +L SLL     + R+F             IPG +IP+W + Q  G  V  
Sbjct  872   CTSLKGGSHQVLKSLLPTGKHQKRKFMGYFVASIASMAFIPGSRIPDWVTYQSSGSEVKA  931

Query  157   PLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICES  333
              LPP+W ++N +GFA+SVV  P    S I ++  +   N   +           G + ES
Sbjct  932   ELPPNWFNSNLLGFALSVVIFPQVCYSTI-VSMTVSFDNSSSFEIGP-RMLHFNGRL-ES  988

Query  334   GHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWN---KPKRCGIRLVYKED  501
              HV + +L  RL QL+       +C+++   L I+ +  P     + KRCG+ LVY  +
Sbjct  989   DHVCLFYL--RLHQLM------SNCSQVTR-LKISFKTFPMGGQIEIKRCGVGLVYSNE  1038



>ref|XP_010645849.1| PREDICTED: disease resistance protein RPS4-like [Vitis vinifera]
Length=827

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH--ANFIGFAISVVFEPMAQNSRI  240
             F ILIPG  IPEWF  Q+MG S+++ LPPDW+   NF+GF +  VF    Q  +I
Sbjct  692  EFCILIPGDGIPEWFEHQEMGSSLTMELPPDWYDRDNFLGFCVCFVFAFKDQMPQI  747



>ref|XP_009336840.1| PREDICTED: uncharacterized protein LOC103929372 [Pyrus x bretschneideri]
Length=184

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 78/162 (48%), Gaps = 24/162 (15%)
 Frame = +1

Query  88   ILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVVFEPM----AQNSRIGITF  252
            ++IPG  IPEWF++Q MG SV   LP    ++N +GFA+  +F P     A N  +    
Sbjct  1    MVIPGSDIPEWFNNQSMGDSVIEKLPSHSCNSNLVGFALCALFVPAQNISAPNHGLKHLS  60

Query  253  KLISQNHKEYTT----------DSISSTTMTGEICESGHVWMGFLSFR-LFQLLFPDIG-  396
              +S++H+   T          D I    +  E+  S H+W+ FLS   LFQ   P+   
Sbjct  61   GHLSRHHRHEITCYPSCSNTFQDIIGLRLLLNEV-ASDHLWLVFLSSEFLFQ---PETNR  116

Query  397  -VDDC--TKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDIVXE  513
              + C     F   T AV ++   K K+CG+  VY++D   E
Sbjct  117  WEEKCWDQIQFRFQTDAVGSKTCLKVKKCGVLPVYEQDTEEE  158



>ref|XP_006491517.1| PREDICTED: uncharacterized protein LOC102619067 [Citrus sinensis]
Length=181

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 71/153 (46%), Gaps = 7/153 (5%)
 Frame = +1

Query  52   LQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQ  228
            L+ +   +R F +  PG +IPEWFS Q MG SV++ LPPDW + NF+GFA+  +  P   
Sbjct  10   LKDDHNPSRSF-VCYPGSEIPEWFSFQSMGSSVTLELPPDWFNNNFVGFALCAIV-PDHH  67

Query  229  NSRIGITFKLISQNHKEYTTDSISSTTMTG--EICESGHVWMGFLSFRLFQLLFPDIGVD  402
                G   + I +   +    S+      G     ES HV +G+  F L          +
Sbjct  68   GITRGFNVRCILKTKDDVAVCSLYVWNHLGVNPSIESDHVLLGY-DFSLSSDSLGGSNNE  126

Query  403  DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             C + +         E ++  K+CG  L+Y +D
Sbjct  127  FCIQFYIQHFEGPGIEGFDV-KKCGAHLIYAQD  158



>emb|CBI40964.3| unnamed protein product [Vitis vinifera]
Length=519

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 53/109 (49%), Gaps = 25/109 (23%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH--ANFIGFAISVVFEPMAQNSRIGITFK  255
            FS + PG +IP+WF     G  ++I +PPDW+  +NF+GFA+S V  P   +SR    + 
Sbjct  351  FSTVFPGSEIPDWFRHHSQGHEINIEVPPDWYINSNFLGFALSAVMAPQ-HDSRAWCMY-  408

Query  256  LISQNHKEYTTDSISSTTMTGEIC---------------ESGHVWMGFL  357
                   +  T  ++S + +  IC               ES HVW+ ++
Sbjct  409  ------CDLDTHDLNSNSNSHRICSFFGSWTYQLQRTPIESDHVWLAYV  451



>emb|CAN71924.1| hypothetical protein VITISV_006193 [Vitis vinifera]
Length=1297

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 76/172 (44%), Gaps = 15/172 (9%)
 Frame = +1

Query  4     LCEANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-A  180
             +  +  + + L  + +L      N  FSI+ PG  IPEW   Q +G S+ I LP DW+  
Sbjct  1076  IVSSTASVSSLTTSPVLMQKLFENIAFSIVFPGSGIPEWIWHQSVGSSIKIELPTDWYND  1135

Query  181   NFIGFAISVVFEPMAQNSRIGITFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGFL  357
             +F+GFA+  V E + +     +   +    + K++  D        G    S HVW+G  
Sbjct  1136  DFLGFALCSVLEQLPERIICHLNSDVFYYGDLKDFGHDFHWKGNHVG----SEHVWLGHQ  1191

Query  358   ---SFRLFQLLFPDIGVDDCTKIFGCLTIAVR--NEPWNKPKRCGIRLVYKE  498
                  RLFQ   P    +D   I      A R  +   N  K+CG+ L+Y E
Sbjct  1192  PCSQLRLFQFNDP----NDWNHIEISFEAAHRFNSSASNVVKKCGVCLIYTE  1239



>gb|KDP41808.1| hypothetical protein JCGZ_26826 [Jatropha curcas]
Length=328

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +1

Query  22   NTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAI  201
            N A   L S      +  +++ I+ PG  IP W   Q  G S+++PLPP+W+ NF+GFA+
Sbjct  34   NLAHKTLESHRGLEYSDEKQYRIIFPGDSIPNWIQHQDTGFSITLPLPPNWYENFLGFAL  93

Query  202  SVVF  213
            S V 
Sbjct  94   SAVL  97



>emb|CDP20963.1| unnamed protein product [Coffea canephora]
Length=1056

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = +1

Query  1    KLCEANKNTADLLL--NSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW  174
            KL +  +N++ +    N +L+  S  +  FSI +PGG IP WF+ Q  G S++I LPP+W
Sbjct  749  KLLQDERNSSMIYATWNHMLKEFSLVDGSFSICLPGGSIPSWFTFQNSGPSITIELPPNW  808

Query  175  HAN-FIGFAISVVFEPM  222
            + N F+GFA+ VV + M
Sbjct  809  YNNEFMGFAVCVVSDLM  825



>emb|CBI40960.3| unnamed protein product [Vitis vinifera]
Length=771

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 78/163 (48%), Gaps = 29/163 (18%)
 Frame = +1

Query  67   TRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF---EPMAQNS  234
            +R  +F+  +PG  IPEWF +Q MG S+ + LP  W+  NF+GFA+ +VF   EP  Q S
Sbjct  505  SRIPKFNTYLPGNGIPEWFRNQCMGDSIMVQLPSHWYNDNFLGFAMCIVFALKEP-NQCS  563

Query  235  RIGITFKLISQ-----NHKEYTTDSISSTTMTGE-ICESGHVWMGFLSFRLFQLLFPDIG  396
            R  +  +L S      N   +    +      G+   ES H+W+G+         FP I 
Sbjct  564  RGAMLCELESSDLDPSNLGCFLDHIVWEGHSDGDGFVESDHLWLGY------HPNFP-IK  616

Query  397  VDD------CTKIFGCLTIA-VRNEPWNKPKRCGIRLVYKEDI  504
             DD       + I     IA + +E     K CG RLVY ED+
Sbjct  617  KDDMDWPNKLSHIKASFVIAGIPHEV----KWCGFRLVYMEDL  655



>ref|XP_007199341.1| hypothetical protein PRUPE_ppa024336mg [Prunus persica]
 gb|EMJ00540.1| hypothetical protein PRUPE_ppa024336mg [Prunus persica]
Length=1133

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 73/158 (46%), Gaps = 26/158 (16%)
 Frame = +1

Query  76    RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIG---I  246
             + F I+IPG +IPEWFS+Q +G SV   LP D ++ ++GFA   +F P+ + S  G   I
Sbjct  905   KNFRIVIPGSEIPEWFSNQSVGDSVIETLPSDSNSKWVGFAFCALFVPVEEISATGHGRI  964

Query  247   TFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGC  426
              FK+    +  +  D ++          S H+W+  LS R         G  +      C
Sbjct  965   LFKMT--EYGSFFIDVVNDVA-------SDHLWLILLS-RESSFDKEPTGRPETYWWNEC  1014

Query  427   LTIAVR-------------NEPWNKPKRCGIRLVYKED  501
                 +R              +   K K+CG+R++Y++D
Sbjct  1015  YDRKIRFHFKVKASASYPGEKTLVKVKKCGVRILYEQD  1052



>ref|XP_011469998.1| PREDICTED: TMV resistance protein N-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1342

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 11/170 (6%)
 Frame = +1

Query  1     KLCEANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA  180
             +L + N  T  + ++   Q N+ R+  F++ +PG ++P+WF++Q  G SV++ LPP+W  
Sbjct  964   QLVQTNLFTEIVEIHPHYQDNNQRSLSFNMSLPGSEVPDWFNNQCRGSSVTVKLPPNWFD  1023

Query  181   N-FIGFAISVVFE---PMAQNSRI-GITFKLISQNH--KEYTTDSISSTTMTGEICESGH  339
             N F+GFAI  V +   P    S +  +    +  NH   E++   +     T  I ES H
Sbjct  1024  NEFLGFAICAVSDFKGPHNDASDLSALCHCSLKGNHGLYEFSFTLLDWGFSTDRILESDH  1083

Query  340   VWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLV  489
             +++ ++ +  ++  F + G     + F   T  +  E  NK +R G R V
Sbjct  1084  MFLAYVPWSEYR--FIEKGKRVNQRYFTEATFEIVLE--NKVERHGFRTV  1129



>ref|XP_004307741.2| PREDICTED: TMV resistance protein N-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469997.1| PREDICTED: TMV resistance protein N-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1348

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 11/170 (6%)
 Frame = +1

Query  1     KLCEANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA  180
             +L + N  T  + ++   Q N+ R+  F++ +PG ++P+WF++Q  G SV++ LPP+W  
Sbjct  970   QLVQTNLFTEIVEIHPHYQDNNQRSLSFNMSLPGSEVPDWFNNQCRGSSVTVKLPPNWFD  1029

Query  181   N-FIGFAISVVFE---PMAQNSRI-GITFKLISQNH--KEYTTDSISSTTMTGEICESGH  339
             N F+GFAI  V +   P    S +  +    +  NH   E++   +     T  I ES H
Sbjct  1030  NEFLGFAICAVSDFKGPHNDASDLSALCHCSLKGNHGLYEFSFTLLDWGFSTDRILESDH  1089

Query  340   VWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLV  489
             +++ ++ +  ++  F + G     + F   T  +  E  NK +R G R V
Sbjct  1090  MFLAYVPWSEYR--FIEKGKRVNQRYFTEATFEIVLE--NKVERHGFRTV  1135



>ref|XP_010657779.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=1268

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 66/141 (47%), Gaps = 13/141 (9%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKL  258
             +  ++PG  IPEWF+ Q    SV++ LPP W +   +G A+ VVF       + G +   
Sbjct  1096  YDAVVPGSSIPEWFTHQSERCSVTVELPPHWCNTRLMGLAVCVVFHANIGMGKFGRSAYF  1155

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                    ++  +    T++    ++ H+W G      ++ LF D+       +   ++ A
Sbjct  1156  SMNESGGFSLHN----TVSMHFSKADHIWFG------YRPLFGDVFSSSIDHLK--VSFA  1203

Query  439   VRNEPWNKPKRCGIRLVYKED  501
               N      K+CG+RLV+++D
Sbjct  1204  GSNRAGEVVKKCGVRLVFEQD  1224



>ref|XP_010657777.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010657778.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1269

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 66/141 (47%), Gaps = 13/141 (9%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKL  258
             +  ++PG  IPEWF+ Q    SV++ LPP W +   +G A+ VVF       + G +   
Sbjct  1096  YDAVVPGSSIPEWFTHQSERCSVTVELPPHWCNTRLMGLAVCVVFHANIGMGKFGRSAYF  1155

Query  259   ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                    ++  +    T++    ++ H+W G      ++ LF D+       +   ++ A
Sbjct  1156  SMNESGGFSLHN----TVSMHFSKADHIWFG------YRPLFGDVFSSSIDHLK--VSFA  1203

Query  439   VRNEPWNKPKRCGIRLVYKED  501
               N      K+CG+RLV+++D
Sbjct  1204  GSNRAGEVVKKCGVRLVFEQD  1224



>ref|XP_003635135.2| PREDICTED: uncharacterized protein LOC100853815 [Vitis vinifera]
Length=2622

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 78/162 (48%), Gaps = 27/162 (17%)
 Frame = +1

Query  67    TRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF---EPMAQNS  234
             +R  +F+  +PG  IPEWF +Q MG S+ + LP  W+  NF+GFA+ +VF   EP  Q S
Sbjct  2371  SRIPKFNTYLPGNGIPEWFRNQCMGDSIMVQLPSHWYNDNFLGFAMCIVFALKEP-NQCS  2429

Query  235   RIGITFKLISQ-----NHKEYTTDSISSTTMTGE-ICESGHVWMGFLSFRLFQLLFPDIG  396
             R  +  +L S      N   +    +      G+   ES H+W+G+         FP I 
Sbjct  2430  RGAMLCELESSDLDPSNLGCFLDHIVWEGHSDGDGFVESDHLWLGY------HPNFP-IK  2482

Query  397   VDD------CTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
              DD       + I     IA    P ++ K CG RLVY ED+
Sbjct  2483  KDDMDWPNKLSHIKASFVIA--GIP-HEVKWCGFRLVYMEDL  2521



>ref|XP_008237597.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Prunus mume]
Length=1123

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 76/162 (47%), Gaps = 6/162 (4%)
 Frame = +1

Query  34    LLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVF  213
             L++   LQ        F ILIPG +IP+WF++Q +G SV   LP D ++ ++GFA   +F
Sbjct  931   LMVKKFLQEIPRSLFSFDILIPGSEIPDWFNNQSVGGSVIETLPSDSNSKWVGFAFCALF  990

Query  214   EPMAQNSRIGITFKLIS--QNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQ---L  378
              P  + S        IS    + +  T + +   +  +   S H+W+  LS + +     
Sbjct  991   VPAQEISATATKHNSISFFCLYDDLNTPAGAGYVIPIDDVASDHLWLILLSRQHYYWEPR  1050

Query  379   LFPDIG-VDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
               P+    + C        +  R+    K K+CG+R +Y++D
Sbjct  1051  HSPETYWREKCHDHKMRFHLNARSHQGVKVKKCGVRALYEQD  1092



>emb|CDP20074.1| unnamed protein product, partial [Coffea canephora]
Length=1056

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  43   NSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVV  210
            N +L+  S  +  FSI +PGG IP WF+ Q  G S++I LPP+W+ N F+GFA+ VV
Sbjct  764  NHMLKKFSLVDGSFSICLPGGSIPSWFTYQNSGPSITIELPPNWYNNEFMGFAVCVV  820



>ref|XP_010658914.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1366

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NF  186
             E++  T+ +++  LL+     N  FSI+ PG  IP+W   Q +G S+ I LP DW++ +F
Sbjct  1250  ESSVTTSPVMMQKLLE-----NIAFSIVFPGTGIPDWIWHQNVGSSIKIQLPTDWYSDDF  1304

Query  187   IGFAISVVFEPMAQNSRIGITFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGF  354
             +GFA+  V E + +     +   +    + K++  D       TG I  S HVW+G+
Sbjct  1305  LGFALCSVLEHLPERIICHLNSDVFDYGDLKDFGHD----FHWTGNIVGSEHVWLGY  1357



>ref|XP_010106413.1| TMV resistance protein N [Morus notabilis]
 gb|EXC10452.1| TMV resistance protein N [Morus notabilis]
Length=1251

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 71/157 (45%), Gaps = 23/157 (15%)
 Frame = +1

Query  85    SILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFKLI  261
             SI  PG +IPEWFS+Q  G S+SI L P W + NF+GF + VV  P A++ +        
Sbjct  986   SICYPGNQIPEWFSNQSAGSSISIELSPHWKNTNFLGFTLCVVAAPFAEH-KFHPQIHFY  1044

Query  262   SQNH---------------KEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIG  396
              ++H               + Y+ D+      +    +S HV   FL +  F     DI 
Sbjct  1045  CESHFRFKDGESRTLNCFWRGYSQDN-DDEDKSRIFLKSNHV---FLWYAPFHHGLEDIF  1100

Query  397   VDDCTKIFGCLTIAVRNEPWN--KPKRCGIRLVYKED  501
              +    +F    I    E  +  K K+CGI ++Y ++
Sbjct  1101  SNSTEALFEFYPIDSLEEKVDFCKVKKCGIHMLYLQE  1137



>ref|XP_007199198.1| hypothetical protein PRUPE_ppa021587mg [Prunus persica]
 gb|EMJ00397.1| hypothetical protein PRUPE_ppa021587mg [Prunus persica]
Length=1047

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 26/149 (17%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFEPMAQNSRIGITFK  255
            R+ I+IPG  IP WFS + +G SVS+   P    N ++G+A+  VFE    +S   +T  
Sbjct  859  RYEIIIPGRNIPWWFSYKNLGSSVSVKQRPQCRKNKWMGYAVCAVFE--VSSSGWNVTCD  916

Query  256  LISQNHKEYTTDSISSTTM-TGEICESGHVWMGFLSFRLFQLLFPDIGVD-----DCTKI  417
            L     ++Y    I++     GE     H+W+ ++S         DI  D      C + 
Sbjct  917  LKVNGKEKYPAPLIATNVQPVGE-----HLWLFYVS--------RDISFDREWQNSCNQ-  962

Query  418  FGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
               LT +  N      K+CG+RLVY++D+
Sbjct  963  ---LTFSFTNSSCCFVKKCGVRLVYQKDV  988



>gb|KHG11425.1| Protein maelstrom [Gossypium arboreum]
Length=230

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 78/171 (46%), Gaps = 25/171 (15%)
 Frame = +1

Query  37   LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSI---PLPPDW--HANFIGFAI  201
            +L + L+  +    +++I IPG +IP WFS Q    S SI    LPP++     F+GFA 
Sbjct  1    MLKTRLKTVANAREKYNIFIPGSEIPIWFSSQTDDSSKSIIKMQLPPNFLNDTQFLGFAF  60

Query  202  SVVFEPMAQN-----SRIGITFKLISQNHK-EYTTDSISSTTMTGEICESGHVWMGFLSF  363
            S +F     N       I  TF +  +N   E+  D       +  + +  H+W+ +L  
Sbjct  61   SCLFFSDFNNKPRRGEHISYTFVIHGRNFSGEFKRDYFHLDGKSTRVTKD-HLWIQYL--  117

Query  364  RLFQLLFPDIGVDDCTKI-FGCLTIAVRNEPW---NKPKRCGIRLVYKEDI  504
                   P  G+D  + +   C    V  E W   +  K+CG R+VY+ED+
Sbjct  118  -------PLNGIDFSSLVELECKETEVAFEIWGINSMVKKCGARIVYEEDL  161



>ref|XP_006478776.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1300

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 66/143 (46%), Gaps = 13/143 (9%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVVFEPMAQNSRIGITFKLIS  264
             I++PG +IP+WFS+Q  G S+ I LPP  +  N IGFA   V +    +S     F +  
Sbjct  1110  IVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVDSDCFRFFYVKC  1169

Query  265   QNHKEYTTDSISSTTMTG-------EICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFG  423
             Q   E  T S +     G       E+ +S HV +GF       + FPD G    T    
Sbjct  1170  QFDLEIETLSETKHVDLGYNSLFIEELIDSDHVILGFKP--CLNVGFPD-GYHRATATLK  1226

Query  424   CLTIAVRNEPWNKPKRCGIRLVY  492
                 A RN+   K KRCG+  VY
Sbjct  1227  --FFAERNQKGQKIKRCGVCPVY  1247



>ref|XP_006442968.1| hypothetical protein CICLE_v10018524mg [Citrus clementina]
 gb|ESR56208.1| hypothetical protein CICLE_v10018524mg [Citrus clementina]
Length=1292

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 66/143 (46%), Gaps = 13/143 (9%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVVFEPMAQNSRIGITFKLIS  264
             I++PG +IP+WFS+Q  G S+ I LPP  +  N IGFA   V +    +S     F +  
Sbjct  1102  IVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVDSDCFRFFYVKC  1161

Query  265   QNHKEYTTDSISSTTMTG-------EICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFG  423
             Q   E  T S +     G       E+ +S HV +GF       + FPD G    T    
Sbjct  1162  QFDLEIETLSETKHVDLGYNSLFIEELIDSDHVILGFKP--CLNVGFPD-GYHRATATLK  1218

Query  424   CLTIAVRNEPWNKPKRCGIRLVY  492
                 A RN+   K KRCG+  VY
Sbjct  1219  --FFAERNQKGQKIKRCGVCPVY  1239



>ref|XP_007199627.1| hypothetical protein PRUPE_ppa016158mg [Prunus persica]
 gb|EMJ00826.1| hypothetical protein PRUPE_ppa016158mg [Prunus persica]
Length=1177

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 71/154 (46%), Gaps = 17/154 (11%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVVFEPMAQNSRIGITFKL  258
             F I+IPG +IPEWF++Q +G SV   LP  D ++ ++GFA   +F P  + S  G    L
Sbjct  958   FGIVIPGSEIPEWFNNQNVGDSVIETLPSQDSNSKWVGFAFCALFLPAQEISATGTRHYL  1017

Query  259   ISQNHKEYTTDSISSTTM---TGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCL  429
             I      Y  ++++       T ++  S H+W+  LS   F       G         C 
Sbjct  1018  IDFRCL-YDLNTLAGPVYVMGTDDVVLSDHLWLFLLSRHHF--FREPSGRHGAYWREKCR  1074

Query  430   TIAVR----------NEPWNKPKRCGIRLVYKED  501
                +R           + W K K+CG+R +Y++D
Sbjct  1075  DHKIRFHFEARSSQGEKTWVKVKKCGVRALYEQD  1108



>emb|CDP07826.1| unnamed protein product [Coffea canephora]
Length=1159

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 16/153 (10%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVF----EPMAQNSRIGI  246
             FSI  PG  IP WF+ Q  G S+S+ LPP+W+ N F+G AI +VF      M   S    
Sbjct  997   FSICSPGQNIPAWFTYQDTGHSISVQLPPNWYCNEFMGMAICIVFGLKTPVMVVRSVNRE  1056

Query  247   TFKLISQNHKEYTTDSIS--STTMTGEIC-----ESGHVWMGFLSFRLFQLLFPDIGVDD  405
                +I   ++    D +S  +    G I      +S H  + +L  R    +  +   +D
Sbjct  1057  NTAVIPVQYRYKGRDKLSPPAVISVGAIAIETNVDSEHTCLAYLPCRKLSQIPQNWRSND  1116

Query  406   CTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
              T    C+ ++     + + K  G+RLVY++D+
Sbjct  1117  WT----CIELSSYTPRFMEFKAWGVRLVYRKDV  1145



>ref|XP_009360663.1| PREDICTED: TMV resistance protein N-like isoform X3 [Pyrus x 
bretschneideri]
Length=781

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 68/143 (48%), Gaps = 14/143 (10%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFEPMAQNSRIGITFK  255
            R+ I++PG +IP WF+ Q+MG  VS+ L P W  N ++G+A+  VFE       +    +
Sbjct  631  RYEIVMPGKEIPGWFTHQRMGPEVSVHLTPQWRDNKWMGYALCAVFEVYGSGWELSGVLE  690

Query  256  LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
            +     +EY    +SS         S H+W+ ++S     + F     + C +    L  
Sbjct  691  V--NGKEEYPAPLLSSDVQPV----SDHIWLLYVS---RGISFGTEWQNSCNQ----LNF  737

Query  436  AVRNEPWNKPKRCGIRLVYKEDI  504
              ++      K CG RLVY+ D+
Sbjct  738  HFKSSGPCLVKSCGTRLVYESDV  760



>ref|XP_008356042.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1142

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 71/160 (44%), Gaps = 20/160 (13%)
 Frame = +1

Query  37    LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVF  213
             +L   L+G      R+ I++PG +IP WF+ Q MG  VS+ L P W  N ++G+A+  VF
Sbjct  983   MLQRYLKGVPYAGDRYEIVMPGKEIPRWFTRQSMGSEVSVDLTPQWRDNKWMGYALCAVF  1042

Query  214   EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDI  393
             E       +    ++     +EY    +S          S H+W          LL+   
Sbjct  1043  EVYGSGWELSGVLEV--NGKEEYPAPLLSLDVQPV----SDHIW----------LLYVSR  1086

Query  394   GVDDCTKIFGCLTIAVRNEPWNKP---KRCGIRLVYKEDI  504
             G+   T+     +  + +   + P   K CG RLVY+ D+
Sbjct  1087  GISFGTEWQNSFSQIIFHFKSSGPCLVKSCGTRLVYEGDV  1126



>ref|XP_009343054.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1239

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 82/179 (46%), Gaps = 27/179 (15%)
 Frame = +1

Query  22    NTADLLLNSLLQGNSTRNRR-----FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HAN  183
             N   L+L   LQ +   + +     F+  IPG +IP WF  Q +G S+SI + P W  + 
Sbjct  970   NLTFLMLRKYLQSSMKADSQEKFAGFNSAIPGSEIPTWFMHQSVGTSLSIEVRPHWCSSK  1029

Query  184   FIGFAISVVFEPMAQNS---RIGITFKLISQNHKEYTTDSISSTTMTGEIC---------  327
             F G A+S VF  + +N+   R+ +          E  TD     TM+  I          
Sbjct  1030  FKGVAVSAVF-GVCENATICRVDLNSTDAPVIRCELDTD---KGTMSPGILYPFIEDMWI  1085

Query  328   ESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             ES H+W+G+LS   F + F +     C  I         N P  + K CG+RLVY++D+
Sbjct  1086  ESDHLWLGYLSRNGFPVSFFEWW--KCRHIRASFK---SNVPGLEVKMCGLRLVYEQDM  1139



>gb|KDO43807.1| hypothetical protein CISIN_1g0018051mg, partial [Citrus sinensis]
Length=489

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 8/125 (6%)
 Frame = +1

Query  13   ANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA--NF  186
            +N   A  +L   L+  S   ++F I++PG +IPEWF  Q  G S+   +P + +     
Sbjct  308  SNDGLAFSMLKEYLEAVSRPMQKFGIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKA  367

Query  187  IGFAISVVFE-----PMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMG  351
            +G+A+  VF      P  Q  R   T +L  Q     T+ SI       +  ESGH+W+ 
Sbjct  368  LGYAVCCVFHVREHSPGIQTRRSYPTHQLNCQMKGSSTSYSIEFREKFAQ-AESGHLWLL  426

Query  352  FLSFR  366
            +LS +
Sbjct  427  YLSLK  431



>emb|CDP20945.1| unnamed protein product [Coffea canephora]
Length=928

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 72/163 (44%), Gaps = 34/163 (21%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGITFKL  258
            FSI +PGG IP WF+ Q  G S ++ LPP+W+ + F+GFA+ VV + +     + I ++ 
Sbjct  722  FSICLPGGSIPSWFTYQNSGPSTTVKLPPNWYNSEFMGFAVCVVSDLITTPFLLEIQYRW  781

Query  259  ISQN-----------HKEYTTDSISST---TMTGEICESGHVWMGFLSF------RLFQL  378
            + Q             KE    S   T     T    +S H W+G+L F      R   +
Sbjct  782  LLQKIPGFPVQFTLIDKEMNLFSYVFTIGYVGTENNIDSEHTWLGYLPFDNIWSMRANTV  841

Query  379  LFP-DIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
              P D    D +  FG +            K  GI LVY+ D+
Sbjct  842  RSPNDWTCIDVSAYFGVI------------KAWGISLVYENDV  872



>ref|XP_010665089.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1028

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 68/145 (47%), Gaps = 18/145 (12%)
 Frame = +1

Query  73   NRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPM-AQNSRIGI  246
            +  F IL+PG ++P WF+ Q +G S++I L PDW ++NF+GFA+  VF    A +S I  
Sbjct  863  DNEFCILLPGKEVPNWFNHQAIGSSITIELSPDWYYSNFLGFAVCFVFTGKPATHSEISC  922

Query  247  TFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGC  426
                 S N   + +     T  +     S HVW+ +       +  P    D+ T I   
Sbjct  923  Q----SNNFSFFYSYPDPQTAFS-----SYHVWLAYQPRSRVDICHP----DEWTDIKAS  969

Query  427  LTIAVRNEPWNKPKRCGIRLVYKED  501
              I   N   +  ++CGI  +Y  D
Sbjct  970  FEI---NGVPDLIQKCGICPIYAHD  991



>ref|XP_008392312.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=910

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 71/158 (45%), Gaps = 28/158 (18%)
 Frame = +1

Query  76   RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFK  255
            +R  I+IPG +IP+WF++Q +G S+++ LPP    N++G A  VVF+ +  N       +
Sbjct  755  QRLKIVIPGSEIPKWFNNQNVGHSINVELPPPSCTNWLGIAFCVVFQDLKXNLANPAALR  814

Query  256  LISQNHKEYTTDSISSTTMTGEI--CESGHVWMGFL-SFR------------LFQLLFPD  390
               +    Y         +   I    S H+ + +L  +R            LF+  F D
Sbjct  815  HYDRFEIWYLDAHFXHRVLINRIGSVVSEHLCLFYLRRYRNQRRENCLQEQCLFETYFFD  874

Query  391  IGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
            I         G L   +     N  K+CG RLVY++D+
Sbjct  875  IK--------GQLKADL-----NMVKKCGARLVYEQDL  899



>ref|XP_006388190.1| hypothetical protein POPTR_0293s00200g, partial [Populus trichocarpa]
 gb|ERP47104.1| hypothetical protein POPTR_0293s00200g, partial [Populus trichocarpa]
Length=467

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 74/156 (47%), Gaps = 20/156 (13%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF--EPMAQNSRIGIT  249
            R  I++ G +IP+WF  Q +G S++I LPP W   N++GFA   V+     + ++   I 
Sbjct  265  RSDIVVYGSEIPKWFDYQSLGYSITIQLPPVWRDRNWVGFAFYAVYVNRDHSFSNFCNIQ  324

Query  250  FKLIS--QNHKEYTTDSISSTTMTGEICESG-------HVWMGFLSFRLFQLLFPDIGVD  402
            F   S  ++H E   +   S T    + E+G       H W+    F L +    D+   
Sbjct  325  FHCASVIRSHNEKKIEGFCSHTY---VLENGYVENQVDHTWL----FYLPRCALFDMDWQ  377

Query  403  DCTKIFGCLTIAVRNEPWN-KPKRCGIRLVYKEDIV  507
            D TK    + + + +       K+CG+R VYK+D +
Sbjct  378  DTTKNMHYIEVKLIDLSGQFHVKKCGVRFVYKDDAL  413



>emb|CDP20545.1| unnamed protein product [Coffea canephora]
Length=234

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 6/56 (11%)
 Frame = +1

Query  46   SLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVV  210
            SL+ G S     FSI +PGG IP WF+ Q  G S+++ LPP+W+ N F+GFA+ VV
Sbjct  14   SLVDGGS-----FSICLPGGSIPSWFTYQNSGPSITVKLPPNWYNNEFMGFAVCVV  64



>ref|XP_008245719.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
 ref|XP_008245720.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
 ref|XP_008245721.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
 ref|XP_008245722.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1233

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 72/153 (47%), Gaps = 22/153 (14%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
             F I+ PG KIPEWFS+Q++G S+++ LP D    +IG A+  VFE  A        F++ 
Sbjct  1006  FEIVTPGRKIPEWFSNQRLGASLTVELPLDSCTTWIGIALCAVFEVQADIPEFHY-FQIK  1064

Query  262   SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAV  441
              +          S     G+   S H+W+ ++S + FQ +        C +  G L   V
Sbjct  1065  CRPLGLRGHILFSKDFKIGDFV-SDHLWVIYVSRKQFQKI--------CGQKKGKLFFNV  1115

Query  442   RNEPWNKP------------KRCGIRLVYKEDI  504
             ++  + K             K+CG  LV+++D+
Sbjct  1116  QSHHYFKGGVSISSVSCASVKKCGFHLVHEQDV  1148



>ref|XP_010665272.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1164

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 56/119 (47%), Gaps = 5/119 (4%)
 Frame = +1

Query  13    ANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFI  189
             A  N A +L    L  N      +SI++PG  IPEWF    +G SV+I LPP+WH  +F+
Sbjct  1045  AQDNVATIL--EKLHQNFLPEIEYSIVLPGSTIPEWFQHPSIGSSVTIELPPNWHNKDFL  1102

Query  190   GFAISVVFEPMAQNSRIGITFKLISQNHKE--YTTDSISSTTMTGEICESGHVWMGFLS  360
             GFA+  VF         G      +   +E  Y T SIS T     + E+    M  +S
Sbjct  1103  GFALCSVFSLEEDEIIQGPGLICCNFEFREGPYLTSSISWTHSGDRVVETDRSHMAGVS  1161



>ref|XP_008359692.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1408

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 77/178 (43%), Gaps = 28/178 (16%)
 Frame = +1

Query  31    DLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQ-KMGRSVSIPLPPDWH-ANFIGFAIS  204
             ++L   L  G S+    F I IPG +IP+WFS Q  +G S++  L P W+ + F+G+A+ 
Sbjct  960   EMLKKFLHXGTSSARETFQIAIPGSEIPKWFSHQXBVGSSLTXDLXPLWNXSKFMGYALC  1019

Query  205   VVF---EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEIC---------------E  330
              VF   E    +      FK     H  +    +       E+C               +
Sbjct  1020  AVFVLDEHCVVDEHDTFQFKTFHATH--HLVCRLKHNGKQXEVCGTQPAFRFSEKFCQVD  1077

Query  331   SGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             S H+WM ++S   +   F     + C++I        R  P  K K+CG+ L Y +D+
Sbjct  1078  SDHLWMFYVSRDKY---FGTDWHBSCSQIX--FLFETRG-PGLKVKKCGVXLXYXQDV  1129



>ref|XP_008365707.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1451

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 71/153 (46%), Gaps = 14/153 (9%)
 Frame = +1

Query  85    SILIPGGKIPEWFS--DQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQ-----NSRI  240
             SI+ PG +IP WFS   Q  G SV I LPPDW   +  GFA+SV+   ++        R 
Sbjct  1130  SIVCPGKEIPNWFSFSYQSEGSSVHIKLPPDWFRTDLSGFALSVIVSCVSNCQGDLRVRA  1189

Query  241   GITFKLISQNHKEYTTDSISSTTMTGEICESGH---VW-MGFLSFRLFQLLFPDIG--VD  402
               T KL+ ++H+ +T+            C   H   VW   F+S  + +   PD+    +
Sbjct  1190  SFTVKLLGESHELFTSLFYIPIRRLNGYCYDRHLVYVWNKAFISEEVAKKCSPDVYKLAN  1249

Query  403   DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             + +  F       ++ P  K ++CGI   Y ED
Sbjct  1250  EASVEFYLPKFYEQHIPSAKVEKCGICPFYAED  1282



>ref|XP_003607597.1| NBS resistance protein [Medicago truncatula]
Length=1278

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 67/150 (45%), Gaps = 17/150 (11%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF-----EPMAQNSRIGIT  249
             I+IPG +IP W ++Q +G+S  I L P  H +NFIG A  VVF     +P       G  
Sbjct  886   IVIPGSEIPSWLNNQCVGKSTRIDLSPTLHDSNFIGLACCVVFSVTFDDPTMTTKEFGPD  945

Query  250   FKLISQNHKEYTTDSISSTTMTGEI--CESGHVWMGFL---SFRLFQLLFPDIGVDDCTK  414
               L+   H   T + +      G++   ES H W+ ++   S       F D+   D   
Sbjct  946   ISLVFDCHTA-TLEFMCPVIFYGDLITLESNHTWLIYVPRDSLSYQNKAFKDV---DHIT  1001

Query  415   IFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             +  CL     N      K CG R V+K+D+
Sbjct  1002  MTACLEDG--NGLHVDVKTCGYRYVFKQDL  1029



>ref|XP_008237742.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=947

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 78/182 (43%), Gaps = 30/182 (16%)
 Frame = +1

Query  19   KNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGF  195
            KN A  +L   L+G      RF  + PG +I EWFS +  G  VS  LP  W+ N ++G+
Sbjct  773  KNMAFAMLRRSLEGIPYAGNRFEAIFPGSEISEWFSYRNDGPVVSTDLPHHWYKNRWMGY  832

Query  196  AISVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESG-------------  336
            A+ VVF  + +     +  K     H   T   +      G + E G             
Sbjct  833  ALCVVF-VLRRRHPSNLLGKWKYGTHS--TAHGLRCEVRPGNLGEGGRCPFFGCSEELGK  889

Query  337  ----HVWMGFLSFRLFQLLFPDIGVDDCTKI-FGCLTIAVRNEPWNKPKRCGIRLVYKED  501
                H+W+ F+S   F   +     D C  + F   ++     P  + KRCG+R +Y++D
Sbjct  890  IESEHIWLSFVSGEYFGTSWQ----DSCRHLEFSFKSLG----PGLELKRCGVRFLYEKD  941

Query  502  IV  507
            +V
Sbjct  942  LV  943



>emb|CDP07823.1| unnamed protein product [Coffea canephora]
Length=977

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  43   NSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVV  210
            N +L+  S  +  FSI +PGG IP WF+ Q  G S+++ LPP+W+ N F+GFA+ VV
Sbjct  686  NHMLKEFSLVDGSFSICLPGGSIPSWFTFQNSGPSITVKLPPNWYNNEFMGFAVCVV  742



>ref|XP_008380886.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1514

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 71/153 (46%), Gaps = 14/153 (9%)
 Frame = +1

Query  85    SILIPGGKIPEWFS--DQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQ-----NSRI  240
             SI+ PG +IP WFS   Q  G SV I LPPDW   +  GFA+SV+   ++        R 
Sbjct  1130  SIVCPGKEIPNWFSFSYQSEGSSVHIKLPPDWFRTDLSGFALSVIVSCVSNCQGDLRVRA  1189

Query  241   GITFKLISQNHKEYTTDSISSTTMTGEICESGH---VW-MGFLSFRLFQLLFPDIG--VD  402
               T KL+ ++H+ +T+            C   H   VW   F+S  + +   PD+    +
Sbjct  1190  SFTVKLLGESHELFTSLFYIPIRRLNGYCYDRHXVYVWNKAFISEEVAKKCSPDVYKLAN  1249

Query  403   DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             + +  F       ++ P  K ++CGI   Y ED
Sbjct  1250  EASVEFYLPKFYEQHIPSAKVEKCGICPFYAED  1282



>ref|XP_007199428.1| hypothetical protein PRUPE_ppa026529mg, partial [Prunus persica]
 gb|EMJ00627.1| hypothetical protein PRUPE_ppa026529mg, partial [Prunus persica]
Length=1102

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 74/149 (50%), Gaps = 11/149 (7%)
 Frame = +1

Query  73    NRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITF  252
             + +F I+ P  KIPEWFS+Q +G S+ + LP D    ++G A+  V E  A  S   + F
Sbjct  933   DYQFEIVTPRRKIPEWFSNQSLGDSLIVELPLDSCTTWMGIALCAVVEFQADLSDFSL-F  991

Query  253   KLISQNHKEYTTDSISSTTM-----TGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKI  417
             ++      E T + +S   +     TG++  S H+W+ +L  +  Q +   I V   T+ 
Sbjct  992   RI--SCFAEGTGNVVSYEVLPKLFKTGDVV-SDHLWVIYLPCKPLQKICSQIKVFFETEY  1048

Query  418   FGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             F       R       K+CG RLV+K+D+
Sbjct  1049  F--CQDKNRYVYDKNVKKCGFRLVHKQDV  1075



>ref|XP_006491534.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
isoform X1 [Citrus sinensis]
 ref|XP_006491535.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
isoform X2 [Citrus sinensis]
Length=1254

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 66/144 (46%), Gaps = 6/144 (4%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFK  255
             R  +  PG +IPEWFS Q MG SV++ LPPDW + NF+GFA+  +  P       G   +
Sbjct  1091  RGCVSYPGSEIPEWFSYQSMGSSVTLELPPDWFNNNFVGFALCAIV-PDHHGITRGFNVR  1149

Query  256   LISQNHKEYTTDSISSTTMTG--EICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCL  429
              I +   +    S+      G     ES HV +G+  F L          + C + +   
Sbjct  1150  CILKTKDDVAVCSLYVWNHLGVNPSIESDHVLLGY-DFSLSSDSLGGSNNEFCIQFYIQH  1208

Query  430   TIAVRNEPWNKPKRCGIRLVYKED  501
                   E ++  K+CG  L+Y +D
Sbjct  1209  YEGPGIEGFD-VKKCGAHLIYAQD  1231



>ref|XP_006491536.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
isoform X3 [Citrus sinensis]
Length=1250

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 66/144 (46%), Gaps = 6/144 (4%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFK  255
             R  +  PG +IPEWFS Q MG SV++ LPPDW + NF+GFA+  +  P       G   +
Sbjct  1087  RGCVSYPGSEIPEWFSYQSMGSSVTLELPPDWFNNNFVGFALCAIV-PDHHGITRGFNVR  1145

Query  256   LISQNHKEYTTDSISSTTMTG--EICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCL  429
              I +   +    S+      G     ES HV +G+  F L          + C + +   
Sbjct  1146  CILKTKDDVAVCSLYVWNHLGVNPSIESDHVLLGY-DFSLSSDSLGGSNNEFCIQFYIQH  1204

Query  430   TIAVRNEPWNKPKRCGIRLVYKED  501
                   E ++  K+CG  L+Y +D
Sbjct  1205  YEGPGIEGFD-VKKCGAHLIYAQD  1227



>ref|XP_009368501.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1232

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 80/187 (43%), Gaps = 29/187 (16%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRN-RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH---  177
             +A  N    +L   LQG        F+I+ PG ++PEWF+ Q+ G S+ + LP D H   
Sbjct  988   KARNNMIFSMLQQFLQGTPPFVIHSFNIVTPGSEMPEWFNIQRAGDSMIVTLPDDVHPTR  1047

Query  178   ANFIGFAISVVFEPMAQNSRIGIT--------FKLISQNHKEYTTDSISSTT--------  309
             +  +GFA+  VF P    + + I          K +S       T S+S  T        
Sbjct  1048  SKLMGFALCAVFAPQENPAALEIDSLECHACGIKCLST-----VTGSMSGKTSLLVKGVY  1102

Query  310   --MTGEICESGHVWMGFLSFRLFQLL-FPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGI  480
                 G+I +S H+W+ +LSF+ +    +   G       F             K K+CG+
Sbjct  1103  YHKAGQI-QSDHLWLLYLSFKGYDPRNYWKGGFHQIEFSFKTFCSGPETNKCLKLKKCGV  1161

Query  481   RLVYKED  501
             RLV  ED
Sbjct  1162  RLVKAED  1168



>gb|AES89794.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1054

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 67/150 (45%), Gaps = 17/150 (11%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF-----EPMAQNSRIGIT  249
             I+IPG +IP W ++Q +G+S  I L P  H +NFIG A  VVF     +P       G  
Sbjct  886   IVIPGSEIPSWLNNQCVGKSTRIDLSPTLHDSNFIGLACCVVFSVTFDDPTMTTKEFGPD  945

Query  250   FKLISQNHKEYTTDSISSTTMTGEI--CESGHVWMGFL---SFRLFQLLFPDIGVDDCTK  414
               L+   H   T + +      G++   ES H W+ ++   S       F D+   D   
Sbjct  946   ISLVFDCHTA-TLEFMCPVIFYGDLITLESNHTWLIYVPRDSLSYQNKAFKDV---DHIT  1001

Query  415   IFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             +  CL     N      K CG R V+K+D+
Sbjct  1002  MTACLEDG--NGLHVDVKTCGYRYVFKQDL  1029



>emb|CDP21222.1| unnamed protein product, partial [Coffea canephora]
Length=855

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 88/186 (47%), Gaps = 23/186 (12%)
 Frame = +1

Query  10   EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-F  186
            E   +  D   N +L+     +  FSI +PGG+IP WF+ Q  G S+   LP +W+++ F
Sbjct  616  EQTSSMIDATWNHMLEELLLIDDNFSICLPGGRIPSWFTYQNWGPSIRFKLPSNWYSDEF  675

Query  187  IGFAISVVFEPMAQNSR----------IGITFKLISQNHKEYTTDSISSTTMTGEI--CE  330
            +GFA+  V + +  +            + I F LI Q  K    D + +    G     +
Sbjct  676  MGFAVCAVSDLITTSLSVRHFLQKLPGVRIQFNLIDQEKK--ICDCMFTIGYVGSENNID  733

Query  331  SGHVWMGFLSF-RLFQLLFPDI-GVDDCTKIFGCLTIA--VRNEPWNKPKRCGIRLVYKE  498
            S H  +G+LSF  ++ L    +   +D T    C+ ++  V ++ +   K  GI LVY++
Sbjct  734  SEHTCLGYLSFDNIWSLCSRRVRSPNDVT----CIEVSADVLSKKYMVFKAWGISLVYEK  789

Query  499  DIVXET  516
            D+   T
Sbjct  790  DVRRNT  795



>ref|XP_008373290.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=499

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 66/148 (45%), Gaps = 23/148 (16%)
 Frame = +1

Query  88   ILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFE-PMAQNSRIGI-----T  249
            I+IPG +IP WF +Q +G S+++ LPP    +++G A  VVFE PM   +          
Sbjct  355  IVIPGSEIPGWFKNQSVGHSINVELPPPSCTDWLGIAFCVVFEDPMKNLANPAALPHCDK  414

Query  250  FKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFL---SFRLFQLLFPDIGVDDCTKIF  420
            F ++ ++   Y       + M      S H+W+ +L   S    Q LF           F
Sbjct  415  FNILVRDFYSYNVTYKIGSLM------SEHLWVFYLDRCSCYQEQFLF--------ETYF  460

Query  421  GCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
                        N  K+CG RL+YK+D+
Sbjct  461  DAFGKRGVKADLNTVKKCGARLLYKQDL  488



>ref|XP_002523474.1| TMV resistance protein N, putative [Ricinus communis]
 gb|EEF38933.1| TMV resistance protein N, putative [Ricinus communis]
Length=1091

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 78/162 (48%), Gaps = 17/162 (10%)
 Frame = +1

Query  67   TRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVVFE-----PMAQ  228
            TRN  F++ + G K PEWFS Q +G S++I LP   ++  F+GFA   V E      +++
Sbjct  838  TRNY-FAVALAGSKTPEWFSYQSLGCSITISLPTCSFNTMFLGFAFCAVLEFEFPLVISR  896

Query  229  NSRIGITFKLISQNHKEYTTDSISSTTMTGE-ICESGHV--WMGFLSFRLFQLLFPDIGV  399
            NS   I  +   +N  +   D +S +  + E I ES HV  W  F S  L   L  +  +
Sbjct  897  NSHFYIACESRFENTNDDIRDDLSFSASSLETIPESDHVFLWYRFNSSDLNSWLIQNCCI  956

Query  400  -DDCTKIFGCLTIAVRN-----EPWN-KPKRCGIRLVYKEDI  504
                +  F      + N     E W  K KRCG+ L+Y E++
Sbjct  957  LRKASFEFKAQYRFLSNHHPSTEKWEVKVKRCGVHLIYNENV  998



>emb|CDY10733.1| BnaA05g12030D [Brassica napus]
Length=1186

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 75/162 (46%), Gaps = 30/162 (19%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV-----FEPMAQNSRIGIT  249
             I  P  +IP WF  Q++GRS+ I LPP W  ++F+G A SVV     +E  A+   +  +
Sbjct  968   ICFPASEIPNWFCYQRLGRSLEITLPPHWCDSSFVGLAFSVVISFTDYEDSAKRFSVKCS  1027

Query  250   FKLISQNHKEYTTDSISSTTMTG--EICE----------SGHVWMGFLSFRLFQLLFPDI  393
              K  +Q+    ++ ++   T+ G  E C+          S HV+MG+ SF   + L  + 
Sbjct  1028  GKFENQD----SSSTVFDFTLAGWNEPCKTLSHEPRKLTSDHVFMGYNSFFHVEQLHEE-  1082

Query  394   GVDDCTKIFGCLTI-AVRNEPWNKPK-----RCGIRLVYKED  501
               + C          A  NE   K +     +CG+ LVY  D
Sbjct  1083  -SNSCCHTKASFEFYATDNETKKKLETCKVIKCGMSLVYVPD  1123



>ref|XP_008237536.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1254

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 81/178 (46%), Gaps = 23/178 (13%)
 Frame = +1

Query  4     LCEANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN  183
             L E       L+L  L +    +  + +I+ PG +IPEWF +Q +G S+ + LPPD  + 
Sbjct  948   LVENEGGCDSLILGVLWRFLQVQVGQLNIVTPGRRIPEWFKNQSVGDSLVVELPPDSCST  1007

Query  184   FIGFAISVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSF  363
             ++GFA+  VFE    N          + +  E+   +I  ++   E+    +VW+     
Sbjct  1008  WMGFALCAVFEEDHPNP---------AHDLSEFDYFTIDCSSGEKEL---AYVWLEIGHV  1055

Query  364   RLFQLLFPDIGVDD----CT--KIFGCLTIAVRNEPWNKP-----KRCGIRLVYKEDI  504
                 L    +  +D    C+  KI        R  P ++      K+CG+RLV+++D+
Sbjct  1056  VSDHLCVFYVSCEDWKRQCSQMKILFQTYYESRARPSDRRNCSSIKKCGLRLVHEQDV  1113



>ref|XP_008237860.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1225

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 72/141 (51%), Gaps = 8/141 (6%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
             F+IL PG KIPEWFS+Q +G S+++ LP  W    +G A  VVFE  A  S   + +  I
Sbjct  1005  FTILTPGRKIPEWFSNQSLGDSLTVELPTTW----MGIAFCVVFEVQANLS--DVHYVRI  1058

Query  262   SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAV  441
             + + +   T  +     T     S H+W+ ++S    + +   I     T  +    I +
Sbjct  1059  NCSPQGMRTHGVFPKEFTIFDVVSDHLWVIYVSRIQSEKICGQIKF-LFTTYYSHQDIML  1117

Query  442   RNEPWNKPKRCGIRLVYKEDI  504
              ++  +  K+CG RLV+++D+
Sbjct  1118  EHKK-SCVKKCGFRLVHEQDV  1137



>ref|XP_011468890.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Fragaria vesca subsp. vesca]
Length=1236

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 62/118 (53%), Gaps = 5/118 (4%)
 Frame = +1

Query  43    NSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFE-  216
             +S  Q N  +   F + +PG +IP WF+ Q  G S+++ LPP+W  N F GFAI   F+ 
Sbjct  1034  HSHCQDNCLQVLSFKMCLPGREIPNWFNHQCSGSSITVQLPPNWLCNQFFGFAICAKFKG  1093

Query  217   -PMAQNSRIGITFKLISQNHKE--YTTDSISSTTMTGEICESGHVWMGFLSFRLFQLL  381
               +  +     +F  +S NH +  +  D +          ES H+++G++S+  ++L+
Sbjct  1094  ADIHTSHLSARSFCTLSGNHGKIAFNFDLLRWRFKIDRFLESDHMFLGYVSWSKYRLV  1151



>ref|XP_006442188.1| hypothetical protein CICLE_v10022183mg [Citrus clementina]
 gb|ESR55428.1| hypothetical protein CICLE_v10022183mg [Citrus clementina]
Length=217

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 62/142 (44%), Gaps = 10/142 (7%)
 Frame = +1

Query  88   ILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVVFEPMAQNSRIGITFKLIS  264
            I++PGG+IP+WFS+Q  G S+ I LPP  +  N IGFA   V +     SR    F    
Sbjct  26   IVLPGGEIPDWFSNQSSGSSIYIQLPPHSFCRNLIGFAFCAVLDFKKVYSRCMCDFYFYR  85

Query  265  QNHKEYTTDSISSTTMTG------EICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGC  426
            Q   E  T S +     G         +S HV +GF       + FPD G    T     
Sbjct  86   QFDLEIKTLSETKHVDLGFDLPTRYSLDSDHVILGFKP--CLNVGFPD-GYHHTTVSLKF  142

Query  427  LTIAVRNEPWNKPKRCGIRLVY  492
                 R++   K KR G+  VY
Sbjct  143  FNKCYRSQKDCKIKRYGVCPVY  164



>ref|XP_009113872.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Brassica rapa]
 ref|XP_009113873.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Brassica rapa]
Length=1198

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 72/153 (47%), Gaps = 15/153 (10%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF---EPMAQNSRIGIT  249
             FS   PG ++P WF  + +G  + + L P WH     G A+  V    +   Q SR+ +T
Sbjct  961   FSTCFPGCEVPSWFCYETVGSELEVKLLPHWHDKRLAGIALCAVVSFNDCHDQISRLSVT  1020

Query  250   --FKLISQNHKEYT--TDSISSTTMTGEICESGHVWMGFLSFRLFQLLFP-DIGVDDCTK  414
               FKL  ++ K +   T  + S T  G+  ES HV++G+ S   + + FP D   D C+ 
Sbjct  1021  CNFKLKVED-KSWVPFTCPVGSWTRQGDKIESDHVFIGYTSCP-YTIKFPEDENSDKCSS  1078

Query  415   IFGCLTIAVRNEPWNKPK----RCGIRLVYKED  501
                 L   V      K K    +CG+ LVY +D
Sbjct  1079  TEASLEFTVAGGTNEKGKLKVLKCGLGLVYAKD  1111



>ref|XP_008382496.1| PREDICTED: uncharacterized protein LOC103445285 [Malus domestica]
 ref|XP_008348946.1| PREDICTED: uncharacterized protein LOC103412126 [Malus domestica]
Length=189

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 75/158 (47%), Gaps = 26/158 (16%)
 Frame = +1

Query  85   SILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFE----PMAQNSRIGIT  249
            +I+ PG +IP WFS Q  G SV+I LPPDW  A F+GFA SVV      P+    R+G+ 
Sbjct  34   TIVCPGRQIPVWFSYQNGGSSVNIELPPDWFRAGFLGFAFSVVVAYGQYPLL---RLGVK  90

Query  250  FKLI-----SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQ--LLFPDIG--VD  402
            F L      SQ    +             I    H+++ + +F+L +   L  D    V 
Sbjct  91   FTLKNNDGESQEISRHFIFPCGYGERHDYIFNPYHMYVWYNAFKLDKEAKLSNDFYKLVT  150

Query  403  DCTKIFGCLTIAVRNEP-----WNKPKRCGIRLVYKED  501
            + +  F C     RN P     + K ++CGI L+Y +D
Sbjct  151  EASVHFSC----PRNCPDQLLSYVKVEKCGICLLYADD  184



>gb|KDO37804.1| hypothetical protein CISIN_1g039311mg, partial [Citrus sinensis]
Length=909

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 71/158 (45%), Gaps = 21/158 (13%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NFIGFAISVVFEPMAQNSRIGITFK  255
            R  I  PG ++PEWF  Q MG S +  LPPDW + NF+GFA+  V      +   G  F+
Sbjct  726  RGMICFPGSELPEWFMFQSMGSSATFNLPPDWFSYNFVGFALCAVV-GFRDHHDDGGGFQ  784

Query  256  LISQNHKEYTTDSISSTT---MTG--------EICESGHVWMGFLSFRLFQLLFPDIGVD  402
            +  +  K  T D +       +TG            S HV++GF  F +F   F +    
Sbjct  785  VFCEC-KLKTEDGLCRVAVGHLTGWSDGYRGPRYIGSDHVFLGF-DFYMFSDGFDEYYYS  842

Query  403  DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDIVXET  516
            D  ++F    I    E   +  +CGI L+Y +D    T
Sbjct  843  D--EVF----IQFYLEDCCEVTKCGIHLLYAQDFSDST  874



>ref|XP_008381726.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1131

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 79/178 (44%), Gaps = 36/178 (20%)
 Frame = +1

Query  40    LNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFE  216
             L   L+G      +F  + PG +I EWFSDQ     VS+ LP  W+ N +IG+A+  VF 
Sbjct  962   LRRFLEGIPYIGNKFEAIYPGSEISEWFSDQSERPVVSMELPRHWYKNEWIGYALCAVFT  1021

Query  217   PMAQNSRIGITFKLISQ-NHKEYTTD-------------------SISSTTMTGEICESG  336
                Q     +   L+ + N+  +TT                    S + +   G+I E  
Sbjct  1022  VHRQ-----LPPNLLGKWNYGTHTTAHGLRCEVKPGNLGVGGWCPSFACSEELGQI-EKE  1075

Query  337   HVWMGFLSFRLFQLLFPDIGVDDCTKI-FGCLTIAVRNEPWNKPKRCGIRLVYKEDIV  507
             H+W+ F+S   F   + D     C  + F   T+    E     KRCG+RL+Y+ D+V
Sbjct  1076  HLWISFVSGEHFGTTWQD----SCHHLEFTFKTLGSGLEV----KRCGVRLIYERDLV  1125



>gb|KDO40706.1| hypothetical protein CISIN_1g036772mg, partial [Citrus sinensis]
Length=583

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 70/150 (47%), Gaps = 17/150 (11%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFK  255
            R  +  PG +IPEWFS Q MG SV++ LPP W + NF+GFA+  +      ++R G T +
Sbjct  414  RGCVSYPGSEIPEWFSYQSMGSSVTLELPPGWVNNNFVGFALCAIVPDHHGDTR-GFTVR  472

Query  256  LISQNHKEYTTDSISSTTM--------TGEICESGHVWMGFLSFRLFQLLFPDIGVDDCT  411
             I +     T D I+   +             ES HV +G+  F +    F     + C 
Sbjct  473  CILK-----TKDDIAVCFLYVWEDYFGVNSSIESDHVLLGY-DFSVSSDSFGGSNSEFCI  526

Query  412  KIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
            + +         E ++  K+CG  L+Y +D
Sbjct  527  QFYIQHFEGPGIEGFDV-KKCGAHLIYVQD  555



>ref|XP_008237763.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1072

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 67/142 (47%), Gaps = 13/142 (9%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGITFK  255
             R+ I+IPG +IP WF  Q+MG S ++ L P W    ++G+A+  VF+       +    +
Sbjct  901   RYEIVIPGSEIPWWFPHQRMGSSTTVELTPHWRDTKWMGYALCAVFQVFGSGWDLSCVLE  960

Query  256   LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
             +   N KE     + ST +     +S H+W+ ++S  +        G +        L  
Sbjct  961   V---NGKEDYPAPLLSTDVQP---KSDHLWLFYVSRDI------SFGTEWQNSSCNQLIF  1008

Query  436   AVRNEPWNKPKRCGIRLVYKED  501
             + ++      KRC  RLVY++D
Sbjct  1009  SFKSSGSCLVKRCSARLVYEQD  1030



>ref|XP_008237864.1| PREDICTED: TMV resistance protein N-like, partial [Prunus mume]
Length=1182

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 15/161 (9%)
 Frame = +1

Query  40    LNSLLQGNSTRNRRFSILIP--GGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVF  213
             L  L+     RN +F I+ P  G KIPEWFS Q +G S+++ LP D    +IG A+  VF
Sbjct  969   LQGLIPRPDFRNHKFEIVTPSPGRKIPEWFSYQSLGDSLTVELPLDSCTTWIGIALCAVF  1028

Query  214   EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDI  393
             E     S +   F++   +        +SS         S H+ + ++S + F  +    
Sbjct  1029  EVQDDLSDLHY-FRIRCSSPLGMVPRGVSSKYFKIGDFVSNHLCVIYVSRKEFGKI----  1083

Query  394   GVDDCTKIFGCLTIAVRNEPWNKP----KRCGIRLVYKEDI  504
                 C +I    T     E W +     K+CG  LV+K+D+
Sbjct  1084  ----CRQIKVLFTTYSHEEVWVEKRSCVKKCGFCLVHKQDV  1120



>ref|XP_007199069.1| hypothetical protein PRUPE_ppa018765mg, partial [Prunus persica]
 gb|EMJ00268.1| hypothetical protein PRUPE_ppa018765mg, partial [Prunus persica]
Length=1192

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (47%), Gaps = 18/148 (12%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
             F I+ PG +IPEWFS+Q +G S+++ LP D    ++G A+  VFE   Q+      +  I
Sbjct  970   FEIVTPGREIPEWFSNQSLGDSLTVELPLDSCTTWMGIALCAVFE--VQDDLSEFHYFQI  1027

Query  262   SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAV  441
             S + +       S      ++  S H+W+ ++S   F        V  C +I    T   
Sbjct  1028  SCSLQGMQPFGFSRCFKIRDVV-SDHLWVIYISREKF--------VKKCGQIKVLSTTYY  1078

Query  442   RNEPWNKP-------KRCGIRLVYKEDI  504
               E   +P       K+C  RLV+++D+
Sbjct  1079  SKEEMWRPEKSCMSVKKCAFRLVHEQDV  1106



>ref|XP_006470766.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1171

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 71/158 (45%), Gaps = 21/158 (13%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NFIGFAISVVFEPMAQNSRIGITFK  255
             R  I  PG ++PEWF  Q MG S +  LPPDW + NF+GFA+  V      +   G  F+
Sbjct  961   RGMICFPGSELPEWFMFQSMGSSATFNLPPDWFSYNFVGFALCAVV-GFRDHHDDGGGFQ  1019

Query  256   LISQNHKEYTTDSISSTT---MTG--------EICESGHVWMGFLSFRLFQLLFPDIGVD  402
             +  +  K  T D +       +TG            S HV++GF  F +F   F +    
Sbjct  1020  VFCEC-KLKTEDGLCRVAVGHLTGWSDGYRGPRYIGSDHVFLGF-DFYMFSDGFDEYYYS  1077

Query  403   DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDIVXET  516
             D  ++F    I    E   +  +CGI L+Y +D    T
Sbjct  1078  D--EVF----IQFYLEDCCEVTKCGIHLLYAQDFSDST  1109



>ref|XP_008243697.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1007

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 4/100 (4%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
            FS+LIPG +IPEWFS+Q +G  +   LP D ++ ++GFAI  +  P  + S        +
Sbjct  790  FSVLIPGSEIPEWFSNQSVGDPLVETLPSDSNSKWVGFAICALVGPAQEISATATKLNYL  849

Query  262  SQNHKEYTTDSISSTTMTG-EICE--SGHVWMGFLSFRLF  372
             + H  Y   +I +    G EI E  S H+W+  LS + F
Sbjct  850  -KFHCVYDLINIYAGPSFGIEITEVASDHLWLILLSRKHF  888



>ref|XP_010665280.1| PREDICTED: uncharacterized protein LOC104882720 [Vitis vinifera]
Length=324

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 52/117 (44%), Gaps = 19/117 (16%)
 Frame = +1

Query  70   RNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQ------  228
             N  FSI+ PG  IPEW   Q  G S+ I LP DW+  +F+GFA   V E + +      
Sbjct  28   ENIAFSIIFPGSGIPEWIWHQNAGSSIKIELPTDWYNDDFLGFAFFSVLEHLPERIICRL  87

Query  229  NSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFL---SFRLFQLLFPD  390
            NS +     L    H  +           G I  S HVW+G+      RLFQ   P+
Sbjct  88   NSDVFYYGDLKDFGHDFH---------WKGNIVGSEHVWLGYQPCSQLRLFQFNDPN  135



>ref|XP_006491604.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=856

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 70/150 (47%), Gaps = 17/150 (11%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFK  255
            R  +  PG +IPEWFS Q MG SV++ LPP W + NF+GFA+  +      ++R G T +
Sbjct  692  RGCVSYPGSEIPEWFSYQSMGSSVTLELPPGWVNNNFVGFALCAIVPDHHGDTR-GFTVR  750

Query  256  LISQNHKEYTTDSISSTTM--------TGEICESGHVWMGFLSFRLFQLLFPDIGVDDCT  411
             I +     T D I+   +             ES HV +G+  F +    F     + C 
Sbjct  751  CILK-----TKDDIAVCFLYVWEDYFGVNSSIESDHVLLGY-DFSVSSDSFGGSNSEFCI  804

Query  412  KIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
            + +         E ++  K+CG  L+Y +D
Sbjct  805  QFYIQHFEGPGIEGFDV-KKCGAHLIYVQD  833



>ref|XP_009340812.1| PREDICTED: putative disease resistance protein At4g11170 isoform 
X3 [Pyrus x bretschneideri]
Length=1066

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 74/158 (47%), Gaps = 17/158 (11%)
 Frame = +1

Query  70    RNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFE----PMAQNS  234
             R    +I+ PG +IP WFS Q  G SV+I LPPDW  A F+GFA SVV      P+    
Sbjct  907   RRPLVTIVCPGRQIPIWFSYQNGGSSVNIELPPDWFRAGFLGFAFSVVVAYGQYPLL---  963

Query  235   RIGITFKLI-----SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQ--LLFPDI  393
             R+G+ F L      SQ    +             I    H+++ + +F L +   L  D 
Sbjct  964   RLGVKFTLKNNDGESQEISRHFIFPCGYGERHDYIFNPYHMYVWYNAFELDKEAKLSNDF  1023

Query  394   --GVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
                V + +  F CL    +   + K ++CGI L+Y +D
Sbjct  1024  YKRVTEASVHFFCLRNCDQLVSYVKVEKCGICLLYADD  1061



>ref|XP_009366533.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=505

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 81/178 (46%), Gaps = 25/178 (14%)
 Frame = +1

Query  22   NTADLLLNSLLQGNSTRNRR-----FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HAN  183
            N   L+L   LQ +   + +     FS  IPG +IP WF  Q +G S+SI + P W  + 
Sbjct  256  NLTFLMLRKYLQSSMKADSQEPFAGFSSAIPGSEIPTWFMHQSVGTSLSIEVRPHWCSSK  315

Query  184  FIGFAISVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEIC---------ESG  336
            F G A+S VF  + +N+ I       + + K          TM+  I          ES 
Sbjct  316  FKGVAVSAVFG-VCENATIRRVDLNSTDDPKIRCELDTDKGTMSPGIVFPFTKDIWIESD  374

Query  337  HVWMGFLSFRLFQLLFPDIGVD--DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
            H+W+ +L+    +  FP+   +   C  I      +V   P  + K CG+RLVY++D+
Sbjct  375  HLWLCYLT----RNGFPESAFEWWKCRHIQASFKSSV---PGLEVKMCGLRLVYEQDM  425



>ref|XP_008365841.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1617

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 2/102 (2%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
               ++IPG +IPEWFS+Q +G S+++ LPP    N++G A  VVF+   QN       +  
Sbjct  1481  LKVVIPGSEIPEWFSNQSVGHSINVELPPPSCTNWLGIAFCVVFQDPKQNLANPAALRHY  1540

Query  262   SQNHKEYTTDSISSTTMTGEI--CESGHVWMGFLSFRLFQLL  381
              +    Y+    S   +   I    S H+W+ +   RL   L
Sbjct  1541  DRFEIWYSDAHFSHRVLINRIGSAVSEHLWITWALRRLINNL  1582



>ref|XP_009340810.1| PREDICTED: TMV resistance protein N-like isoform X2 [Pyrus x 
bretschneideri]
 ref|XP_009340811.1| PREDICTED: TMV resistance protein N-like isoform X2 [Pyrus x 
bretschneideri]
Length=1322

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 73/153 (48%), Gaps = 17/153 (11%)
 Frame = +1

Query  85    SILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFE----PMAQNSRIGIT  249
             +I+ PG +IP WFS Q  G SV+I LPPDW  A F+GFA SVV      P+    R+G+ 
Sbjct  1168  TIVCPGRQIPIWFSYQNGGSSVNIELPPDWFRAGFLGFAFSVVVAYGQYPLL---RLGVK  1224

Query  250   FKLI-----SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQ--LLFPDI--GVD  402
             F L      SQ    +             I    H+++ + +F L +   L  D    V 
Sbjct  1225  FTLKNNDGESQEISRHFIFPCGYGERHDYIFNPYHMYVWYNAFELDKEAKLSNDFYKRVT  1284

Query  403   DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             + +  F CL    +   + K ++CGI L+Y +D
Sbjct  1285  EASVHFFCLRNCDQLVSYVKVEKCGICLLYADD  1317



>gb|KDP26905.1| hypothetical protein JCGZ_18063 [Jatropha curcas]
Length=841

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 75/165 (45%), Gaps = 21/165 (13%)
 Frame = +1

Query  37   LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVF  213
            LL    QG    +   S+ + G ++PEWF    MG S+ + LPP W++N + GFAI VVF
Sbjct  642  LLKHSSQGLFNPSSHVSMCLAGNEVPEWFDYMGMGSSLEVELPPYWYSNKWKGFAICVVF  701

Query  214  EPMAQNSRIGITFKLISQNHKEYTTDS-----ISSTTMTGEIC--ESGHVWMGFLSFRLF  372
            EP A +  +  T  L    H  Y +D        ST ++G+     +  +W  F+     
Sbjct  702  EPNALS--LSETASLSCDLHA-YMSDQPLFLGRQSTEISGDTAGNMAEKIWFNFI-----  753

Query  373  QLLFPDIGVDDCTKIFGCLTIAVR-NEPWNKPKRCGIRLVYKEDI  504
                P   ++       C  I +       K K CG+R++Y+ D+
Sbjct  754  ----PGSSLNAVAWGEACRKIKMTFFSNGLKVKYCGLRIIYEHDV  794



>ref|XP_007227167.1| hypothetical protein PRUPE_ppa023967mg [Prunus persica]
 gb|EMJ28366.1| hypothetical protein PRUPE_ppa023967mg [Prunus persica]
Length=1142

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 84/181 (46%), Gaps = 20/181 (11%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANF  186
             E   N A L+L    QG      +F I+IPG +IP+WFS+Q +G S+ +  P    ++ +
Sbjct  896   EGCNNIAFLMLQKFRQGVRHSVLKFDIVIPGSEIPDWFSNQTVGDSLMVERPLHLCNSKW  955

Query  187   IGFAISVVFEPMAQNSRI----------GITFKLISQNHKEYT---TDSISSTTMTGEIC  327
             +GF +  VF        +          GI   L      +++    D++   ++ G + 
Sbjct  956   MGFVLCAVFGAQENPDLLEFDYFGRHPCGILCYLEIAGSYQFSFPIPDAVLHHSV-GHVA  1014

Query  328   ESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLT--IAVRNEPWNKPKRCGIRLVYKED  501
              S H+W+ + S +  +  + +   D C+++        +V+     K K+CGI LVY ED
Sbjct  1015  -SDHLWLLYFSRKHHR--YENFLKDSCSQVEVLFKPFCSVQKNTCLKLKKCGIHLVYGED  1071

Query  502   I  504
             +
Sbjct  1072  V  1072



>ref|XP_009340809.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
Length=1328

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 73/153 (48%), Gaps = 17/153 (11%)
 Frame = +1

Query  85    SILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFE----PMAQNSRIGIT  249
             +I+ PG +IP WFS Q  G SV+I LPPDW  A F+GFA SVV      P+    R+G+ 
Sbjct  1174  TIVCPGRQIPIWFSYQNGGSSVNIELPPDWFRAGFLGFAFSVVVAYGQYPLL---RLGVK  1230

Query  250   FKLI-----SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQ--LLFPDI--GVD  402
             F L      SQ    +             I    H+++ + +F L +   L  D    V 
Sbjct  1231  FTLKNNDGESQEISRHFIFPCGYGERHDYIFNPYHMYVWYNAFELDKEAKLSNDFYKRVT  1290

Query  403   DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             + +  F CL    +   + K ++CGI L+Y +D
Sbjct  1291  EASVHFFCLRNCDQLVSYVKVEKCGICLLYADD  1323



>ref|XP_010645917.1| PREDICTED: disease resistance protein RPS4-like [Vitis vinifera]
Length=230

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (45%), Gaps = 12/143 (8%)
 Frame = +1

Query  91   LIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGITFKLISQ  267
            ++ G +IP+W   Q  G  V   LPP+W+ +N +G A+S V    A N  I +++ L   
Sbjct  1    MVYGSRIPDWIRYQSSGCEVEADLPPNWYNSNLLGLALSFVTYVFASNVIIPVSYTL---  57

Query  268  NHKEYTTDSISSTTMTGEICESG----HVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
                Y+T S  +  ++    + G    HVW+ ++   LF        ++        ++ 
Sbjct  58   ---RYSTSSYIANRISIRCDKEGVGLDHVWLLYIKLPLFSNWHNGTPINWHEVTHISVSF  114

Query  436  AVRNEPWNKP-KRCGIRLVYKED  501
              +   W  P KRCG  LVY  D
Sbjct  115  GTQVMGWYPPIKRCGFDLVYSND  137



>gb|KDO47983.1| hypothetical protein CISIN_1g044579mg, partial [Citrus sinensis]
Length=1103

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +1

Query  76    RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFK  255
             +  SI +PG +IP+WFS+Q  G S+++ LP     N IGFA+  V E    +S     F 
Sbjct  945   KELSIFVPGSEIPDWFSNQSSGSSITLQLPQHSFGNLIGFALCAVIEFKQLSSNSWSYFN  1004

Query  256   LISQNHKEYTTDSISSTTMTG--EICESGHVWMGF  354
             +  +   E    S     + G  +  +S HV +GF
Sbjct  1005  VGCRYSYEINKISAKDVYLAGIVDFIDSDHVILGF  1039



>ref|XP_006492798.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1224

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +1

Query  76    RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFK  255
             +  SI +PG +IP+WFS+Q  G S+++ LP     N IGFA+  V E    +S     F 
Sbjct  1023  KELSIFVPGSEIPDWFSNQSSGSSITLQLPQHSFGNLIGFALCAVIEFKQLSSNSWSYFN  1082

Query  256   LISQNHKEYTTDSISSTTMTG--EICESGHVWMGF  354
             +  +   E    S     + G  +  +S HV +GF
Sbjct  1083  VGCRYSYEINKISAKDVYLAGIVDFIDSDHVILGF  1117



>ref|XP_008237366.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1050

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 70/147 (48%), Gaps = 21/147 (14%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLI  261
            F I+  G +IP+WFS+Q +G S+++ LP D    ++G A+  VFE   Q+      +  I
Sbjct  851  FEIVTSGSEIPKWFSNQSLGDSLTVELPLDSCTTWMGIALCAVFE--VQDDLSEFHYFEI  908

Query  262  SQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAV  441
            S + + ++ +   S  +      S H+W+ +LS   F      I V   T  F       
Sbjct  909  SWSPQRFSKNFKVSDVV------SDHLWVTYLSREQFVKKCGQIKVLSTTYYF-------  955

Query  442  RNEPWNKP------KRCGIRLVYKEDI  504
            + + W +       K+C  RLV+++D+
Sbjct  956  KEKMWRQEKSCMSVKKCAFRLVHEQDV  982



>ref|XP_007199048.1| hypothetical protein PRUPE_ppa018338mg [Prunus persica]
 gb|EMJ00247.1| hypothetical protein PRUPE_ppa018338mg [Prunus persica]
Length=1126

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (46%), Gaps = 11/148 (7%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSI--PLPPDWHANFIGFAISVVFEPMAQNSRIGITFK--  255
             I+ PG +IP+WF +Q +G S+ +  PLPP   ++++G A  VVFE      R+G  +   
Sbjct  946   IIWPGSEIPDWFDNQSVGDSIIVEPPLPPQTCSDWVGIAFCVVFEDYEHLKRLGYKYLQI  1005

Query  256   LISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTI  435
             L S+     T  + +   + G +   G + +   S  L     P  G D     F   + 
Sbjct  1006  LCSRKRPNTTNKTKAHQQIVGNLFVLGKITVDLSSQHLLVSYLP--GNDPYQLSFEGHSW  1063

Query  436   AVRNEPWNKP-----KRCGIRLVYKEDI  504
             ++ +           K+CG RLVYK D+
Sbjct  1064  SIGSSYKELKTSLIIKKCGTRLVYKRDL  1091



>ref|XP_011458726.1| PREDICTED: TMV resistance protein N-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1073

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 67/164 (41%), Gaps = 37/164 (23%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPD---WHANFIGFAISVVFEPMAQNSRI----  240
             F IL PG +I EWF  +  G S+++ LPPD     + ++G    VVF  + +   +    
Sbjct  893   FDILSPGSRISEWFDIRSEGGSLTVELPPDRKNCKSKWMGIVFCVVFADLKEPHTLENDE  952

Query  241   --------GITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIG  396
                      +  K I  + K +   + +   M G+     H+W+ F+         P   
Sbjct  953   FVIEGLSPAVGVKHIHDSKKHFMHLTNTKRHMKGD-----HLWVSFM---------PRGQ  998

Query  397   VDDCTKIFGCLTIAVRNEPWNKP--------KRCGIRLVYKEDI  504
             + D T      +     + W  P        KRCG RL+YKED+
Sbjct  999   IRDTTSCSFTFSFDAYCDSWRHPRIPCPNCVKRCGARLLYKEDL  1042



>ref|XP_011458731.1| PREDICTED: TMV resistance protein N-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1049

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 67/164 (41%), Gaps = 37/164 (23%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPD---WHANFIGFAISVVFEPMAQNSRI----  240
             F IL PG +I EWF  +  G S+++ LPPD     + ++G    VVF  + +   +    
Sbjct  869   FDILSPGSRISEWFDIRSEGGSLTVELPPDRKNCKSKWMGIVFCVVFADLKEPHTLENDE  928

Query  241   --------GITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIG  396
                      +  K I  + K +   + +   M G+     H+W+ F+         P   
Sbjct  929   FVIEGLSPAVGVKHIHDSKKHFMHLTNTKRHMKGD-----HLWVSFM---------PRGQ  974

Query  397   VDDCTKIFGCLTIAVRNEPWNKP--------KRCGIRLVYKEDI  504
             + D T      +     + W  P        KRCG RL+YKED+
Sbjct  975   IRDTTSCSFTFSFDAYCDSWRHPRIPCPNCVKRCGARLLYKEDL  1018



>ref|XP_008366223.1| PREDICTED: uncharacterized protein LOC103429872 [Malus domestica]
Length=227

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 71/166 (43%), Gaps = 14/166 (8%)
 Frame = +1

Query  10   EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-F  186
            E+  +    +L   L+G      R  I++PG +IP WF+ Q MG  VS+ L   W  N +
Sbjct  28   ESYNHITFTMLQRYLKGVPYAGDRCEIVMPGKEIPRWFTRQSMGSEVSVDLTRQWRDNKW  87

Query  187  IGFAISVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFR  366
            +G+A+  VFE       +    ++     +EY    +S          S H+W+ ++S  
Sbjct  88   MGYALCAVFEVYGSGWELSGVLEV--NGKEEYPAPLLSLDVQP----VSDHIWLIYVSRG  141

Query  367  LFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
            +        G  +    F  L    ++      K CG RLVY+ D+
Sbjct  142  I------SFGT-EWQNSFSQLIFHFKSSGPCLVKSCGTRLVYEGDV  180



>ref|XP_006441763.1| hypothetical protein CICLE_v10023653mg [Citrus clementina]
 gb|ESR55003.1| hypothetical protein CICLE_v10023653mg [Citrus clementina]
Length=980

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 52/104 (50%), Gaps = 8/104 (8%)
 Frame = +1

Query  76   RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA--NFIGFAISVVFE-----PMAQNS  234
            ++F I++PG +IPEWF  Q  G S+   +P + +     +G+A+  VF      P  Q  
Sbjct  820  QKFGIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHVREHSPGIQTR  879

Query  235  RIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFR  366
            R   T +L  Q     T+ SI       E  ESGH+W+ +LS +
Sbjct  880  RSYPTHQLNCQMKGSSTSYSIEFREKFAE-AESGHLWLLYLSLK  922



>ref|XP_008350156.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1272

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 79/178 (44%), Gaps = 25/178 (14%)
 Frame = +1

Query  22    NTADLLLNSLLQGNSTRNRR-----FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HAN  183
             N   L+L   LQ +   + +     FS  +PG +IP WF  Q +G S+SI + P W  + 
Sbjct  1024  NLTFLMLRKYLQSSMKADSQEPFAGFSSAVPGSEIPTWFMHQSVGTSLSIEVRPHWCSSK  1083

Query  184   FIGFAISVVFEPMAQNSRIG-ITFKLISQNHKEYTTDSISSTTMTGEI--------CESG  336
             F G A+S VF  + +N+ I  +              D+   T   G +         ES 
Sbjct  1084  FKGVAVSAVF-GVCENATIHRVDLNSTDDPMIRCELDTDKGTMSPGIVFPFTKDIRIESD  1142

Query  337   HVWMGFLSFRLFQLLFPDIGVD--DCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
             H+W+ +LS    +  FP    +   C  I      +V   P  + K CG+RLVY++D+
Sbjct  1143  HLWLSYLS----RNGFPVSAFEWWKCRHIQASFKSSV---PGLEVKMCGLRLVYEQDM  1193



>ref|XP_008339192.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1131

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 77/166 (46%), Gaps = 26/166 (16%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVVFEPMAQNSRIGITFKL  258
             FSILIPG +IPEWF++Q MG SV   LP    +   +GFA+  +F      S      K 
Sbjct  944   FSILIPGSEIPEWFNNQSMGDSVIEKLPSHSCNREGMGFALCAIFAAAESISAPTCGRKW  1003

Query  259   ISQNHK--EYTTDSISSTT----------MTGEICESGHVWMGFLSFRLFQLLFPDIGVD  402
             + ++    E+     S++T          M  ++  S H+W+ FLS++    LFP     
Sbjct  1004  LRRHEYLIEFRCSFGSNSTFQDMPQTIGIMVNKVV-SDHLWLVFLSWK---FLFPSDHQP  1059

Query  403   DCTKIFGC---------LTIAVRNEPWNKPKRCGIRLVYKEDIVXE  513
             +  +   C            AV ++   K K+CG+R +Y++D   E
Sbjct  1060  EKNRWESCWNQIQFHFETECAVGSKTCLKVKKCGVRPLYEQDTEEE  1105



>emb|CDX86729.1| BnaA09g21190D [Brassica napus]
Length=924

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 67/158 (42%), Gaps = 22/158 (14%)
 Frame = +1

Query  88   ILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV-----FEPMAQNSRIGIT  249
            I  P  +IP WF  Q++G S+ IPLPP W   NF+G A+SVV     +E  A+   +  +
Sbjct  712  ICYPANEIPSWFCHQRLGHSLEIPLPPHWCDTNFVGLALSVVVSFKDYEDRAKRFSVKCS  771

Query  250  FKLISQNHK----EYT----TDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDD  405
             K  +Q+      ++T     +   S +       S HV+MG+ S   F L         
Sbjct  772  GKFDNQDGSFTGFDFTLAGWNEPCGSLSHEPRKLTSDHVFMGYNS--CFHLKKLHGESSS  829

Query  406  CTKIFGCLTIAVRNEPWNKP------KRCGIRLVYKED  501
            C            ++  NK        +CG+ LVY  D
Sbjct  830  CCYTKASFEFYATDDERNKKLETCEVVKCGMSLVYVPD  867



>ref|XP_006442147.1| hypothetical protein CICLE_v10018573mg [Citrus clementina]
 gb|ESR55387.1| hypothetical protein CICLE_v10018573mg [Citrus clementina]
Length=1168

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +1

Query  76    RRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFK  255
             +  SI +PG +IP+WFS+Q  G S+++ LP     N IGFA+  V E    +S     F 
Sbjct  968   KELSIFVPGSEIPDWFSNQSSGSSITLQLPQHSFGNLIGFALCAVIEFKQLSSNSWSYFN  1027

Query  256   LISQNHKEYTTDSISSTTMTG--EICESGHVWMGF  354
             +  +   E    S     + G  +  +S HV +GF
Sbjct  1028  VGCRYSCEINKISAKDVYLAGIIDFIDSDHVILGF  1062



>emb|CAN75296.1| hypothetical protein VITISV_010423 [Vitis vinifera]
Length=849

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 63/142 (44%), Gaps = 12/142 (8%)
 Frame = +1

Query  94   IPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGITFKLISQN  270
            IPG +IP+W   Q  G  V   LPP+W+ +N +G A+S V    A N  I +++ L    
Sbjct  621  IPGSRIPDWIRYQSSGCXVEADLPPNWYNSNLLGLALSFVTYVFASNVIIPVSYTL----  676

Query  271  HKEYTTDSISSTTMTGEICESG----HVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
               Y+T S  +  ++    + G    HVW+ ++   LF        ++        ++  
Sbjct  677  --RYSTSSYIANRISIRFDKEGVGLDHVWLLYIKLPLFSNWHNGTPINWHEVTHISVSFG  734

Query  439  VRNEPWNKP-KRCGIRLVYKED  501
             +   W  P KR G  LVY  D
Sbjct  735  TQVMGWYPPIKRXGFDLVYSND  756



>ref|XP_009114646.1| PREDICTED: TMV resistance protein N [Brassica rapa]
Length=1219

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 67/158 (42%), Gaps = 22/158 (14%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV-----FEPMAQNSRIGIT  249
             I  P  +IP WF  Q++G S+ IPLPP W   NF+G A+SVV     +E  A+   +  +
Sbjct  1007  ICYPANEIPSWFCHQRLGHSLEIPLPPHWCDTNFVGLALSVVVSFKDYEDRAKRFSVKCS  1066

Query  250   FKLISQNHK----EYT----TDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDD  405
              K  +Q+      ++T     +   S +       S HV+MG+ S   F L         
Sbjct  1067  GKFDNQDGSFTGFDFTLAGWNEPCGSLSHEPRKLTSDHVFMGYNS--CFHLKKLHGESSS  1124

Query  406   CTKIFGCLTIAVRNEPWNKP------KRCGIRLVYKED  501
             C            ++  NK        +CG+ LVY  D
Sbjct  1125  CCYTKASFEFYATDDERNKKLETCEVVKCGMSLVYVPD  1162



>ref|XP_006387238.1| hypothetical protein POPTR_1446s00200g, partial [Populus trichocarpa]
 gb|ERP46152.1| hypothetical protein POPTR_1446s00200g, partial [Populus trichocarpa]
Length=716

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 67/150 (45%), Gaps = 29/150 (19%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN--FIGFAISVV-----FEPMAQNSRI  240
            FS++IPG +IP WFS Q  G SVS+  PP  H N  ++G+A+        F P    S +
Sbjct  527  FSVIIPGSEIPTWFSHQSEGSSVSVQTPPHSHENDEWLGYAVCASLGYPDFPPNVFRSPM  586

Query  241  GITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFL--SFRLFQLLFPDIGVDDCTK  414
               F     N     ++SI       EI  S H+W  +    F+ F         D+C++
Sbjct  587  QCFF-----NGDGNESESIYVRLKPCEIL-SDHLWFLYFPSRFKRFDRHVRFRFEDNCSQ  640

Query  415  IFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
                           K  +CG+RLVY++D+
Sbjct  641  --------------TKVIKCGVRLVYQQDV  656



>gb|AHG28999.1| NBS-LRR protein [Cicer arietinum]
Length=989

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 72/154 (47%), Gaps = 7/154 (5%)
 Frame = +1

Query  55   QGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSI-PLPPDWHANFIGFAISVVFEPMAQN  231
            Q +S   R   I++PG ++P WF +Q++GRS+ I P       + IG    VVF   + +
Sbjct  825  QESSASFRWIEIVVPGSEVPSWFDNQRVGRSIRINPFFIMVDNDVIGIVCCVVFSAASHD  884

Query  232  -SRIGITFKLISQNHKEYTTDSISSTTMTGEI-CESGHVWMGFLSFRLFQLLFPDIG--V  399
             +  G    L+   HK       S T  T  I  +S H+W+ + +   F  +   IG  V
Sbjct  885  PTTFGQKPVLLLCFHKSDLKLHFSITVNTKLIMVQSNHMWLTYFTRESFFDILKGIGNEV  944

Query  400  DDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             DC ++   +  A   +   + K CG R V+K+D
Sbjct  945  GDCIRMEASIVDAEGLDV--EVKSCGYRWVFKQD  976



>emb|CAN68293.1| hypothetical protein VITISV_015601 [Vitis vinifera]
Length=1254

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = +1

Query  13    ANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFI  189
             A  N A +L    L  N      +SI++PG  IPEWF    +G S +I LPP+WH  +F+
Sbjct  1054  AQDNVATIL--EKLHQNFLPEIEYSIVLPGSTIPEWFQHPSIGSSETIELPPNWHNKDFL  1111

Query  190   GFAISVVF  213
             GFA+  VF
Sbjct  1112  GFALCSVF  1119



>gb|KDO40441.1| hypothetical protein CISIN_1g006695mg [Citrus sinensis]
Length=635

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 12/99 (12%)
 Frame = +1

Query  85   SILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLIS  264
            SI++PG +IPEWFS+Q  G S+++  P +   N IGFA+  V +    N RI   F  + 
Sbjct  436  SIILPGSEIPEWFSNQSSGSSITVKPPQNCCRNLIGFALCAVLD---YNERIPSGFSSVF  492

Query  265  QNHK---------EYTTDSISSTTMTGEICESGHVWMGF  354
              ++         E+  ++      T E+ +S HV +GF
Sbjct  493  CEYRFEVNALSGIEHVYENCLILASTHELIDSDHVVLGF  531



>emb|CDY26389.1| BnaA02g23810D [Brassica napus]
Length=984

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 68/153 (44%), Gaps = 11/153 (7%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH----ANFIGFAISVVFEPMAQNSRIGI-  246
            FS   PG ++P WF  +++G  + + L P WH    A     A+    +   Q S + + 
Sbjct  752  FSTCFPGCEVPSWFCHERVGSELEVKLLPHWHDKRLAEIALCAVVSFHDCKDQISCLSVT  811

Query  247  -TFKL-ISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIF  420
             TFK+ +  N     T  + S T  G+  +S HV++G+ S         D   D C+   
Sbjct  812  CTFKVKVEDNSWVSFTCPVGSWTRQGDKVDSDHVFIGYTSCPYTMKCPEDENSDKCSSTE  871

Query  421  GCLTIAV---RNEPWN-KPKRCGIRLVYKEDIV  507
             CL   V    NE    K  +CG+ LVY +D +
Sbjct  872  ACLEFTVTGGTNEKGTLKVLKCGLGLVYAKDKI  904



>gb|KDP25810.1| hypothetical protein JCGZ_22532 [Jatropha curcas]
Length=950

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 81/175 (46%), Gaps = 16/175 (9%)
 Frame = +1

Query  10   EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMG-RSVSIPLPPDW-HAN  183
            + + N A ++L   LQG S     F I+IPG  +P+WFS Q  G  S  + LPP    + 
Sbjct  720  QGDNNLAFMMLRRYLQGLSNPKTGFDIVIPGSNVPKWFSHQSSGDSSARLELPPICSDSK  779

Query  184  FIGFAISVVF------EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVW  345
            ++GFA+  +F      +P   +  +G + K+       +  D   ++    E   S  +W
Sbjct  780  WMGFALCAIFVIRNRADPSILDFDLGCSIKIKGHTWPHHLEDGFLTSM---EQFGSDQLW  836

Query  346  MGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWN-KPKRCGIRLVYKEDIV  507
            + +LS    +  F +I   + T+I   + +           K+ G+RLVY+ D++
Sbjct  837  LFYLS----RHEFLEIDWHETTQISCPVEVKFTAHGMGFSVKKFGVRLVYEHDVL  887



>ref|XP_009597696.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009597704.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009597706.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1447

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 45/90 (50%), Gaps = 11/90 (12%)
 Frame = +1

Query  58    GNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW--HANFIGFA---------IS  204
              +S   R F+I  PG KIP WF    +  SVS+ LP +W  H NF+GFA         I+
Sbjct  1232  SDSLSQRVFTIEHPGKKIPSWFDYHGIDTSVSVNLPENWYVHDNFLGFAVCYSGSLIEIT  1291

Query  205   VVFEPMAQNSRIGITFKLISQNHKEYTTDS  294
                 P+  +    +T KL   NH +Y T+S
Sbjct  1292  AQLIPLCNDEMSWMTQKLALCNHSKYDTES  1321



>ref|XP_009597713.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1356

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 45/90 (50%), Gaps = 11/90 (12%)
 Frame = +1

Query  58    GNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW--HANFIGFA---------IS  204
              +S   R F+I  PG KIP WF    +  SVS+ LP +W  H NF+GFA         I+
Sbjct  1141  SDSLSQRVFTIEHPGKKIPSWFDYHGIDTSVSVNLPENWYVHDNFLGFAVCYSGSLIEIT  1200

Query  205   VVFEPMAQNSRIGITFKLISQNHKEYTTDS  294
                 P+  +    +T KL   NH +Y T+S
Sbjct  1201  AQLIPLCNDEMSWMTQKLALCNHSKYDTES  1230



>gb|KDO36493.1| hypothetical protein CISIN_1g046284mg, partial [Citrus sinensis]
Length=618

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (50%), Gaps = 16/105 (15%)
 Frame = +1

Query  76   RRFSILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVV----------FEPM  222
            RR  I++PG KIP+WFS+Q  G S+ I LPP  +  N IGFA   V          F  +
Sbjct  499  RRSQIVLPGSKIPDWFSNQSSGSSIRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFRNV  558

Query  223  AQNSRIGITFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGF  354
                R  +  K +S+  H   + DS S      ++ +S HV +GF
Sbjct  559  YVGCRSDLEIKTLSETKHVHLSFDSHS----IEDLIDSDHVILGF  599



>gb|AEE43931.1| TIR-NBS-LRR resistance protein muRdr1G [Rosa multiflora]
Length=1141

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 70/149 (47%), Gaps = 16/149 (11%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEP------MAQNSRI  240
              + LIPG +IPEWF++Q  G SV+  LP D  ++ +IGFA+  +  P      + ++  +
Sbjct  951   LNFLIPGSEIPEWFNNQSAGDSVTEKLPWDACNSKWIGFAVCALIVPQDNPSAVPEDPDL  1010

Query  241   GITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIF  420
                  LIS N   Y  + +    +     +S H+W       L  L  P     +C ++ 
Sbjct  1011  DPDTCLISCNWSNYGINGVVGRGLCVRQFDSDHLW-------LLVLPSPFRKPKNCREVN  1063

Query  421   GCLTI--AVRNEPWNKPKRCGIRLVYKED  501
                    AV N    K K+CG+R +Y++D
Sbjct  1064  FVFQTARAVGNNRCMKVKKCGVRALYEQD  1092



>ref|XP_006443097.1| hypothetical protein CICLE_v10023324mg, partial [Citrus clementina]
 gb|ESR56337.1| hypothetical protein CICLE_v10023324mg, partial [Citrus clementina]
Length=220

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +1

Query  85   SILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAIS--VVFE--PMAQNSRIGITF  252
            SI++PG KIPEWF +Q+ G S++I LP   + +F+GFA+   +VFE  P A +++    F
Sbjct  9    SIIVPGNKIPEWFINQRSGSSITIQLPQRCNKDFVGFALCAVIVFEKDPEASSAQY---F  65

Query  253  KLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLS  360
            +++ +   E          +  +  +S H+ +GF S
Sbjct  66   QVVCRYRLEKKLVHPDCWLVMYDTVDSDHLMLGFDS  101



>ref|XP_006442158.1| hypothetical protein CICLE_v10018611mg [Citrus clementina]
 gb|ESR55398.1| hypothetical protein CICLE_v10018611mg [Citrus clementina]
Length=1092

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 51/112 (46%), Gaps = 7/112 (6%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPD-WHANFIGFAISVV------FEPMAQNSRI  240
             F+  +PG +IP+WFS Q  G S++I LPP   + NFIGFA+ VV      F+  A    +
Sbjct  892   FNFCLPGSEIPDWFSYQSSGSSIAIQLPPHCCNKNFIGFALCVVIQLEEGFDADADECFV  951

Query  241   GITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIG  396
                +    +   E             E  ES HV +GF       L  PD+G
Sbjct  952   KCNYNFEIKTPSETKHADDYCFLFADEFIESDHVLLGFSPCWNVGLPDPDVG  1003



>ref|XP_011470001.1| PREDICTED: TMV resistance protein N-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1413

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 66/120 (55%), Gaps = 7/120 (6%)
 Frame = +1

Query  43    NSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFE-  216
             +SL Q    R   F++ +PG +IP+WF+ +  G SV++ LPP W  N F+GFAI  V + 
Sbjct  982   HSLYQNYYQRPLSFNMSLPGDEIPDWFNYRCRGFSVTVQLPPSWFDNKFLGFAICAVSDF  1041

Query  217   PMAQNSRIGITFK---LISQNHKEYT-TDSISSTTMTGE-ICESGHVWMGFLSFRLFQLL  381
               + N    ++F     +  NH  Y+ + ++     T E I ES H+++ ++ +  ++L+
Sbjct  1042  KGSHNDASDLSFLCHCCLKGNHGRYSFSFTLLDWGFTNERILESNHMFLAYVQWSEYRLI  1101



>gb|AEE43926.1| TIR-NBS-LRR resistance protein muRdr1B [Rosa multiflora]
Length=1157

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 70/149 (47%), Gaps = 16/149 (11%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEP------MAQNSRI  240
              + LIPG +IPEWF++Q  G SV+  LP D  ++ +IGFA+  +  P      + ++  +
Sbjct  967   LNFLIPGSEIPEWFNNQSAGDSVTEKLPWDACNSKWIGFAVCALIVPQDNPSAVPEDPDL  1026

Query  241   GITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIF  420
                  LIS N   Y  + +    +     +S H+W       L  L  P     +C ++ 
Sbjct  1027  DPDTCLISCNWSNYGINGVVGRGLCVRQFDSDHLW-------LLVLPSPFRKPKNCREVN  1079

Query  421   GCLTI--AVRNEPWNKPKRCGIRLVYKED  501
                    AV N    K K+CG+R +Y++D
Sbjct  1080  FVFQTARAVGNNRCMKVKKCGVRALYEQD  1108



>ref|XP_009345930.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1287

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 81/164 (49%), Gaps = 27/164 (16%)
 Frame = +1

Query  79    RFSILIPGGKIPEW--FSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNS-----  234
             +FS++ PG +IP+W  FS Q  G SV I LPP++     +GF +S+V   ++  +     
Sbjct  1050  KFSVVCPGKEIPKWFSFSYQSEGSSVHIKLPPEFIRTGLLGFVLSIVVSCVSNCNKWFVI  1109

Query  235   RIGITFKLISQNHKEYTTDSI--SSTTMTGEICESG--HVWMGF---LSFRLFQLLFPDI  393
             R     K + ++H+ +T+       + +  + C+ G  HV M +   +S +  ++  PD+
Sbjct  1110  RARCNVKSLGESHELFTSSFFVQRKSRILNDCCDDGQDHVCMWYESVISGKEAEMCSPDV  1169

Query  394   GVDDCTKIFGCLTIAVRNEPWN-------KPKRCGIRLVYKEDI  504
                   K+    ++  R E +N       K K+CGI  +Y ED+
Sbjct  1170  -----YKLANEASVEFRMEDFNRTPISSVKVKKCGIWPLYAEDV  1208



>ref|XP_009360786.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=496

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 64/140 (46%), Gaps = 17/140 (12%)
 Frame = +1

Query  88   ILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLISQ  267
            ++ PG +IP+WFS+Q +G SV++ LPP    +++G A  +VF+ +   +           
Sbjct  363  VVWPGSEIPKWFSNQSVGNSVNVKLPPPSCTDWLGIAFCLVFQNLVYPT---------VP  413

Query  268  NHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRN  447
             H +Y    +S        CES  V    +S  L    FP         +F       + 
Sbjct  414  YHSDYIGIWLSKR------CESSKVG-SCVSEHLLVFYFPRAYCPQEQILFETYVRGFKE  466

Query  448  EP-WNKPKRCGIRLVYKEDI  504
            +   N  K+CG RLVYK+D+
Sbjct  467  KADLNSVKKCGARLVYKQDL  486



>ref|XP_004308990.1| PREDICTED: TMV resistance protein N-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469999.1| PREDICTED: TMV resistance protein N-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011470000.1| PREDICTED: TMV resistance protein N-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1424

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 66/120 (55%), Gaps = 7/120 (6%)
 Frame = +1

Query  43    NSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFE-  216
             +SL Q    R   F++ +PG +IP+WF+ +  G SV++ LPP W  N F+GFAI  V + 
Sbjct  993   HSLYQNYYQRPLSFNMSLPGDEIPDWFNYRCRGFSVTVQLPPSWFDNKFLGFAICAVSDF  1052

Query  217   PMAQNSRIGITFK---LISQNHKEYT-TDSISSTTMTGE-ICESGHVWMGFLSFRLFQLL  381
               + N    ++F     +  NH  Y+ + ++     T E I ES H+++ ++ +  ++L+
Sbjct  1053  KGSHNDASDLSFLCHCCLKGNHGRYSFSFTLLDWGFTNERILESNHMFLAYVQWSEYRLI  1112



>ref|XP_009368502.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1127

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 80/175 (46%), Gaps = 17/175 (10%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA---  180
             + + N    +L   LQ       RFSI+IPG +IPEWF++Q +G S++  LP   HA   
Sbjct  931   QGSNNIIYSMLKRFLQEIPHFVDRFSIIIPGSEIPEWFTNQSVGHSLTEKLP--LHAGNS  988

Query  181   NFIGFAISVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTG-------EICESGH  339
              ++GFA+  VF      + +     L +  ++      I  +   G       +   S H
Sbjct  989   EWMGFALCAVFVSHENPAVVREVDYLQNYANEICCQWKIPGSQFEGVSFYNRLDQVVSDH  1048

Query  340   VWMGFLSFRLFQLLFPDIGVDDCTKIFGCLT-IAVRNEPWNKPKRCGIRLVYKED  501
             + +  LS + +  L        C   FG  T  AV N+   K K+CG+R VY++D
Sbjct  1049  LLLVLLSRQHYNFL----EEKRCQIKFGFKTRRAVGNKKCLKVKKCGVRSVYEQD  1099



>gb|KHG21792.1| putative WRKY transcription factor 19 -like protein [Gossypium 
arboreum]
Length=584

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 48/88 (55%), Gaps = 5/88 (6%)
 Frame = +1

Query  37   LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVF-  213
            LL   L+  +   ++F I++PG +IPEWFS QK   S+ IPLP D  + +IG A   +F 
Sbjct  392  LLKKHLKAFANSRKKFDIMMPGSEIPEWFSQQKSDSSIQIPLPKD--SEWIGVACCYIFV  449

Query  214  --EPMAQNSRIGITFKLISQNHKEYTTD  291
              + +  +  IG    +  +N +E + +
Sbjct  450  NNDALRDDEYIGWGVSIYCRNSEEASCN  477



>ref|XP_008243638.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Prunus mume]
Length=1160

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 69/151 (46%), Gaps = 15/151 (10%)
 Frame = +1

Query  85    SILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKLIS  264
             S++IPG +IPEWF++Q +G SV   LP   +  ++GFA   +F P  + S        I 
Sbjct  944   SVVIPGSEIPEWFNNQNVGDSVIETLPYS-NRKWVGFAFCALFSPAQEISATATRHFAIE  1002

Query  265   QNHKEYTTDSISSTTMT--GEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIA  438
                 +     ++        ++  S H+W+  LS + F  + P  G  +  +   C    
Sbjct  1003  LRCLDDLNTLVAPVYAKRIDDVVLSDHLWLILLSRQRFYTV-PS-GRSEVRRRENCCDHK  1060

Query  439   VR----------NEPWNKPKRCGIRLVYKED  501
             +R           + W K K+CG+R +Y++D
Sbjct  1061  IRFHFKAISVLGEKTWVKVKKCGVRALYEQD  1091



>ref|XP_008364337.1| PREDICTED: uncharacterized protein LOC103428024 [Malus domestica]
Length=363

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 70/148 (47%), Gaps = 23/148 (16%)
 Frame = +1

Query  88   ILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSR-IGITFKLIS  264
            I+ PG  IP+WF++Q +G S+++ LPP   ++++G A  VVF   AQ+   +GI   L+ 
Sbjct  190  IVCPGKVIPKWFNNQTVGHSLNVELPPQSCSSWMGIAFCVVF---AQDKETLGIPAGLLY  246

Query  265  QNHKEYTTDSISSTTMTGEI--CESGHVWMGFLSFRLF---QLLFPDIGVDDCTKIFGCL  429
               +   +     T    +I    S H+W+ FL   +    Q LF             C 
Sbjct  247  YQCRIRDSPWTRCTHWYPDIRPLVSEHLWVFFLRHVICHQEQFLFET-----------CY  295

Query  430  TIAVRNEP---WNKPKRCGIRLVYKEDI  504
                  EP    N  K+CG RLVYK+D+
Sbjct  296  CEPGMTEPKGGLNMVKKCGARLVYKKDL  323



>gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca]
Length=1335

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 67/158 (42%), Gaps = 13/158 (8%)
 Frame = +1

Query  55    QGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF------  213
             +G  T +  ++ L+PG +IPEWF  Q +G SV+I LP  W+    +G A           
Sbjct  1094  RGIPTPHNEYNALVPGNRIPEWFRHQSVGCSVNIELPQHWYNTKLMGLAFCAALNFKGAM  1153

Query  214   --EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFP  387
                P  + S  G+   L +    E    S+ +     +  ES H    ++S    ++   
Sbjct  1154  DGNPGTEPSSFGLVCYL-NDCFVETGLHSLYTPPEGSKFIESDHTLFEYISLARLEICLG  1212

Query  388   DIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             +        +     +   +    + K+CGIRLVY+ED
Sbjct  1213  NWFRKLSDNVVASFALTGSD---GEVKKCGIRLVYEED  1247



>ref|XP_009353079.1| PREDICTED: uncharacterized protein LOC103944368 [Pyrus x bretschneideri]
Length=206

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 75/172 (44%), Gaps = 19/172 (11%)
 Frame = +1

Query  22   NTADLLLNSLLQGNSTRNRR-----FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HAN  183
            N   L+L   LQ +   + +     F   IPG +IP+WF  Q  G S+SI + P W    
Sbjct  40   NLTFLMLRKYLQSSIKADSQEPFAAFGSCIPGSEIPKWFMHQSAGSSLSIEVRPHWCSGK  99

Query  184  FIGFAISVVF--EPMAQNSRIGITFKLISQNHKEYTTDS---ISSTTM--TGEIC-ESGH  339
            F G A+S VF     A   R+ +      +   E  TD    I    +  T +IC ES H
Sbjct  100  FKGVAVSTVFGVRDNATIRRVDLNSTDEPKIRCELDTDKGIMIPGLVLPFTKDICIESDH  159

Query  340  VWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYK  495
            +W+ ++S   F     +     C  I      ++      + KRCG+RLVYK
Sbjct  160  LWLCYISREWFAKCAGEWW--KCRHIQASFESSISVL---EVKRCGLRLVYK  206



>ref|XP_010665419.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1322

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 67/158 (42%), Gaps = 13/158 (8%)
 Frame = +1

Query  55    QGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVF------  213
             +G  T +  ++ L+PG +IPEWF  Q +G SV+I LP  W+    +G A           
Sbjct  1094  RGIPTPHNEYNALVPGNRIPEWFRHQSVGCSVNIELPQHWYNTKLMGLAFCAALNFKGAM  1153

Query  214   --EPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFP  387
                P  + S  G+   L +    E    S+ +     +  ES H    ++S    ++   
Sbjct  1154  DGNPGTEPSSFGLVCYL-NDCFVETGLHSLYTPPEGSKFIESDHTLFEYISLARLEICLG  1212

Query  388   DIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             +        +     +   +    + K+CGIRLVY+ED
Sbjct  1213  NWFRKLSDNVVASFALTGSD---GEVKKCGIRLVYEED  1247



>ref|XP_004237584.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1154

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 13/177 (7%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-F  186
             +  ++ A  L   L +    ++  FSI +PG ++PEWF  +  G SVS+ LP DW+ + F
Sbjct  974   QQTRDMATSLWLHLFKKCIVKSGHFSIYLPGEQVPEWFGYKLNGTSVSLQLPNDWYNDKF  1033

Query  187   IGFAISVVFEPMAQ---------NSRIGITFKLISQNHKEYTTDSISSTTMTG--EICES  333
             +GFAI VV +                 GI+ +   ++H   +T  + +    G  +   S
Sbjct  1034  MGFAICVVSDQETTWLSVHEGYLQEMPGISIEFTIKSHLRRSTSCLMNIGFVGTNKNVAS  1093

Query  334   GHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDI  504
              H  + +++F  +  ++ +  +D     +     A         K  GIRLVY +D+
Sbjct  1094  DHTCLAYVAFEEYWSMYKN-HLDTPNNWYQIDFSANSLRKHIFLKSWGIRLVYTDDL  1149



>ref|XP_006421210.1| hypothetical protein CICLE_v100041741mg, partial [Citrus clementina]
 gb|ESR34450.1| hypothetical protein CICLE_v100041741mg, partial [Citrus clementina]
Length=1087

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 47/95 (49%), Gaps = 4/95 (4%)
 Frame = +1

Query  79    RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQNSRIGITFK  255
             R  +  PG +IPEWFS Q MG SV++ LPP W + NF+GFA+  +  P       G   +
Sbjct  924   RGCVSYPGSEIPEWFSYQSMGSSVTLELPPGWFNNNFVGFALCAIV-PDHHGITRGFNVR  982

Query  256   LISQNHKEYTTDSISSTTMTG--EICESGHVWMGF  354
              I +   +    S+      G     ES HV +G+
Sbjct  983   CILKTKDDVAVCSLYVWNHLGVNPSIESDHVLLGY  1017



>gb|KDO39975.1| hypothetical protein CISIN_1g0014581mg, partial [Citrus sinensis]
Length=567

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 81/175 (46%), Gaps = 16/175 (9%)
 Frame = +1

Query  13   ANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH--ANF  186
             NK+ A  +L   L+  S   +  S+++PG +IPEWF  Q  G S+++  P + +     
Sbjct  330  GNKSLAFSMLREYLEAVSNTRQHLSVVVPGSEIPEWFMYQNEGSSITVTRPSNLYNKKKL  389

Query  187  IGFAISVVFEPMAQNSRIGITFKLISQN----HKEYTTDSISSTTMTGEICESGHVWMGF  354
            +G+AI  VF  + +NSR    F     +    H  +    I      G+   S H+W+ +
Sbjct  390  VGYAICCVFH-VLKNSRGNNCFGSYPTHQLNCHIGHGIYGIGFRDKFGQ-AGSDHLWLLY  447

Query  355  LSFR-LFQLLFPDIGVDDCTKIFGCLTIAVRNEPW----NKPKRCGIRLVYKEDI  504
            LS +  + +  P   ++   + F    + V  EPW     + K CG+  VY +++
Sbjct  448  LSRQTCYDIRLP---LESNLEPFESNHVNVSFEPWLGQGLEVKMCGLHPVYMDEV  499



>ref|XP_008356222.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=712

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 66/150 (44%), Gaps = 8/150 (5%)
 Frame = +1

Query  79   RFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVVFEPMAQNSRIGITFKL  258
            R  I+ PG  IPEWF++Q +G ++ + LPP   ++++G A  VVF    +N R+    K 
Sbjct  521  RHPIVCPGKGIPEWFNNQTLGHALDVELPPQSCSSWMGIAFCVVFAQPKENLRLLQKQKK  580

Query  259  ISQNHKEYTTDS--ISSTTMTGEICESGHVWM---GFLSFRLFQLLFPDIGVDDCTKIFG  423
              +N     TD   I     T     +   W      +S  L+    P         +F 
Sbjct  581  NFRNPAAPKTDGFWIRCLLRTNRKQSARSSWCFTRPLVSEHLWIFYLPRQQCLQEQFLFE  640

Query  424  CLTIAVRNEP---WNKPKRCGIRLVYKEDI  504
                   N+P    N  K+CG RLVYK+D+
Sbjct  641  TYYGLGMNKPKVGLNVVKKCGARLVYKKDL  670



>ref|NP_192938.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
 emb|CAB40942.1| putative disease resistance protein (TMV N-like) [Arabidopsis 
thaliana]
 emb|CAB78244.1| putative disease resistance protein (TMV N-like) [Arabidopsis 
thaliana]
 gb|AEE83083.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
Length=1219

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 10/67 (15%)
 Frame = +1

Query  40    LNSLLQGNSTRNRRF---------SILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFI  189
             + S L  N++  R +          I  P  +IP WF  Q++GRS+ IPLPP W   NF+
Sbjct  977   IKSQLMANASAKRYYRGFVPEPLVGICYPATEIPSWFCHQRLGRSLEIPLPPHWCDINFV  1036

Query  190   GFAISVV  210
             G A+SVV
Sbjct  1037  GLALSVV  1043



>ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis]
 gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis]
Length=944

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/151 (24%), Positives = 70/151 (46%), Gaps = 16/151 (11%)
 Frame = +1

Query  97   PGGKIPEWFSDQKMGRSVSIPLPPDWHAN---FIGFAISVV--FEPMAQNSRIGITFKL-  258
            PG +IP+W   ++ G S+++ L P+WH N   F+GFA+  V  F      + I +  +  
Sbjct  791  PGTEIPDWLLYKETGSSITVKLHPNWHRNPSRFLGFAVCCVVKFTHFIDINNIYVICECN  850

Query  259  ISQNHKEYTT-----DSISSTTMTGEICESGHVWMGF---LSFRLFQLLFPD--IGVDDC  408
               NH ++         +++     ++ +S HV++G+   +  R  +  +P      ++ 
Sbjct  851  FKTNHDDHHVVNCFLQGLNNGKDESDLVKSQHVYIGYDFGIYLRAVKGTYPGRLYHYEEV  910

Query  409  TKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
            T  F    +      W K  +CG+ L+Y +D
Sbjct  911  TFKFYAKKMVGHTVAWRKVDKCGVHLLYAQD  941



>ref|XP_010087622.1| TMV resistance protein N [Morus notabilis]
 gb|EXB29477.1| TMV resistance protein N [Morus notabilis]
Length=1257

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 66/152 (43%), Gaps = 28/152 (18%)
 Frame = +1

Query  97    PGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVV----FEPMAQNSRIGITFKLI  261
             PG ++PEWF+ +  G S+ I LPP W+  NF+GF +  V    + P   + R+   F+L+
Sbjct  1071  PGSEVPEWFNYRSEGSSIKIKLPPQWNKTNFLGFVVCAVASGDYYPHPVSLRLSSYFRLL  1130

Query  262   SQNHKE-------YTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIF  420
               NH +       +   S+     T     S H+      F  FQ    D   D     F
Sbjct  1131  KTNHSKTELFPWRFNGGSLEDDVPT---LNSPHI------FTWFQCQMYD--QDAAEASF  1179

Query  421   GCLTIAVRNEPW-----NKPKRCGIRLVYKED  501
                     NE +      K  RCGIR++Y++D
Sbjct  1180  EFFFDEWINETYVRSSRTKVIRCGIRMLYRQD  1211



>ref|XP_007199227.1| hypothetical protein PRUPE_ppa022016mg [Prunus persica]
 gb|EMJ00426.1| hypothetical protein PRUPE_ppa022016mg [Prunus persica]
Length=900

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 77/181 (43%), Gaps = 32/181 (18%)
 Frame = +1

Query  22   NTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFA  198
            N A  +L   L+GN    ++F  +IPG ++P++FS Q  G  VS+ LP +W+ +  +G+A
Sbjct  660  NNAFTMLRRFLKGNPCPGKKFETIIPGKELPQYFSYQHEGSVVSMSLPQNWYTDKCMGYA  719

Query  199  ISVV-----FEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTG-----------EICE  330
            +  V     + P   NS   +  +     H        S + + G              E
Sbjct  720  VCAVVGFRRYRPA--NSLGKLRHEAFGTTHGLGCEVKCSKSDIPGLHPFLRCSQELSQIE  777

Query  331  SGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKP---KRCGIRLVYKED  501
            S H+W+ F+S   F   + +           C       +P+      K+ G+RL+Y +D
Sbjct  778  SDHLWISFVSCENFSTEWKNC----------CRHPEFSFQPYGAGLVVKKSGVRLIYLQD  827

Query  502  I  504
            I
Sbjct  828  I  828



>ref|XP_006492471.1| PREDICTED: TMV resistance protein N-like isoform X1 [Citrus sinensis]
 ref|XP_006492472.1| PREDICTED: TMV resistance protein N-like isoform X2 [Citrus sinensis]
 ref|XP_006492473.1| PREDICTED: TMV resistance protein N-like isoform X3 [Citrus sinensis]
Length=1242

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = +1

Query  37    LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPD-WHANFI-GFAISVV  210
             +L   L+  S   +R SI++PG +IPEWF  Q  G S+++  PPD ++ N + GFAI  V
Sbjct  1022  MLKEYLEAVSHSRQRLSIVVPGSEIPEWFMYQNKGSSITLNRPPDSFNKNKVAGFAICCV  1081

Query  211   FEPMAQNSRIGI--TFKLISQNHKEYTTDSISSTTMTGEICESG--HVWMGFL  357
             F     ++RI    ++       +   +  + STT   +  + G  H+W+ +L
Sbjct  1082  FHVNKHSTRIRTLRSYPTKCLTWRLKGSRVVDSTTFREKFGQDGSAHLWLLYL  1134



>emb|CDX94478.1| BnaC09g23580D [Brassica napus]
Length=1204

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 14/103 (14%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV-----FEPMAQNSRIGIT  249
             I  P  +IP WF  Q++G S+ IPLPP W   NF+G A+SVV     +E  A+   +  +
Sbjct  992   ICYPANEIPSWFCHQRLGHSLEIPLPPHWCDTNFVGLALSVVVSFKDYEDRAKRFSVKCS  1051

Query  250   FKLISQNHK----EYT----TDSISSTTMTGEICESGHVWMGF  354
              K  +Q+      ++T     +   S +       S HV+MG+
Sbjct  1052  GKFDNQDGSFTGFDFTLAGWNEPCGSLSHEPRKLTSDHVFMGY  1094



>ref|XP_006492768.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Citrus sinensis]
Length=674

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 66/151 (44%), Gaps = 15/151 (10%)
 Frame = +1

Query  76   RRFSILIPGGKIPEWFSDQKMGRSVSIPLPP-DWHANFIGFAISVVFEPMAQNSRIGITF  252
            R   I++PG +IP+WFS+Q  G S+ I LPP  +  N IGFA   V +     S     F
Sbjct  457  RGSQIVLPGSEIPDWFSNQSSGSSIRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRSRYF  516

Query  253  KLISQNHKEYTTDSISSTTMTG-------EICESGHVWMGFLSFRLFQLLFPDIGVDDCT  411
             +  ++  E  T S +     G       +  +S HV +GF       + FPD G    T
Sbjct  517  YVYCRSDLEIKTLSETKHVHLGYNLHSIQDPHDSDHVILGFKP--CLNVGFPD-GDHHST  573

Query  412  KIFGCLTIAVRN----EPWNKPKRCGIRLVY  492
              F       RN    +   K KRCG+  VY
Sbjct  574  ATFKFFNECHRNIIKVQKGQKIKRCGVCPVY  604



>ref|XP_010646043.1| PREDICTED: disease resistance protein RPS4-like [Vitis vinifera]
Length=639

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/156 (28%), Positives = 69/156 (44%), Gaps = 28/156 (18%)
 Frame = +1

Query  76   RRFSILIPGGK-IPEWFSDQKMGRSVSIPLPPDWHA--NFIGFAISVVFEPMAQNSRIGI  246
            R   ++IPG + IPEW S + MG  ++I LP +W+   NF+GFA+   + P+  +     
Sbjct  466  RETRVVIPGSRGIPEWISHKSMGDEITIDLPKNWYEDNNFLGFALFSHYAPVDDDIFKAA  525

Query  247  TFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDCTKIFGC  426
              ++ S        DS+      G+  + GHV    +S  +F  LFP+  +         
Sbjct  526  NIRIAS--------DSLRLLISDGD--QFGHV-EKIMSRMIFSTLFPNPALRVVYFPQSA  574

Query  427  LTIAVRNEPWN--------------KPKRCGIRLVY  492
            ++   R+  WN              K K CGI L+Y
Sbjct  575  ISSEYRSNRWNKFKTRFSALPNEAFKVKSCGIHLIY  610



>ref|XP_011457954.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=295

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +1

Query  67   TRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHAN-FIGFAISVVFE  216
            +  +RF  ++PG +IPEW++ Q +GR +++ L P W  N F+GF   VVF 
Sbjct  162  SNQKRFEFILPGNEIPEWYNHQSVGRVITLELDPGWFTNKFMGFTTCVVFR  212



>ref|XP_008353544.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Malus domestica]
Length=1111

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 78/181 (43%), Gaps = 46/181 (25%)
 Frame = +1

Query  52    LQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPD-WHANFIGFAISVVFEPMAQ  228
             L GNS      +I+ PG +IP WF  Q  G S++I LPP+ + ++F+GF  S++ E    
Sbjct  938   LDGNSL----VTIVCPGNEIPNWFGAQNEGSSINIRLPPNCFGSDFLGFVFSLLVEFDNY  993

Query  229   NSRIGITFKLISQNHKEYTTDSISSTTMTGEICE-----------------SGHVWMGFL  357
             N   G+ F   S        +S  S   +  +C+                 S HV++ + 
Sbjct  994   NVEQGLEFGCKST----LKGNSGKSHEFSCRLCDRLWGETQGEESNGYNFNSDHVFVWYN  1049

Query  358   SFRLFQLLFPDIGVDDCTKIF--GCLTIAV-------RNEPWN----KPKRCGIRLVYKE  498
             +F L       +G   C+     G    +V        + P N    K KRCG+RL+Y E
Sbjct  1050  TFDL-------VGGAQCSTALHNGVTEASVEFYPKDHHDRPLNSYTVKVKRCGVRLLYAE  1102

Query  499   D  501
             D
Sbjct  1103  D  1103



>emb|CDX86732.1| BnaA09g21220D [Brassica napus]
Length=1186

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 68/158 (43%), Gaps = 22/158 (14%)
 Frame = +1

Query  88    ILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVV-----FEPMAQNSRIGIT  249
             I  P  +IP WF  Q++G S+ IPLPP W   NF+G A+SVV     +E  A+   +  +
Sbjct  974   ICYPANEIPSWFCHQRLGHSLEIPLPPHWCDTNFVGLALSVVVSFKDYEDRAKRFSVKCS  1033

Query  250   FKLISQNHK----EYT----TDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDD  405
              K  +Q+      ++T     +   S +       S HV+MG+ S    + L  +     
Sbjct  1034  GKFDNQDGSFTGFDFTLAGWNEPCGSLSHEPRKLTSDHVFMGYNSCFHVKKLHGESS--S  1091

Query  406   CTKIFGCLTIAVRNEPWNKP------KRCGIRLVYKED  501
             C            ++  NK        +CG+ LVY  D
Sbjct  1092  CCYTKASFEFYATDDERNKKLETCEVVKCGMSLVYVPD  1129



>ref|XP_010419801.1| PREDICTED: TMV resistance protein N-like isoform X2 [Camelina 
sativa]
Length=1579

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 62/156 (40%), Gaps = 19/156 (12%)
 Frame = +1

Query  94    IPGGKIPEWFSDQKMGRSVSIPLPPDWHAN----FIGFAISVVFEPMAQNSRIGITFKLI  261
             +PG  IPEWF  Q  G  V + L    H+N      GFAISV+      N   GI+ K  
Sbjct  1269  LPGDNIPEWFCHQSNGSCVEVMLEHLKHSNESVTLAGFAISVLVAFQDYNDDKGISIKYE  1328

Query  262   SQNHKEYTTDSISSTTMTG-------EIC-ESGHVWMGFLSFRLFQLL-----FPDIGVD  402
              Q H  Y      S  + G        +C E  H+++GF S  LF        F     D
Sbjct  1329  CQFHFNYIRTYEGSGYLRGWDGKKGKPLCIEGDHLFLGFDSSILFDAANGIEQFVKYSED  1388

Query  403   DCTKIFGCLTIAVRNEPWNK--PKRCGIRLVYKEDI  504
                  F C  I     P N    K+C I+ +Y  D+
Sbjct  1389  LVKASFQCYVIDEDGNPINSCTVKKCAIQPLYTCDL  1424



>ref|XP_010110663.1| TMV resistance protein N [Morus notabilis]
 gb|EXC27508.1| TMV resistance protein N [Morus notabilis]
Length=1528

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 80/174 (46%), Gaps = 25/174 (14%)
 Frame = +1

Query  70    RNRRFSILIPGGKIPEWFSDQKMGRS-VSIPLPPDW-HANFIGFAISVV--FEPMAQNSR  237
             R     +  PG +IP+W + Q  G S ++I LP +W  ANF GF   +V  FE +  N R
Sbjct  1037  RVSHIKVCYPGNRIPKWMTCQSEGSSTLTIKLPSNWDRANFSGFVACIVLSFEELYWNQR  1096

Query  238   --IGITFKL-----ISQNHKEYTTDSISSTTMTG-----EICESGHVWMGFLSFRLFQLL  381
               + I F++       Q+H+  +   I      G     E   S HV+M +   + F  +
Sbjct  1097  RDLDIFFEVHLKTKQGQSHRSGSFSMILEGEFFGHEDGKEFLRSDHVFMWYDYHKNFLKM  1156

Query  382   F-PDIGVDDCTKIFGC-----LTIAVRNEPWN---KPKRCGIRLVYKEDIVXET  516
             +  D    + +  FGC     ++ + R    +   K KRCGI ++Y E+++  T
Sbjct  1157  YNEDFDAVEISFDFGCIERTGISYSTRERECSFKYKVKRCGIHMLYAENVLAMT  1210



>ref|XP_010419800.1| PREDICTED: TMV resistance protein N-like isoform X1 [Camelina 
sativa]
Length=1589

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 62/156 (40%), Gaps = 19/156 (12%)
 Frame = +1

Query  94    IPGGKIPEWFSDQKMGRSVSIPLPPDWHAN----FIGFAISVVFEPMAQNSRIGITFKLI  261
             +PG  IPEWF  Q  G  V + L    H+N      GFAISV+      N   GI+ K  
Sbjct  1269  LPGDNIPEWFCHQSNGSCVEVMLEHLKHSNESVTLAGFAISVLVAFQDYNDDKGISIKYE  1328

Query  262   SQNHKEYTTDSISSTTMTG-------EIC-ESGHVWMGFLSFRLFQLL-----FPDIGVD  402
              Q H  Y      S  + G        +C E  H+++GF S  LF        F     D
Sbjct  1329  CQFHFNYIRTYEGSGYLRGWDGKKGKPLCIEGDHLFLGFDSSILFDAANGIEQFVKYSED  1388

Query  403   DCTKIFGCLTIAVRNEPWNK--PKRCGIRLVYKEDI  504
                  F C  I     P N    K+C I+ +Y  D+
Sbjct  1389  LVKASFQCYVIDEDGNPINSCTVKKCAIQPLYTCDL  1424



>gb|KHG05418.1| TMV resistance N [Gossypium arboreum]
Length=601

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/199 (26%), Positives = 83/199 (42%), Gaps = 61/199 (31%)
 Frame = +1

Query  37   LLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAISVV--  210
            LL   L+  +   + F+IL+PG  IPEWFS QK   S+ IPLP D  + +IG A   +  
Sbjct  349  LLRKHLKAFANSRKMFAILMPGSDIPEWFSQQKSDSSIKIPLPKD--SQWIGVASCCIFI  406

Query  211  ------------------FEPMAQNSRIGITFK---------------LISQNH---KEY  282
                              F    Q SR G  F+                I ++H     +
Sbjct  407  NNDSSRDYEIISCCACINFRNSEQASRDGSIFRGRNRRMIGGTGWQVGPIIKDHLFLHYW  466

Query  283  TTDSISSTTMTGEI--CESGHVWM-GFLSFRL--FQLLFPDIGVDDCTKIFGCLTIAVRN  447
            + D +   ++  +   CE+ ++W    L  +    +L F D+ V+D  K+          
Sbjct  467  SRDQLYPISIEYKYGHCETNNLWATDCLDHKCDELELSFSDLVVEDNAKV----------  516

Query  448  EPWNKPKRCGIRLVYKEDI  504
                  K+CG+R+VY++D+
Sbjct  517  ------KKCGVRIVYEKDL  529



>ref|XP_010419802.1| PREDICTED: TMV resistance protein N-like isoform X3 [Camelina 
sativa]
Length=1577

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 62/156 (40%), Gaps = 19/156 (12%)
 Frame = +1

Query  94    IPGGKIPEWFSDQKMGRSVSIPLPPDWHAN----FIGFAISVVFEPMAQNSRIGITFKLI  261
             +PG  IPEWF  Q  G  V + L    H+N      GFAISV+      N   GI+ K  
Sbjct  1269  LPGDNIPEWFCHQSNGSCVEVMLEHLKHSNESVTLAGFAISVLVAFQDYNDDKGISIKYE  1328

Query  262   SQNHKEYTTDSISSTTMTG-------EIC-ESGHVWMGFLSFRLFQLL-----FPDIGVD  402
              Q H  Y      S  + G        +C E  H+++GF S  LF        F     D
Sbjct  1329  CQFHFNYIRTYEGSGYLRGWDGKKGKPLCIEGDHLFLGFDSSILFDAANGIEQFVKYSED  1388

Query  403   DCTKIFGCLTIAVRNEPWNK--PKRCGIRLVYKEDI  504
                  F C  I     P N    K+C I+ +Y  D+
Sbjct  1389  LVKASFQCYVIDEDGNPINSCTVKKCAIQPLYTCDL  1424



>ref|XP_004292702.2| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1173

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +1

Query  40    LNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH--ANFIGFAISVVF  213
             L+SL  G  ++ ++  ++  G  IP+WFS Q  G  + +  PP W   ANF+GFA+SVVF
Sbjct  1004  LSSLCDGADSKIQKLIVISAGNVIPDWFSYQAEGCQIDVKFPPHWFDTANFLGFAVSVVF  1063



>ref|XP_006289237.1| hypothetical protein CARUB_v10002693mg [Capsella rubella]
 gb|EOA22135.1| hypothetical protein CARUB_v10002693mg [Capsella rubella]
Length=1225

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 10/67 (15%)
 Frame = +1

Query  40    LNSLLQGNSTRNRRFSILIP---------GGKIPEWFSDQKMGRSVSIPLPPDW-HANFI  189
             + S L  N++  R +   IP           +IP WF  Q++GRS+ IPLPP W   NF+
Sbjct  980   IKSQLMANASVKRYYRGFIPEPLVGICYAATEIPSWFCHQRLGRSLEIPLPPHWCDTNFV  1039

Query  190   GFAISVV  210
             G A+SVV
Sbjct  1040  GLALSVV  1046



>ref|XP_006353757.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1218

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 48/89 (54%), Gaps = 11/89 (12%)
 Frame = +1

Query  58    GNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA--NFIGFAI---------S  204
              +S+  R F+I  PG KIP WF  Q M +SVS+ LP +W+   NF+GFA+         +
Sbjct  1022  SDSSSLRVFTIEHPGKKIPRWFHHQGMDKSVSVNLPKNWYVSNNFVGFAVCYSGCLTETT  1081

Query  205   VVFEPMAQNSRIGITFKLISQNHKEYTTD  291
                 P+  +    +T ++ S +H ++ T+
Sbjct  1082  AQLIPLCDDGISWMTLEVKSSHHSKWITE  1110



>ref|XP_010665230.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=540

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 65/147 (44%), Gaps = 15/147 (10%)
 Frame = +1

Query  70   RNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGI  246
             N  FSI+ PG  IPEW   Q +G S+ I LP DW+  +F+GFA+  V E + +     +
Sbjct  367  ENIAFSIVFPGSGIPEWIWHQSVGSSIKIELPTDWYNDDFLGFALCSVLEQLPERIICHL  426

Query  247  TFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWMGFL---SFRLFQLLFPDIGVDDCTK  414
               +    + K++  D        G    S HVW+G       RLFQ   P    +D   
Sbjct  427  NSDVFYYGDLKDFGHDFHWKGNHVG----SEHVWLGHQPCSQLRLFQFNDP----NDWNH  478

Query  415  IFGCLTIAVR--NEPWNKPKRCGIRLV  489
            I      A R  +   N  K+CG+  +
Sbjct  479  IEISFEAAHRFNSSASNVVKKCGVSFL  505



>emb|CBI31343.3| unnamed protein product [Vitis vinifera]
Length=1239

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 76/175 (43%), Gaps = 21/175 (12%)
 Frame = +1

Query  1     KLCEANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA  180
             KL E  + T+ L  +S  Q ++     F+++ PG  IP+W S Q  GR V++ LPP+W  
Sbjct  882   KLKEHPRRTSQLEHDSEGQLSAA----FTVVAPGSGIPDWISYQSSGREVTVKLPPNWFT  937

Query  181   N-FIGFAISVVFEPMAQNSRIGI-------TFKLISQNHKEYTTDSISSTTMTGEICESG  336
               F+ FA  VV  P        I       T    + +    + D    +   G + ES 
Sbjct  938   TYFLAFASCVVTSPSVLPYADSINELCTKCTVFYSTSSCVSSSYDVFPRSHAEGRM-ESD  996

Query  337   HVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             HVW+ ++ F +       I   + T I     + +     +  KRCG+ LVY  D
Sbjct  997   HVWLRYVRFPI------SINCHEVTHIKFSFEMILGTS--SAIKRCGVGLVYGND  1043



>emb|CAN72519.1| hypothetical protein VITISV_024695 [Vitis vinifera]
Length=432

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 69/156 (44%), Gaps = 27/156 (17%)
 Frame = +1

Query  82   FSILIPGGKIPEWFSDQKMGRSVSIPLPPDW-HANFIGFAISVVFEPMAQ----------  228
            FS  +PG +IP+WFS Q +G +V++ LPP+W     +  A+  +F               
Sbjct  221  FSTFVPGSRIPQWFSQQSIGSTVTVHLPPNWCDTRLMALAVCAIFVVKGAVHDCPGNIFC  280

Query  229  -----NSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDI  393
                   + G  F  I+  H+       +S+    ++ +S H+W G+       +   + 
Sbjct  281  HLNLTQGKTGHFFAPINPEHR-------NSSDKGRKLIKSDHMWFGYKPISRIGIGHANW  333

Query  394  GVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             ++  ++I     +     P  + K+CG+ L+Y++D
Sbjct  334  -LNKLSQIQASFQVY---GPSYEVKKCGVHLLYEQD  365



>ref|XP_006441734.1| hypothetical protein CICLE_v10018550mg [Citrus clementina]
 gb|ESR54974.1| hypothetical protein CICLE_v10018550mg [Citrus clementina]
Length=1231

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 59/124 (48%), Gaps = 12/124 (10%)
 Frame = +1

Query  13    ANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWH--ANF  186
              NK+ A  +L   L+  S   +  S+++PG +IPEWF  Q  G S+++  P + +     
Sbjct  1076  GNKSLAFSMLREYLEAVSNTRQHLSVVVPGSEIPEWFMYQNEGSSITVTRPSNLYNKKKL  1135

Query  187   IGFAISVVFEPMAQ---NSRIGI--TFKLISQ-NHKEYTTDSISSTTMTGEICESGHVWM  348
             +G+AI  VF  +     N+R G   T +L  +  H  Y  D        G    S H+W+
Sbjct  1136  VGYAICCVFHVLKNSRGNNRFGSYPTHQLNCRIGHGSYRIDFRDKFGQAG----SDHLWL  1191

Query  349   GFLS  360
              +LS
Sbjct  1192  LYLS  1195



>ref|XP_010645915.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1163

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 76/175 (43%), Gaps = 21/175 (12%)
 Frame = +1

Query  1     KLCEANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA  180
             KL E  + T+ L  +S  Q ++     F+++ PG  IP+W S Q  GR V++ LPP+W  
Sbjct  882   KLKEHPRRTSQLEHDSEGQLSAA----FTVVAPGSGIPDWISYQSSGREVTVKLPPNWFT  937

Query  181   N-FIGFAISVVFEPMAQNSRIGI-------TFKLISQNHKEYTTDSISSTTMTGEICESG  336
               F+ FA  VV  P        I       T    + +    + D    +   G + ES 
Sbjct  938   TYFLAFASCVVTSPSVLPYADSINELCTKCTVFYSTSSCVSSSYDVFPRSHAEGRM-ESD  996

Query  337   HVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKED  501
             HVW+ ++ F +       I   + T I     + +     +  KRCG+ LVY  D
Sbjct  997   HVWLRYVRFPI------SINCHEVTHIKFSFEMILGTS--SAIKRCGVGLVYGND  1043



>ref|XP_009760755.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Nicotiana sylvestris]
Length=1182

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 76/163 (47%), Gaps = 30/163 (18%)
 Frame = +1

Query  82    FSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA--NFIGFAI---SVVFEPMAQ------  228
             F+I+ P  KIP WF  Q   RSVS+ LP +W+    F+GFA+    ++ + +AQ      
Sbjct  983   FTIVHPYNKIPNWFLQQGRDRSVSVNLPENWYIPDKFLGFALCYDGILIDTIAQLIPVCD  1042

Query  229   NSRIGITFKLISQNHKEYTTDSISSTTMTGEICESGHVWMGFLSFRLFQLLFPDIGVDDC  408
             +    +T KL   NH E  T+S  ++       +  H +  F  F +  LL P   + D 
Sbjct  1043  DGMSWMTRKLALSNHSECDTESSDNSV------KDIHFFATF--FDIHFLLVPLAVLWDT  1094

Query  409   TKI-------FGCLTIAVRNEPWNKPKRCGIRLVYKEDIVXET  516
             +K        +G + ++   E     K  G+RL+YKE+   E 
Sbjct  1095  SKANGKTPNDYGVIRLSFSGE----MKEYGLRLLYKEEAEAEA  1133



>ref|XP_006494203.1| PREDICTED: putative disease resistance protein At4g11170-like 
[Citrus sinensis]
Length=568

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = +1

Query  85   SILIPGGKIPEWFSDQKMGRSVSIPLPPDWHANFIGFAIS--VVFE--PMAQNSRIGITF  252
            SI++PG KIPEWF +Q+ G S++I LP   + +F GFA+   +VFE  P A +++    F
Sbjct  354  SIIVPGNKIPEWFINQRSGSSITIQLPQRCNKDFAGFALCAVIVFEKDPEASSAQY---F  410

Query  253  KLISQNHKEYTTDSISSTTMTGEICESGHVWMGF  354
            +++ +   E    +     +  +  +S H+ +GF
Sbjct  411  QVVCRYRLEKKLVNHDCWLVMYDTVDSDHLMLGF  444



>ref|XP_010433874.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Camelina sativa]
Length=1220

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 10/67 (15%)
 Frame = +1

Query  40    LNSLLQGNSTRNRRFSILIP---------GGKIPEWFSDQKMGRSVSIPLPPDW-HANFI  189
             + S L  N++  R +   IP           +IP WF  Q++GRS+ IPLPP W   NF+
Sbjct  982   IKSQLMANASAKRYYRGFIPEPLVGICYAATEIPSWFCYQRLGRSLEIPLPPHWCDTNFV  1041

Query  190   GFAISVV  210
             G A+SVV
Sbjct  1042  GLALSVV  1048



>ref|XP_010419804.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Camelina sativa]
Length=1133

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 67/156 (43%), Gaps = 19/156 (12%)
 Frame = +1

Query  94   IPGGKIPEWFSDQKMGRSVSIPLPPDWHAN----FIGFAISVVFEPMAQNSRIGITFKLI  261
            +PG  IPEWF  Q++G  +++ + P  H+N     +GFAISV+      +   GI  K  
Sbjct  835  LPGDDIPEWFCHQRIGSFIAVLVQPPEHSNDKVLLVGFAISVLVAFDDYHDDKGIRIKYE  894

Query  262  SQNHKEYTTDSISSTTMTGEICESG--------HVWMGFLSFRLFQLL-----FPDIGVD  402
               H  +    + +  + G   + G        H+++G+ S  +F        F +   D
Sbjct  895  CHFHSNFLGTRVGAGYLRGWDGQKGKRLSVKGDHLFLGYDSSIMFDAANGIKQFVNYSED  954

Query  403  DCTKIFGCLTIAVRNEPWN--KPKRCGIRLVYKEDI  504
                 F C  +   + P N    K+C I+ +Y  D+
Sbjct  955  LVKATFRCYVVDEDDNPINSCSVKKCAIQPLYVNDM  990



>ref|XP_008339119.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1127

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 84/177 (47%), Gaps = 19/177 (11%)
 Frame = +1

Query  10    EANKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA---  180
             + + N    +L   LQ       RFSI+IPG +IPEWF++Q +G S++  LP   HA   
Sbjct  931   QGSNNIIYSMLKRFLQEIPHFVDRFSIIIPGSEIPEWFTNQSVGHSLTEKLP--LHAGNS  988

Query  181   NFIGFAISVVFEPMAQNSRIGITFKLISQNHKEYTTDSISSTTMTG-------EICESGH  339
              ++GFA+  VF      + +     L +  ++      I  +   G       +   S H
Sbjct  989   EWMGFALCAVFVSHENPAVVREVDYLQTYANEICCQWKIPGSQFEGVSFYNRLDHVVSDH  1048

Query  340   VWMGFLSFRLFQLLFPDIGVDDCTKI-FGCLT-IAVRNEPWNKPKRCGIRLVYKEDI  504
             + +  LS + +  L      +  ++I FG  T  AV N+   K K+CG+R VY++D+
Sbjct  1049  LLLVLLSRQHYNFL-----EEKHSQIKFGFKTRRAVGNKKCLKVKKCGVRSVYEQDV  1100



>emb|CAN68384.1| hypothetical protein VITISV_018351 [Vitis vinifera]
Length=940

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 12/144 (8%)
 Frame = +1

Query  88   ILIPGGKIPEWFSDQKMGRSVSIPLPPDWH-ANFIGFAISVVFEPMAQNSRIGITFKLIS  264
            +++ G +IP+W   Q  G  V   LPP+W+ +N +G A+S V    A N  I +++ L  
Sbjct  710  VMVYGSRIPDWIRYQSSGCEVEADLPPNWYNSNLLGLALSFVTYVFASNVIIPVSYTL--  767

Query  265  QNHKEYTTDSISSTTMTGEICESG----HVWMGFLSFRLFQLLFPDIGVDDCTKIFGCLT  432
                 Y+T S  +  ++    + G    HVW+ ++   LF        ++        ++
Sbjct  768  ----RYSTSSYIANRISIRFDKEGVGLDHVWLLYIKLPLFSNWHNGTPINWHEVTHISVS  823

Query  433  IAVRNEPWNKP-KRCGIRLVYKED  501
               +   W  P KR G  LVY  D
Sbjct  824  FGTQVMGWYPPIKRSGFDLVYSND  847



>ref|XP_009794567.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nicotiana 
sylvestris]
Length=1093

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 77/178 (43%), Gaps = 20/178 (11%)
 Frame = +1

Query  16    NKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NFIG  192
             + +  D L +++L+G        SI IPG +IP WF+ +  G +V++ L  +W+  N  G
Sbjct  920   DTDMVDALWSNMLKGLYVLRNDLSICIPGSQIPMWFTYKNFGENVTLTLANNWYTDNLWG  979

Query  193   FAISVVFEPMA--------QNSRIGITFKLISQNHKEYTTDSISSTTMTG---EICESGH  339
             FA  +VFE M             +G    L  + +     D  S   + G    I  S H
Sbjct  980   FAFCIVFERMEWCGLYDGYLQPSLGFPVNLKFKTYDGKEGDIRSIIGIKGGDMSIRNSEH  1039

Query  340   VWMGFLSFRLFQLLFPD--IGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDIV  507
               + ++  R F   + +     +D  +I    T+   ++ W      G RLVY +DI+
Sbjct  1040  TLLAYVPSRRFLQPYNNEVYSPNDWIEIVAYSTVQFDSKAW------GTRLVYLDDII  1091



>ref|XP_009794566.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=1107

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 77/178 (43%), Gaps = 20/178 (11%)
 Frame = +1

Query  16    NKNTADLLLNSLLQGNSTRNRRFSILIPGGKIPEWFSDQKMGRSVSIPLPPDWHA-NFIG  192
             + +  D L +++L+G        SI IPG +IP WF+ +  G +V++ L  +W+  N  G
Sbjct  934   DTDMVDALWSNMLKGLYVLRNDLSICIPGSQIPMWFTYKNFGENVTLTLANNWYTDNLWG  993

Query  193   FAISVVFEPMA--------QNSRIGITFKLISQNHKEYTTDSISSTTMTG---EICESGH  339
             FA  +VFE M             +G    L  + +     D  S   + G    I  S H
Sbjct  994   FAFCIVFERMEWCGLYDGYLQPSLGFPVNLKFKTYDGKEGDIRSIIGIKGGDMSIRNSEH  1053

Query  340   VWMGFLSFRLFQLLFPD--IGVDDCTKIFGCLTIAVRNEPWNKPKRCGIRLVYKEDIV  507
               + ++  R F   + +     +D  +I    T+   ++ W      G RLVY +DI+
Sbjct  1054  TLLAYVPSRRFLQPYNNEVYSPNDWIEIVAYSTVQFDSKAW------GTRLVYLDDII  1105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325