BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I20

Length=583
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011088790.1|  PREDICTED: vacuolar protein sorting-associat...    209   2e-64   Sesamum indicum [beniseed]
ref|XP_007132323.1|  hypothetical protein PHAVU_011G085100g             208   1e-63   Phaseolus vulgaris [French bean]
ref|NP_001239962.1|  uncharacterized protein LOC100797244               207   1e-63   Glycine max [soybeans]
ref|XP_006349016.1|  PREDICTED: vacuolar protein sorting-associat...    207   2e-63   Solanum tuberosum [potatoes]
ref|XP_009777504.1|  PREDICTED: vacuolar protein sorting-associat...    204   2e-63   Nicotiana sylvestris
ref|XP_003527138.1|  PREDICTED: vacuolar protein sorting-associat...    206   4e-63   Glycine max [soybeans]
gb|AFK35786.1|  unknown                                                 206   5e-63   Medicago truncatula
gb|KDP43979.1|  hypothetical protein JCGZ_05446                         206   6e-63   Jatropha curcas
ref|XP_009619509.1|  PREDICTED: vacuolar protein sorting-associat...    205   1e-62   Nicotiana tomentosiformis
gb|EYU18785.1|  hypothetical protein MIMGU_mgv1a013298mg                204   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_011089953.1|  PREDICTED: vacuolar protein sorting-associat...    204   4e-62   Sesamum indicum [beniseed]
emb|CDP07042.1|  unnamed protein product                                203   5e-62   Coffea canephora [robusta coffee]
ref|XP_004506062.1|  PREDICTED: vacuolar protein sorting-associat...    202   1e-61   Cicer arietinum [garbanzo]
ref|NP_001241270.1|  uncharacterized protein LOC100780989               200   1e-60   Glycine max [soybeans]
ref|XP_009617666.1|  PREDICTED: vacuolar protein sorting-associat...    199   2e-60   Nicotiana tomentosiformis
ref|XP_006582059.1|  PREDICTED: vacuolar protein sorting-associat...    199   2e-60   Glycine max [soybeans]
ref|XP_006488018.1|  PREDICTED: vacuolar protein sorting-associat...    199   3e-60   Citrus sinensis [apfelsine]
ref|XP_009356928.1|  PREDICTED: vacuolar protein sorting-associat...    199   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_010535627.1|  PREDICTED: vacuolar protein sorting-associat...    199   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_004163684.1|  PREDICTED: vacuolar protein sorting-associat...    198   6e-60   
ref|XP_004147294.1|  PREDICTED: vacuolar protein sorting-associat...    198   6e-60   Cucumis sativus [cucumbers]
ref|XP_007016863.1|  SNF7 family protein isoform 3                      197   8e-60   
ref|XP_006424467.1|  hypothetical protein CICLE_v10029212mg             198   9e-60   Citrus clementina [clementine]
ref|XP_009335972.1|  PREDICTED: vacuolar protein sorting-associat...    198   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_009345744.1|  PREDICTED: vacuolar protein sorting-associat...    197   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_009795413.1|  PREDICTED: vacuolar protein sorting-associat...    197   1e-59   Nicotiana sylvestris
ref|XP_008385520.1|  PREDICTED: vacuolar protein sorting-associat...    197   1e-59   Malus domestica [apple tree]
ref|XP_007016862.1|  SNF7 family protein isoform 2                      197   2e-59   Theobroma cacao [chocolate]
ref|XP_004287557.1|  PREDICTED: vacuolar protein sorting-associat...    197   2e-59   Fragaria vesca subsp. vesca
ref|XP_006347202.1|  PREDICTED: vacuolar protein sorting-associat...    197   2e-59   Solanum tuberosum [potatoes]
ref|XP_004241293.1|  PREDICTED: vacuolar protein sorting-associat...    197   2e-59   Solanum lycopersicum
ref|XP_010045312.1|  PREDICTED: vacuolar protein sorting-associat...    197   2e-59   Eucalyptus grandis [rose gum]
ref|XP_007205829.1|  hypothetical protein PRUPE_ppa010967mg             197   3e-59   Prunus persica
ref|XP_008226446.1|  PREDICTED: vacuolar protein sorting-associat...    196   3e-59   Prunus mume [ume]
gb|KJB20375.1|  hypothetical protein B456_003G145500                    196   4e-59   Gossypium raimondii
ref|XP_006288588.1|  hypothetical protein CARUB_v10001883mg             196   8e-59   Capsella rubella
ref|XP_002275903.1|  PREDICTED: vacuolar protein sorting-associat...    195   1e-58   Vitis vinifera
ref|XP_008463000.1|  PREDICTED: vacuolar protein sorting-associat...    194   2e-58   Cucumis melo [Oriental melon]
ref|XP_010111610.1|  Vacuolar protein sorting-associated protein ...    195   2e-58   
ref|XP_002872026.1|  SNF7 family protein                                194   3e-58   
ref|NP_197686.1|  vacuolar protein sorting-associated protein 24-1      194   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27621.1|  hypothetical protein AALP_AA8G407300                    194   3e-58   Arabis alpina [alpine rockcress]
ref|XP_006384952.1|  hypothetical protein POPTR_0004s22530g             194   3e-58   Populus trichocarpa [western balsam poplar]
emb|CBI17151.3|  unnamed protein product                                195   3e-58   Vitis vinifera
gb|KJB74776.1|  hypothetical protein B456_012G006500                    192   3e-58   Gossypium raimondii
ref|XP_008359644.1|  PREDICTED: vacuolar protein sorting-associat...    194   4e-58   
ref|XP_006400804.1|  hypothetical protein EUTSA_v10014580mg             193   5e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010421095.1|  PREDICTED: vacuolar protein sorting-associat...    193   5e-58   Camelina sativa [gold-of-pleasure]
gb|KJB74775.1|  hypothetical protein B456_012G006500                    193   6e-58   Gossypium raimondii
gb|KHG26620.1|  Vacuolar sorting-associated protein 24 -like protein    192   1e-57   Gossypium arboreum [tree cotton]
gb|KJB73430.1|  hypothetical protein B456_011G235800                    192   1e-57   Gossypium raimondii
gb|KHG14933.1|  Vacuolar sorting-associated protein 24 -like protein    192   2e-57   Gossypium arboreum [tree cotton]
emb|CDY50330.1|  BnaA10g13630D                                          191   3e-57   Brassica napus [oilseed rape]
ref|XP_002311070.1|  SNF7 family protein                                191   6e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011031663.1|  PREDICTED: vacuolar protein sorting-associat...    191   6e-57   Populus euphratica
ref|XP_007016861.1|  Vacuolar protein sorting-associated protein ...    191   6e-57   
ref|XP_010520386.1|  PREDICTED: vacuolar protein sorting-associat...    191   7e-57   Tarenaya hassleriana [spider flower]
ref|XP_009131901.1|  PREDICTED: vacuolar protein sorting-associat...    190   8e-57   Brassica rapa
ref|XP_007010008.1|  Vacuolar protein sorting-associated protein 24     190   1e-56   Theobroma cacao [chocolate]
emb|CDX71024.1|  BnaC03g11080D                                          190   1e-56   
ref|XP_009120619.1|  PREDICTED: vacuolar protein sorting-associat...    189   1e-56   Brassica rapa
ref|XP_009120618.1|  PREDICTED: vacuolar protein sorting-associat...    189   2e-56   Brassica rapa
ref|XP_011028257.1|  PREDICTED: vacuolar protein sorting-associat...    189   2e-56   Populus euphratica
ref|XP_011012691.1|  PREDICTED: vacuolar protein sorting-associat...    189   2e-56   Populus euphratica
ref|XP_009397570.1|  PREDICTED: vacuolar protein sorting-associat...    188   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918614.1|  PREDICTED: vacuolar protein sorting-associat...    189   4e-56   Elaeis guineensis
ref|XP_010267215.1|  PREDICTED: vacuolar protein sorting-associat...    188   4e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009397569.1|  PREDICTED: vacuolar protein sorting-associat...    188   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAN60307.1|  unknown                                                 188   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436508.1|  hypothetical protein CICLE_v10032656mg             188   6e-56   Citrus clementina [clementine]
gb|KDO48252.1|  hypothetical protein CISIN_1g027052mg                   188   7e-56   Citrus sinensis [apfelsine]
ref|XP_010243255.1|  PREDICTED: vacuolar protein sorting-associat...    186   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008805716.1|  PREDICTED: vacuolar protein sorting-associat...    187   2e-54   Phoenix dactylifera
ref|XP_010685399.1|  PREDICTED: vacuolar protein sorting-associat...    184   3e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007016864.1|  Vacuolar protein sorting-associated protein ...    183   3e-54   
ref|XP_009389257.1|  PREDICTED: vacuolar protein sorting-associat...    184   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004957682.1|  PREDICTED: vacuolar protein sorting-associat...    183   7e-54   Setaria italica
ref|XP_003563129.1|  PREDICTED: vacuolar protein sorting-associat...    183   7e-54   Brachypodium distachyon [annual false brome]
emb|CDY26972.1|  BnaC09g36110D                                          182   8e-54   Brassica napus [oilseed rape]
ref|XP_006649245.1|  PREDICTED: vacuolar protein sorting-associat...    182   9e-54   Oryza brachyantha
ref|XP_008650985.1|  PREDICTED: hypothetical protein isoform X1         182   9e-54   Zea mays [maize]
ref|XP_002462856.1|  hypothetical protein SORBIDRAFT_02g033180          182   1e-53   Sorghum bicolor [broomcorn]
gb|ACG37446.1|  charged multivesicular body protein 3                   182   1e-53   Zea mays [maize]
ref|XP_006851293.1|  hypothetical protein AMTR_s00050p00108830          181   5e-53   Amborella trichopoda
ref|XP_007218313.1|  hypothetical protein PRUPE_ppa010938mg             180   8e-53   
ref|XP_008233267.1|  PREDICTED: vacuolar protein sorting-associat...    181   1e-52   Prunus mume [ume]
dbj|BAC45115.1|  putative endosomal Vps protein complex subunit         179   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048700.2|  Os03g0108400                                       175   4e-52   
gb|ACG25955.1|  charged multivesicular body protein 3                   177   7e-52   Zea mays [maize]
ref|XP_008363454.1|  PREDICTED: vacuolar protein sorting-associat...    176   3e-51   Malus domestica [apple tree]
ref|XP_002468673.1|  hypothetical protein SORBIDRAFT_01g050050          176   3e-51   Sorghum bicolor [broomcorn]
gb|EEC74362.1|  hypothetical protein OsI_09672                          176   3e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_009368927.1|  PREDICTED: vacuolar protein sorting-associat...    176   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_009368928.1|  PREDICTED: vacuolar protein sorting-associat...    176   4e-51   Pyrus x bretschneideri [bai li]
gb|ABF93564.1|  SNF7 family protein, expressed                          176   4e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EYU36149.1|  hypothetical protein MIMGU_mgv1a013379mg                175   6e-51   Erythranthe guttata [common monkey flower]
ref|XP_009120617.1|  PREDICTED: vacuolar protein sorting-associat...    176   8e-51   Brassica rapa
ref|XP_008667584.1|  PREDICTED: uncharacterized protein LOC100273...    174   1e-50   
ref|XP_003557475.1|  PREDICTED: vacuolar protein sorting-associat...    174   2e-50   Brachypodium distachyon [annual false brome]
dbj|BAJ98079.1|  predicted protein                                      173   3e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS67269.1|  hypothetical protein M569_07508                         172   5e-50   Genlisea aurea
emb|CDY09181.1|  BnaA02g06070D                                          172   1e-49   Brassica napus [oilseed rape]
tpg|DAA62692.1|  TPA: hypothetical protein ZEAMMB73_817857              170   5e-49   
gb|KHG17098.1|  Vacuolar sorting-associated protein 24 -like protein    167   3e-48   Gossypium arboreum [tree cotton]
ref|XP_001766951.1|  predicted protein                                  168   4e-48   
gb|EEC82025.1|  hypothetical protein OsI_25990                          168   5e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_004307352.1|  PREDICTED: vacuolar protein sorting-associat...    167   6e-48   Fragaria vesca subsp. vesca
gb|AAN62785.1|  Unknown protein                                         167   8e-47   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA42866.1|  TPA: hypothetical protein ZEAMMB73_720763              165   8e-47   
ref|XP_002983949.1|  hypothetical protein SELMODRAFT_180699             163   4e-46   
gb|ACN26066.1|  unknown                                                 161   9e-46   Zea mays [maize]
ref|XP_002960722.1|  hypothetical protein SELMODRAFT_75154              161   2e-45   
gb|KDO36911.1|  hypothetical protein CISIN_1g028108mg                   156   1e-43   Citrus sinensis [apfelsine]
ref|XP_006658555.1|  PREDICTED: vacuolar protein sorting-associat...    153   9e-43   
ref|XP_002875706.1|  predicted protein                                  154   1e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_006291692.1|  hypothetical protein CARUB_v10017855mg             154   3e-42   
ref|XP_001768641.1|  predicted protein                                  152   6e-42   
tpg|DAA62691.1|  TPA: hypothetical protein ZEAMMB73_817857              142   1e-39   
gb|AGT17311.1|  multivesicular body protein                             143   6e-39   Saccharum hybrid cultivar R570
gb|AGT15932.1|  charged multivesicular body protein                     143   7e-39   Saccharum hybrid cultivar R570
ref|XP_010425933.1|  PREDICTED: vacuolar protein sorting-associat...    142   3e-38   Camelina sativa [gold-of-pleasure]
ref|NP_001059635.2|  Os07g0479400                                       136   3e-37   
ref|XP_010425934.1|  PREDICTED: vacuolar protein sorting-associat...    139   4e-37   
ref|XP_010503153.1|  PREDICTED: vacuolar protein sorting-associat...    138   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010425932.1|  PREDICTED: vacuolar protein sorting-associat...    137   4e-36   
ref|XP_010425931.1|  PREDICTED: vacuolar protein sorting-associat...    137   4e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010514836.1|  PREDICTED: vacuolar protein sorting-associat...    137   4e-36   Camelina sativa [gold-of-pleasure]
emb|CDY09182.1|  BnaA02g06080D                                          136   1e-35   Brassica napus [oilseed rape]
gb|EAZ39797.1|  hypothetical protein OsJ_24237                          137   4e-35   Oryza sativa Japonica Group [Japonica rice]
emb|CDY29920.1|  BnaC05g29160D                                          129   2e-34   Brassica napus [oilseed rape]
ref|NP_190086.1|  vacuolar protein sorting protein 24.2                 130   6e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ACU20533.1|  unknown                                                 123   2e-31   Glycine max [soybeans]
ref|XP_002505454.1|  predicted protein                                  124   2e-31   Micromonas commoda
gb|AFK41585.1|  unknown                                                 122   6e-31   Lotus japonicus
ref|XP_011031664.1|  PREDICTED: vacuolar protein sorting-associat...    121   9e-31   Populus euphratica
gb|KJB73432.1|  hypothetical protein B456_011G235800                    121   1e-30   Gossypium raimondii
ref|XP_006485586.1|  PREDICTED: vacuolar protein sorting-associat...    119   7e-30   
ref|XP_006384951.1|  hypothetical protein POPTR_0004s22530g             116   6e-29   
gb|ACG25833.1|  hypothetical protein                                    115   1e-28   Zea mays [maize]
ref|NP_001136753.1|  hypothetical protein                               115   1e-28   Zea mays [maize]
emb|CDX81905.1|  BnaC08g36960D                                          114   2e-28   
ref|XP_003059726.1|  predicted protein                                  115   1e-27   Micromonas pusilla CCMP1545
ref|XP_001768580.1|  predicted protein                                  112   2e-27   
ref|XP_002955113.1|  hypothetical protein VOLCADRAFT_102242             113   3e-27   Volvox carteri f. nagariensis
ref|XP_001701067.1|  subunit of the ESCRT-III complex                   113   3e-27   Chlamydomonas reinhardtii
gb|EMT12604.1|  Vacuolar protein sorting-associated 24-1-like pro...    114   5e-27   
gb|KJB20376.1|  hypothetical protein B456_003G145500                    109   3e-26   Gossypium raimondii
ref|XP_010111834.1|  Vacuolar protein sorting-associated protein ...    106   4e-25   
ref|XP_004959675.1|  PREDICTED: vacuolar protein sorting-associat...    107   7e-25   Setaria italica
gb|EMS49932.1|  Vacuolar protein sorting-associated protein 24-li...    105   2e-23   Triticum urartu
ref|XP_005643152.1|  Snf7-domain-containing protein                     102   6e-23   Coccomyxa subellipsoidea C-169
ref|XP_005846960.1|  hypothetical protein CHLNCDRAFT_56197              102   8e-23   Chlorella variabilis
ref|XP_011396971.1|  Vacuolar protein sorting-associated protein ...  99.4    3e-22   Auxenochlorella protothecoides
gb|KFM60205.1|  Charged multivesicular body protein 3                 98.2    1e-21   Stegodyphus mimosarum
ref|XP_002523708.1|  neuroendocrine differentiation factor, putative  97.8    2e-21   
ref|XP_005759503.1|  vacuolar protein sorting protein 24              97.1    3e-21   Emiliania huxleyi CCMP1516
gb|KFO55293.1|  Charged multivesicular body protein 3                 95.5    1e-20   Corvus brachyrhynchos
ref|XP_009099641.1|  PREDICTED: charged multivesicular body prote...  95.9    1e-20   
ref|XP_008626905.1|  PREDICTED: charged multivesicular body prote...  95.5    1e-20   
gb|KFR04528.1|  Charged multivesicular body protein 3                 94.7    1e-20   Nipponia nippon
ref|XP_009970015.1|  PREDICTED: charged multivesicular body prote...  95.1    1e-20   Tyto alba [Schleiereule]
ref|XP_005517975.1|  PREDICTED: charged multivesicular body prote...  95.9    1e-20   Pseudopodoces humilis [Tibetan ground-jay]
gb|ACQ58274.1|  Charged multivesicular body protein 3                 95.5    2e-20   Anoplopoma fimbria
gb|ETE62372.1|  E3 ubiquitin-protein ligase                           99.8    2e-20   Ophiophagus hannah
ref|XP_005490896.1|  PREDICTED: charged multivesicular body prote...  95.9    2e-20   
gb|KFP07073.1|  Charged multivesicular body protein 3                 95.1    2e-20   Calypte anna
gb|KFV91446.1|  Charged multivesicular body protein 3                 94.7    2e-20   Eurypyga helias
gb|KFV86979.1|  Charged multivesicular body protein 3                 94.7    2e-20   Struthio camelus australis
gb|KFR10835.1|  Charged multivesicular body protein 3                 94.7    2e-20   Opisthocomus hoazin [hoatzin]
gb|KGL91258.1|  Charged multivesicular body protein 3                 94.7    2e-20   Charadrius vociferus
gb|KFP58659.1|  Charged multivesicular body protein 3                 94.7    2e-20   Cathartes aura
gb|KFP11175.1|  Charged multivesicular body protein 3                 94.7    2e-20   Egretta garzetta
ref|XP_010008173.1|  PREDICTED: charged multivesicular body prote...  94.7    2e-20   Nestor notabilis
ref|XP_010576116.1|  PREDICTED: charged multivesicular body prote...  95.1    2e-20   Haliaeetus leucocephalus
ref|XP_009922345.1|  PREDICTED: charged multivesicular body prote...  94.7    2e-20   Haliaeetus albicilla
ref|XP_005045633.1|  PREDICTED: charged multivesicular body prote...  95.1    2e-20   Ficedula albicollis
gb|KFM01751.1|  Charged multivesicular body protein 3                 94.7    2e-20   Aptenodytes forsteri
gb|KFP75044.1|  Charged multivesicular body protein 3                 94.7    3e-20   Apaloderma vittatum
ref|XP_006028703.1|  PREDICTED: charged multivesicular body prote...  94.7    3e-20   Alligator sinensis
gb|KFQ04463.1|  Charged multivesicular body protein 3                 94.4    3e-20   Leptosomus discolor
ref|XP_005029940.1|  PREDICTED: charged multivesicular body prote...  95.9    3e-20   
gb|KFO94295.1|  Charged multivesicular body protein 3                 94.4    3e-20   Buceros rhinoceros silvestris
ref|XP_010141750.1|  PREDICTED: charged multivesicular body prote...  94.4    3e-20   Buceros rhinoceros silvestris
ref|XP_008111320.1|  PREDICTED: charged multivesicular body prote...  94.7    4e-20   Anolis carolinensis [Carolina anole]
ref|XP_001568986.1|  SNF7-like protein                                94.4    4e-20   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_009287683.1|  PREDICTED: charged multivesicular body prote...  94.7    4e-20   
ref|XP_005229928.1|  PREDICTED: charged multivesicular body prote...  94.4    4e-20   
ref|XP_002130271.1|  PREDICTED: charged multivesicular body prote...  94.4    4e-20   Ciona intestinalis [sea vase]
ref|XP_008500084.1|  PREDICTED: charged multivesicular body prote...  95.1    4e-20   Calypte anna
ref|XP_009975459.1|  PREDICTED: charged multivesicular body prote...  94.0    4e-20   Tauraco erythrolophus
ref|XP_002603819.1|  hypothetical protein BRAFLDRAFT_124687           94.4    4e-20   Branchiostoma floridae
ref|XP_005292502.1|  PREDICTED: charged multivesicular body prote...  94.4    4e-20   Chrysemys picta bellii
ref|NP_001232425.1|  putative vacuolar protein sorting 24 isoform...  94.7    5e-20   Taeniopygia guttata
gb|KFW86821.1|  Charged multivesicular body protein 3                 94.0    5e-20   Manacus vitellinus
gb|EMC83057.1|  Charged multivesicular body protein 3                 94.0    5e-20   
ref|XP_010400387.1|  PREDICTED: charged multivesicular body prote...  95.1    5e-20   
ref|XP_009933052.1|  PREDICTED: charged multivesicular body prote...  94.7    5e-20   Opisthocomus hoazin [hoatzin]
ref|XP_009865174.1|  PREDICTED: charged multivesicular body prote...  94.7    5e-20   Apaloderma vittatum
gb|KFU98562.1|  Charged multivesicular body protein 3                 94.0    5e-20   Pterocles gutturalis
ref|XP_009647170.1|  PREDICTED: charged multivesicular body prote...  94.7    5e-20   Egretta garzetta
ref|XP_005510025.1|  PREDICTED: charged multivesicular body prote...  94.4    5e-20   
ref|XP_009880818.1|  PREDICTED: charged multivesicular body prote...  94.7    5e-20   Charadrius vociferus
ref|XP_009330153.1|  PREDICTED: LOW QUALITY PROTEIN: charged mult...  94.7    5e-20   Pygoscelis adeliae
ref|XP_009684385.1|  PREDICTED: charged multivesicular body prote...  94.7    5e-20   Struthio camelus australis
ref|XP_009694260.1|  PREDICTED: charged multivesicular body prote...  94.4    5e-20   Cariama cristata
ref|XP_005446437.1|  PREDICTED: charged multivesicular body prote...  94.7    5e-20   Falco cherrug
ref|XP_009684386.1|  PREDICTED: charged multivesicular body prote...  93.6    6e-20   Struthio camelus australis
ref|XP_010145409.1|  PREDICTED: charged multivesicular body prote...  93.6    6e-20   Eurypyga helias
ref|XP_008933459.1|  PREDICTED: charged multivesicular body prote...  93.6    6e-20   Merops nubicus
gb|KFU91577.1|  Charged multivesicular body protein 3                 93.6    6e-20   Chaetura pelagica
gb|KFQ31413.1|  Charged multivesicular body protein 3                 93.6    6e-20   Mesitornis unicolor
gb|KFO72527.1|  Charged multivesicular body protein 3                 93.6    6e-20   Cuculus canorus
ref|XP_009478017.1|  PREDICTED: charged multivesicular body prote...  93.2    7e-20   Pelecanus crispus
ref|XP_007175385.1|  PREDICTED: charged multivesicular body prote...  94.0    7e-20   Balaenoptera acutorostrata scammoni
ref|XP_011444021.1|  PREDICTED: charged multivesicular body prote...  93.6    7e-20   Crassostrea gigas
ref|XP_006271557.1|  PREDICTED: charged multivesicular body prote...  93.6    8e-20   
ref|XP_009959146.1|  PREDICTED: charged multivesicular body prote...  93.2    8e-20   Leptosomus discolor
ref|XP_009073206.1|  PREDICTED: charged multivesicular body prote...  93.6    8e-20   Acanthisitta chloris
ref|XP_010576124.1|  PREDICTED: charged multivesicular body prote...  94.7    8e-20   Haliaeetus leucocephalus
ref|XP_005045632.1|  PREDICTED: charged multivesicular body prote...  94.7    9e-20   
ref|XP_007063786.1|  PREDICTED: charged multivesicular body prote...  93.6    9e-20   
ref|XP_009469965.1|  PREDICTED: LOW QUALITY PROTEIN: charged mult...  94.7    9e-20   Nipponia nippon
ref|XP_008929217.1|  PREDICTED: charged multivesicular body prote...  94.0    9e-20   
emb|CEP15313.1|  hypothetical protein                                 93.6    1e-19   Parasitella parasitica
ref|XP_003222421.1|  PREDICTED: charged multivesicular body prote...  94.4    1e-19   Anolis carolinensis [Carolina anole]
ref|XP_007427680.1|  PREDICTED: charged multivesicular body prote...  94.4    1e-19   
ref|XP_420858.2|  PREDICTED: charged multivesicular body protein ...  93.2    1e-19   Gallus gallus [bantam]
ref|XP_009998524.1|  PREDICTED: charged multivesicular body prote...  93.6    1e-19   Chaetura pelagica
ref|XP_010703289.1|  SNF7-like protein                                93.2    1e-19   Leishmania panamensis
gb|EMP32190.1|  Charged multivesicular body protein 3                 93.6    1e-19   Chelonia mydas [green seaturtle]
ref|XP_010074540.1|  PREDICTED: charged multivesicular body prote...  92.4    1e-19   Pterocles gutturalis
ref|XP_008929219.1|  PREDICTED: charged multivesicular body prote...  92.4    1e-19   
ref|XP_009554287.1|  PREDICTED: charged multivesicular body prote...  93.6    1e-19   Cuculus canorus
ref|XP_006111681.1|  PREDICTED: charged multivesicular body prote...  92.8    1e-19   Pelodiscus sinensis [Chinese softshell turtle]
dbj|GAN01797.1|  vacuolar sorting protein VPS24                       93.2    1e-19   Mucor ambiguus
ref|XP_010708906.1|  PREDICTED: charged multivesicular body prote...  93.2    1e-19   
ref|XP_001954294.1|  GF16818                                          93.2    1e-19   Drosophila ananassae
ref|XP_005292501.1|  PREDICTED: charged multivesicular body prote...  94.0    2e-19   Chrysemys picta bellii
ref|XP_010178300.1|  PREDICTED: charged multivesicular body prote...  93.2    2e-19   Mesitornis unicolor
ref|XP_006111682.1|  PREDICTED: charged multivesicular body prote...  92.8    2e-19   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001626340.1|  predicted protein                                91.7    2e-19   Nematostella vectensis
ref|XP_005801162.1|  PREDICTED: charged multivesicular body prote...  92.8    2e-19   Xiphophorus maculatus
ref|XP_006271559.1|  PREDICTED: charged multivesicular body prote...  93.6    2e-19   Alligator mississippiensis
ref|XP_010211114.1|  PREDICTED: charged multivesicular body prote...  92.8    2e-19   Tinamus guttatus
ref|XP_007175387.1|  PREDICTED: charged multivesicular body prote...  93.6    2e-19   
gb|EHA99121.1|  Charged multivesicular body protein 3                 93.2    2e-19   Heterocephalus glaber [naked mole rat]
gb|EPB82581.1|  hypothetical protein HMPREF1544_10665                 92.4    2e-19   Mucor circinelloides f. circinelloides 1006PhL
gb|EPY27103.1|  charged multivesicular body protein 3                 92.4    2e-19   Angomonas deanei
gb|EPY37420.1|  charged multivesicular body protein 3                 92.0    2e-19   Angomonas deanei
ref|XP_004878597.1|  PREDICTED: charged multivesicular body prote...  93.6    2e-19   
gb|EPY37452.1|  charged multivesicular body protein 3                 92.0    2e-19   Angomonas deanei
gb|EHJ63967.1|  putative neuroendocrine differentiation factor        92.0    2e-19   
ref|XP_010116240.1|  PREDICTED: charged multivesicular body prote...  92.0    3e-19   Chlamydotis macqueenii
ref|XP_004844628.1|  PREDICTED: charged multivesicular body prote...  93.2    3e-19   
ref|NP_001187430.1|  charged multivesicular body protein 3            92.0    3e-19   Ictalurus punctatus
pdb|3FRV|A  Chain A, Structure Of Human Chmp3 (Residues 1-150)        90.5    3e-19   Homo sapiens [man]
gb|KFV62037.1|  Charged multivesicular body protein 3                 91.3    3e-19   Picoides pubescens
ref|XP_001086438.2|  PREDICTED: charged multivesicular body prote...  91.7    3e-19   
ref|XP_003385166.1|  PREDICTED: charged multivesicular body prote...  91.7    3e-19   Amphimedon queenslandica
gb|EHH55726.1|  hypothetical protein EGM_04987                        90.5    3e-19   Macaca fascicularis [crab eating macaque]
ref|XP_010367047.1|  PREDICTED: charged multivesicular body prote...  92.0    4e-19   Rhinopithecus roxellana
ref|XP_006107105.1|  PREDICTED: charged multivesicular body prote...  92.0    4e-19   Myotis lucifugus
ref|XP_007533963.1|  PREDICTED: charged multivesicular body prote...  92.0    4e-19   Erinaceus europaeus [common hedgehog]
gb|EHH22297.1|  hypothetical protein EGK_05535                        90.5    4e-19   Macaca mulatta [rhesus macaque]
ref|XP_008560253.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Microplitis demolitor
ref|XP_005338526.1|  PREDICTED: charged multivesicular body prote...  92.0    4e-19   
ref|XP_004663837.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Jaculus jaculus
ref|XP_010623952.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Fukomys damarensis [Damara mole rat]
ref|XP_008576706.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004660569.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Jaculus jaculus
ref|XP_010623953.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Fukomys damarensis [Damara mole rat]
ref|XP_007576234.1|  PREDICTED: charged multivesicular body prote...  91.3    4e-19   Poecilia formosa
ref|XP_004742419.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Mustela putorius furo [black ferret]
ref|XP_004415451.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Odobenus rosmarus divergens
ref|XP_004708008.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_008154143.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Eptesicus fuscus
ref|XP_006764043.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Myotis davidii
ref|XP_002757572.1|  PREDICTED: charged multivesicular body prote...  91.7    4e-19   Callithrix jacchus [common marmoset]
ref|XP_006991065.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   Peromyscus maniculatus bairdii
ref|NP_001125653.1|  charged multivesicular body protein 3            91.7    5e-19   
ref|XP_003799239.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   
ref|XP_005575424.1|  PREDICTED: charged multivesicular body prote...  91.3    5e-19   
ref|XP_008834956.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   
ref|XP_003984282.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   
ref|XP_003503963.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   
ref|XP_005900426.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   
ref|XP_001138427.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   
ref|XP_006203969.1|  PREDICTED: charged multivesicular body prote...  91.3    5e-19   
ref|XP_003942574.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   
ref|XP_008252373.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   
gb|AAX46717.1|  vacuolar protein sorting 24 isoform 1                 91.7    5e-19   
ref|NP_001030223.2|  charged multivesicular body protein 3            91.7    5e-19   
ref|XP_003696118.1|  PREDICTED: charged multivesicular body prote...  91.3    5e-19   
ref|XP_007576233.1|  PREDICTED: charged multivesicular body prote...  91.3    5e-19   
ref|XP_004005941.1|  PREDICTED: charged multivesicular body prote...  91.3    5e-19   
gb|KFO32638.1|  Charged multivesicular body protein 3                 92.4    5e-19   
ref|XP_005364818.1|  PREDICTED: charged multivesicular body prote...  91.7    5e-19   
gb|EGW03669.1|  RING finger protein 103                               95.1    5e-19   
ref|XP_005575425.1|  PREDICTED: charged multivesicular body prote...  91.3    5e-19   
sp|Q4R574.3|CHMP3_MACFA  RecName: Full=Charged multivesicular bod...  91.3    5e-19   
ref|XP_005415406.1|  PREDICTED: LOW QUALITY PROTEIN: charged mult...  92.0    5e-19   
ref|NP_057163.1|  charged multivesicular body protein 3 isoform 1     91.3    6e-19   
gb|AAF26737.1|AF219226_1  neuroendocrine differentiation factor       91.3    6e-19   
pdb|3FRT|A  Chain A, The Structure Of Human Chmp3 (Residues 8 - 222)  91.3    6e-19   
ref|NP_001084828.1|  charged multivesicular body protein 3            91.3    6e-19   
ref|XP_006008668.1|  PREDICTED: charged multivesicular body prote...  91.3    7e-19   
gb|ERE66366.1|  charged multivesicular body protein 3                 91.3    7e-19   
ref|XP_005003364.1|  PREDICTED: charged multivesicular body prote...  91.3    7e-19   
emb|CEG80669.1|  Putative Vacuolar protein-sorting-associated pro...  90.9    7e-19   
ref|XP_007952279.1|  PREDICTED: charged multivesicular body prote...  91.3    7e-19   
ref|XP_007082375.1|  PREDICTED: charged multivesicular body prote...  91.7    7e-19   
ref|XP_007252577.1|  PREDICTED: charged multivesicular body prote...  90.9    7e-19   
gb|ETN58540.1|  neuroendocrine differentiation factor                 90.9    7e-19   
ref|XP_003908985.2|  PREDICTED: charged multivesicular body prote...  91.7    7e-19   
ref|XP_007968172.1|  PREDICTED: charged multivesicular body prote...  91.7    7e-19   
ref|XP_003354782.2|  PREDICTED: LOW QUALITY PROTEIN: charged mult...  91.7    7e-19   
emb|CEG71719.1|  hypothetical protein RMATCC62417_07405               90.9    8e-19   
ref|XP_004465751.1|  PREDICTED: charged multivesicular body prote...  90.9    8e-19   
gb|EFN87651.1|  Charged multivesicular body protein 3                 90.9    8e-19   
ref|XP_009052342.1|  hypothetical protein LOTGIDRAFT_214378           90.9    8e-19   
ref|XP_004642847.1|  PREDICTED: charged multivesicular body prote...  90.9    8e-19   
ref|XP_011155078.1|  PREDICTED: charged multivesicular body prote...  90.9    8e-19   
emb|CEI97251.1|  hypothetical protein RMCBS344292_11387               90.9    8e-19   
ref|XP_001359617.1|  GA22030                                          90.9    9e-19   
ref|NP_758834.1|  charged multivesicular body protein 3               90.9    9e-19   
dbj|BAB26273.1|  unnamed protein product                              90.9    9e-19   
ref|XP_005364817.1|  PREDICTED: charged multivesicular body prote...  91.3    9e-19   
ref|NP_080059.2|  charged multivesicular body protein 3               90.9    9e-19   
dbj|BAB31306.1|  unnamed protein product                              90.9    9e-19   
ref|XP_004530046.1|  PREDICTED: charged multivesicular body prote...  90.9    9e-19   
ref|XP_006900426.1|  PREDICTED: charged multivesicular body prote...  90.9    9e-19   
ref|XP_011181882.1|  PREDICTED: charged multivesicular body prote...  90.9    9e-19   
sp|Q5BKM3.4|CHMP3_XENTR  RecName: Full=Charged multivesicular bod...  90.5    9e-19   
ref|XP_006183698.1|  PREDICTED: charged multivesicular body prote...  91.7    9e-19   
ref|NP_001185883.1|  RNF103-CHMP3 protein                             90.9    1e-18   
ref|NP_001016229.2|  charged multivesicular body protein 3            90.5    1e-18   
ref|XP_004612096.1|  PREDICTED: charged multivesicular body prote...  91.7    1e-18   
ref|XP_011208651.1|  PREDICTED: charged multivesicular body prote...  90.5    1e-18   
ref|XP_007896190.1|  PREDICTED: charged multivesicular body prote...  90.5    1e-18   
ref|XP_004660568.1|  PREDICTED: charged multivesicular body prote...  91.7    1e-18   
ref|XP_010957256.1|  PREDICTED: charged multivesicular body prote...  91.7    1e-18   
ref|XP_010623955.1|  PREDICTED: charged multivesicular body prote...  91.3    1e-18   
ref|XP_002922382.1|  PREDICTED: charged multivesicular body prote...  90.5    1e-18   
ref|XP_006168428.1|  PREDICTED: charged multivesicular body prote...  91.3    1e-18   
ref|XP_004708007.1|  PREDICTED: charged multivesicular body prote...  91.3    1e-18   
ref|XP_002400207.1|  vacuolar sorting protein VPS24, putative         89.7    1e-18   
ref|XP_006930337.1|  PREDICTED: charged multivesicular body prote...  91.3    1e-18   
ref|XP_010328665.1|  PREDICTED: charged multivesicular body prote...  91.3    1e-18   
ref|XP_004388287.1|  PREDICTED: charged multivesicular body prote...  90.5    1e-18   
ref|XP_010623954.1|  PREDICTED: charged multivesicular body prote...  89.7    1e-18   
ref|XP_004271636.1|  PREDICTED: charged multivesicular body prote...  90.5    1e-18   
ref|XP_004742417.1|  PREDICTED: charged multivesicular body prote...  91.3    1e-18   
ref|XP_007968173.1|  PREDICTED: charged multivesicular body prote...  91.3    1e-18   
ref|XP_008834958.1|  PREDICTED: charged multivesicular body prote...  89.7    1e-18   
ref|XP_004691667.1|  PREDICTED: charged multivesicular body prote...  90.1    1e-18   
gb|ADD83025.1|  vacuolar protein sorting 24                           89.7    1e-18   
ref|XP_007466795.1|  PREDICTED: charged multivesicular body prote...  90.1    1e-18   
ref|XP_006679500.1|  hypothetical protein BATDEDRAFT_25657            90.1    1e-18   
ref|XP_004340812.1|  SNF7 family protein                              89.7    1e-18   
ref|XP_009182867.1|  PREDICTED: charged multivesicular body prote...  89.7    2e-18   
ref|XP_004465750.1|  PREDICTED: charged multivesicular body prote...  90.5    2e-18   
ref|XP_003468997.1|  PREDICTED: charged multivesicular body prote...  90.9    2e-18   
ref|XP_010598265.1|  PREDICTED: LOW QUALITY PROTEIN: charged mult...  90.1    2e-18   
dbj|GAM21077.1|  hypothetical protein SAMD00019534_042520             89.7    2e-18   
ref|XP_003758684.1|  PREDICTED: charged multivesicular body prote...  89.7    2e-18   
ref|XP_007477782.1|  PREDICTED: charged multivesicular body prote...  89.7    2e-18   
ref|XP_003865475.1|  SNF7-like protein                                89.7    2e-18   
ref|XP_004642846.1|  PREDICTED: charged multivesicular body prote...  90.5    2e-18   
ref|XP_011162881.1|  PREDICTED: charged multivesicular body prote...  88.6    2e-18   
ref|XP_006236693.1|  PREDICTED: charged multivesicular body prote...  89.4    2e-18   
ref|XP_006506543.1|  PREDICTED: charged multivesicular body prote...  89.4    2e-18   
ref|XP_001658413.1|  AAEL007509-PA                                    89.7    2e-18   
ref|XP_006917778.1|  PREDICTED: charged multivesicular body prote...  89.7    2e-18   
ref|XP_010747242.1|  PREDICTED: charged multivesicular body prote...  89.4    3e-18   
ref|XP_003874697.1|  SNF7-like protein                                89.4    3e-18   
ref|XP_002019296.1|  GL12331                                          89.4    3e-18   
ref|XP_002114552.1|  hypothetical protein TRIADDRAFT_50591            89.4    3e-18   
ref|XP_001469672.1|  SNF7-like protein                                89.4    3e-18   
ref|XP_008698318.1|  PREDICTED: charged multivesicular body prote...  90.5    3e-18   
gb|ACO15577.1|  Charged multivesicular body protein 3                 89.4    3e-18   
gb|ACO15440.1|  Charged multivesicular body protein 3                 89.4    3e-18   
ref|XP_010765311.1|  PREDICTED: charged multivesicular body prote...  89.4    3e-18   
ref|XP_007896191.1|  PREDICTED: charged multivesicular body prote...  90.1    3e-18   
ref|XP_004691666.1|  PREDICTED: charged multivesicular body prote...  90.1    3e-18   
ref|XP_309652.2|  AGAP003507-PA                                       89.0    4e-18   
gb|ACO09776.1|  Charged multivesicular body protein 3                 89.0    4e-18   
ref|XP_005599913.1|  PREDICTED: charged multivesicular body prote...  88.6    4e-18   
gb|EFA79153.1|  SNF7 family protein                                   88.6    4e-18   
gb|AGG11609.1|  hypothetical protein                                  89.0    4e-18   
ref|XP_011368098.1|  PREDICTED: charged multivesicular body prote...  89.4    4e-18   
gb|ABI83750.1|  vacuolar sorting protein VPS24                        89.0    4e-18   
ref|NP_998485.1|  charged multivesicular body protein 3               89.0    5e-18   
ref|XP_006917780.1|  PREDICTED: charged multivesicular body prote...  89.7    5e-18   
ref|XP_001845728.1|  charged multivesicular body protein 3            88.6    5e-18   
ref|XP_011058091.1|  PREDICTED: charged multivesicular body prote...  88.6    6e-18   
ref|XP_011260881.1|  PREDICTED: charged multivesicular body prote...  88.6    6e-18   
ref|XP_006875924.1|  PREDICTED: charged multivesicular body prote...  88.6    6e-18   
ref|XP_006830716.1|  PREDICTED: charged multivesicular body prote...  88.2    7e-18   
gb|EPY30658.1|  charged multivesicular body protein 3                 88.2    7e-18   
gb|EPY28647.1|  charged multivesicular body protein 3                 88.2    7e-18   
ref|XP_002162304.1|  PREDICTED: charged multivesicular body prote...  88.2    8e-18   
gb|KFH69931.1|  hypothetical protein MVEG_04735                       88.2    8e-18   
ref|XP_010996154.1|  PREDICTED: zinc finger protein 853               90.9    8e-18   
ref|XP_006884210.1|  PREDICTED: charged multivesicular body prote...  86.3    8e-18   
emb|CDQ56186.1|  unnamed protein product                              87.8    9e-18   
ref|XP_001978802.1|  GG11685                                          88.2    9e-18   
ref|NP_001133836.1|  Charged multivesicular body protein 3            87.8    1e-17   
ref|XP_004933051.1|  PREDICTED: charged multivesicular body prote...  87.4    1e-17   
ref|XP_004367229.1|  SNF7 family protein                              87.4    1e-17   
ref|XP_011309256.1|  PREDICTED: charged multivesicular body prote...  87.4    1e-17   
ref|XP_004082340.1|  PREDICTED: charged multivesicular body prote...  87.4    1e-17   
ref|XP_002070585.1|  GK12139                                          87.8    1e-17   
ref|XP_006786226.1|  PREDICTED: charged multivesicular body prote...  87.4    1e-17   
ref|XP_001686924.1|  SNF7-like protein                                87.4    1e-17   
ref|XP_005724055.1|  PREDICTED: charged multivesicular body prote...  87.4    1e-17   
ref|XP_004540646.1|  PREDICTED: LOW QUALITY PROTEIN: charged mult...  87.4    1e-17   
ref|XP_003453092.1|  PREDICTED: charged multivesicular body prote...  87.4    1e-17   
gb|ELV10795.1|  Charged multivesicular body protein 3                 90.5    1e-17   
gb|AAT92113.1|  vacuolar sorting protein VPS24                        87.4    1e-17   
ref|XP_003109025.1|  hypothetical protein CRE_11883                   86.7    1e-17   
ref|XP_006062481.1|  PREDICTED: charged multivesicular body prote...  87.4    1e-17   
gb|ACI34368.1|  Charged multivesicular body protein 3                 86.7    2e-17   
gb|KFB36136.1|  hypothetical protein ZHAS_00003210                    87.4    2e-17   
ref|XP_003704764.1|  PREDICTED: charged multivesicular body prote...  87.4    2e-17   
ref|XP_004444144.1|  PREDICTED: LOW QUALITY PROTEIN: ring finger ...  90.5    2e-17   
gb|EXX57487.1|  Vps24p                                                87.0    2e-17   
emb|CAG10563.1|  unnamed protein product                              87.0    2e-17   
ref|XP_010877155.1|  PREDICTED: charged multivesicular body prote...  86.7    2e-17   
ref|XP_011331547.1|  PREDICTED: charged multivesicular body prote...  86.7    2e-17   
ref|XP_011270074.1|  hypothetical protein CAOG_08492                  90.9    3e-17   
ref|XP_006629697.1|  PREDICTED: charged multivesicular body prote...  86.7    3e-17   
ref|XP_003962516.1|  PREDICTED: charged multivesicular body prote...  86.7    3e-17   
ref|NP_001158539.1|  Charged multivesicular body protein 3            86.7    3e-17   
ref|NP_649451.1|  vacuolar protein sorting 24                         86.7    3e-17   
tpg|DAA34422.1|  TPA: vacuolar sorting protein VPS24                  86.3    3e-17   
ref|XP_005185525.1|  PREDICTED: charged multivesicular body prote...  86.7    3e-17   
ref|XP_009492441.1|  hypothetical protein H696_00319                  87.0    3e-17   
ref|XP_005724056.1|  PREDICTED: charged multivesicular body prote...  85.9    3e-17   
dbj|BAM18377.1|  charged multivesicular body protein 3                86.3    3e-17   
ref|XP_004590788.1|  PREDICTED: charged multivesicular body prote...  86.3    4e-17   
gb|EPY23815.1|  charged multivesicular body protein 3                 85.5    4e-17   
ref|XP_002095926.1|  GE25363                                          86.3    4e-17   
ref|XP_002038274.1|  GM10712                                          86.3    4e-17   
gb|ACI67688.1|  Charged multivesicular body protein 3                 86.3    4e-17   
ref|XP_010290792.1|  PREDICTED: charged multivesicular body prote...  85.5    4e-17   
ref|XP_001746337.1|  hypothetical protein                             85.9    4e-17   
ref|XP_002000056.1|  GI22744                                          85.9    5e-17   
ref|XP_002054553.1|  GJ22745                                          85.9    5e-17   
gb|ACO51201.1|  vacuolar protein sorting 24-like protein              85.5    5e-17   
gb|ACI49018.1|  hypothetical protein Cbre_JD04.003                    83.6    6e-17   
ref|NP_494919.1|  Protein T27F7.1                                     85.1    7e-17   
ref|XP_004590787.1|  PREDICTED: charged multivesicular body prote...  86.3    8e-17   
ref|XP_638395.1|  SNF7 family protein                                 85.1    8e-17   
ref|XP_008281903.1|  PREDICTED: charged multivesicular body prote...  85.1    8e-17   
pir||T16946  hypothetical protein T27F7.1 - Caenorhabditis elegans    85.1    9e-17
ref|XP_001607770.1|  PREDICTED: charged multivesicular body prote...  85.1    1e-16   
gb|KHJ78904.1|  SNF7 family protein                                   83.6    1e-16   
ref|NP_001156086.1|  charged multivesicular body protein 3-like       84.7    1e-16   
ref|XP_001994762.1|  GH17415                                          85.1    1e-16   
ref|XP_005093210.1|  PREDICTED: charged multivesicular body prote...  85.1    1e-16   
ref|XP_002630629.1|  Hypothetical protein CBG02295                    84.3    1e-16   
emb|CDH49941.1|  vacuolar sorting protein vps24                       84.7    1e-16   
emb|CDS04866.1|  hypothetical protein LRAMOSA07396                    84.3    2e-16   
ref|XP_007418081.1|  hypothetical protein MELLADRAFT_113366           84.3    2e-16   
ref|XP_006896139.1|  PREDICTED: charged multivesicular body prote...  84.3    2e-16   
ref|XP_009311648.1|  putative SNF7-like protein                       84.3    2e-16   
gb|EYC08512.1|  hypothetical protein Y032_0065g3590                   84.3    2e-16   
gb|EYC08513.1|  hypothetical protein Y032_0065g3590                   84.0    2e-16   
gb|EYC08511.1|  hypothetical protein Y032_0065g3590                   84.0    2e-16   
gb|EYC08514.1|  hypothetical protein Y032_0065g3590                   84.0    2e-16   
gb|ACO11304.1|  Charged multivesicular body protein 3                 84.0    2e-16   
gb|EGT54955.1|  hypothetical protein CAEBREN_01508                    84.0    3e-16   
emb|CCC53595.1|  putative SNF7-like protein                           83.6    4e-16   
gb|KHJ93796.1|  SNF7 family protein                                   83.2    4e-16   
gb|EOA94096.1|  Charged multivesicular body protein 3                 82.8    4e-16   
gb|KDR22737.1|  Charged multivesicular body protein 3                 83.2    4e-16   
gb|EKF29117.1|  SNF7-like protein, putative                           83.6    4e-16   
gb|EGT40902.1|  hypothetical protein CAEBREN_20433                    83.2    4e-16   
emb|CCW65667.1|  unnamed protein product                              83.2    4e-16   
ref|XP_011504303.1|  PREDICTED: charged multivesicular body prote...  82.8    6e-16   
gb|KFQ68310.1|  Charged multivesicular body protein 3                 82.0    6e-16   
gb|ENN79434.1|  hypothetical protein YQE_04078                        82.8    7e-16   
gb|KFV57295.1|  Charged multivesicular body protein 3                 81.6    7e-16   
gb|KFW94319.1|  Charged multivesicular body protein 3                 81.6    9e-16   
gb|KFO13538.1|  Charged multivesicular body protein 3                 81.6    1e-15   
ref|XP_007509681.1|  charged multivesicular body protein 3            82.0    1e-15   
emb|CDJ80549.1|  Snf7 domain containing protein                       82.0    1e-15   
gb|KFP24680.1|  Charged multivesicular body protein 3                 80.5    1e-15   
gb|KIH67397.1|  SNF7 family protein                                   83.6    2e-15   
ref|XP_968988.1|  PREDICTED: charged multivesicular body protein 3    81.3    2e-15   
gb|EFZ16182.1|  hypothetical protein SINV_13181                       79.7    2e-15   
ref|XP_781609.3|  PREDICTED: charged multivesicular body protein ...  80.9    2e-15   
gb|KFZ64412.1|  Charged multivesicular body protein 3                 80.5    3e-15   
gb|KGL76013.1|  Charged multivesicular body protein 3                 80.9    3e-15   
ref|XP_008306073.1|  PREDICTED: charged multivesicular body prote...  80.9    3e-15   
pdb|2GD5|A  Chain A, Structural Basis For Budding By The Escrtiii...  80.1    3e-15   
ref|XP_002430051.1|  Charged multivesicular body protein, putative    80.1    5e-15   
gb|KDD72601.1|  hypothetical protein H632_c3138p1                     79.0    5e-15   
gb|KDQ12727.1|  hypothetical protein BOTBODRAFT_67194                 79.7    7e-15   
ref|XP_008051744.1|  PREDICTED: charged multivesicular body prote...  79.3    8e-15   



>ref|XP_011088790.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Sesamum indicum]
Length=222

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG
Sbjct  1    MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAVARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_007132323.1| hypothetical protein PHAVU_011G085100g [Phaseolus vulgaris]
 gb|ESW04317.1| hypothetical protein PHAVU_011G085100g [Phaseolus vulgaris]
Length=228

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAI+EAAKRNDMG
Sbjct  1    MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSRKTVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|NP_001239962.1| uncharacterized protein LOC100797244 [Glycine max]
 gb|ACU21093.1| unknown [Glycine max]
 gb|KHN37775.1| Vacuolar protein sorting-associated protein 24 like 1 [Glycine 
soja]
Length=227

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAI+EAAKRNDMG
Sbjct  1    MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSRKTVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006349016.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Solanum tuberosum]
 ref|XP_010313300.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Solanum lycopersicum]
Length=220

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQ+LRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG
Sbjct  1    MEKVMNILKPKPNPQQILRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRS+KTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSKKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009777504.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Nicotiana sylvestris]
Length=139

 Score =   204 bits (519),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG
Sbjct  1    MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRS++TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSKRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_003527138.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 isoform X1 [Glycine max]
 gb|KHN19850.1| Vacuolar protein sorting-associated protein 24 like 1 [Glycine 
soja]
Length=227

 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAI+EAAKRNDMG
Sbjct  1    MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKELVRSRQTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|AFK35786.1| unknown [Medicago truncatula]
 gb|KEH29963.1| vacuolar sorting-associated-like protein [Medicago truncatula]
Length=227

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQLLRDWQR+LRQECRNIERQIRDIQREEKNVQKAIKEAAKRND+G
Sbjct  1    MEKVMNILKPKPNPQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALA ELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALATELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|KDP43979.1| hypothetical protein JCGZ_05446 [Jatropha curcas]
Length=229

 Score =   206 bits (524),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNI+KPKANPQQ LRDWQRRLRQECRNIERQIRDIQREEK+VQKAI+EAAKRNDMG
Sbjct  1    MEKVMNIIKPKANPQQQLRDWQRRLRQECRNIERQIRDIQREEKSVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSRKTVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009619509.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Nicotiana tomentosiformis]
Length=222

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG
Sbjct  1    MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRS++TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSKRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|EYU18785.1| hypothetical protein MIMGU_mgv1a013298mg [Erythranthe guttata]
Length=224

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQLLRDWQRRLR ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG
Sbjct  1    MEKVMNILKPKPNPQQLLRDWQRRLRNECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSR+TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMK+VNNLM
Sbjct  61   SAKSLAKEIVRSRQTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKIVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_011089953.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Sesamum indicum]
Length=222

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV NILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEK+VQKAIKEAAKRNDMG
Sbjct  1    MEKVKNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKSVQKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMK+VNNLM
Sbjct  61   SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKIVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>emb|CDP07042.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMN++KPK NPQQLLRDWQRRLRQECRNIERQIRDIQ+EEKNVQKAIKEAAKRNDMG
Sbjct  1    MEKVMNMIKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQKEEKNVQKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKELVRSRKTVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKSLAKELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_004506062.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X1 [Cicer arietinum]
 ref|XP_004506063.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X2 [Cicer arietinum]
Length=229

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAI+EAAKRND+G
Sbjct  1    MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALA ELVRSRKTVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALATELVRSRKTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|NP_001241270.1| uncharacterized protein LOC100780989 [Glycine max]
 gb|ACU19725.1| unknown [Glycine max]
 gb|KHN21065.1| Vacuolar protein sorting-associated protein 24 like 1 [Glycine 
soja]
Length=228

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV NILKPK NPQQLLRDWQRRLRQ CRNIERQIRDIQREEKNVQKAI+EAAKRNDMG
Sbjct  1    MEKVKNILKPKPNPQQLLRDWQRRLRQGCRNIERQIRDIQREEKNVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSRKTVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNL+
Sbjct  61   SAKALAKELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLI  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009617666.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Nicotiana tomentosiformis]
Length=222

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEK+ NILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNV+K+IKEAAKRNDMG
Sbjct  1    MEKMKNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVEKSIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRS++TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKELVRSKRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006582059.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 isoform X2 [Glycine max]
Length=223

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +3

Query  231  MNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKA  410
            MNILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAI+EAAKRNDMGSAKA
Sbjct  1    MNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREAAKRNDMGSAKA  60

Query  411  LAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            LAKELVRSR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK
Sbjct  61   LAKELVRSRQTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  117



>ref|XP_006488018.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Citrus sinensis]
Length=229

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMN++KPK NPQQLLRDWQR+LRQECRNIERQIRDIQREEKNVQKAIK+AAKRNDM 
Sbjct  1    MEKVMNMIKPKPNPQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMS  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LA+ELVRSRKTVNRLYENKAQ+NSISMHLGESVAIARTVGHL+KSAEVMKLVNNLM
Sbjct  61   SAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009356928.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Pyrus x bretschneideri]
Length=228

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMNI+KPK NPQQ LRDWQR+LRQECRNIERQIRDIQREEK+VQKAI+EAAKRNDMG
Sbjct  1    MERVMNIIKPKPNPQQQLRDWQRKLRQECRNIERQIRDIQREEKSVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKELVRSR+TVNRL+EN+AQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKSLAKELVRSRRTVNRLHENRAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010535627.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Tarenaya hassleriana]
Length=230

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNI+KPK +P+Q LRDWQRRLRQECRNIERQIRDIQREEKNVQKAIK+AAKRND+G
Sbjct  1    MEKVMNIIKPKPDPKQQLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKALAKEIVSSRRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_004163684.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Cucumis sativus]
Length=228

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQ LRDWQRRLRQECRN+ERQIRDIQREEKNVQKAI++AAKRNDM 
Sbjct  1    MEKVMNILKPKPNPQQQLRDWQRRLRQECRNVERQIRDIQREEKNVQKAIRDAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRS+KTVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSKKTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_004147294.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Cucumis sativus]
 gb|KGN64811.1| hypothetical protein Csa_1G109340 [Cucumis sativus]
Length=228

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQ LRDWQRRLRQECRN+ERQIRDIQREEKNVQKAI++AAKRNDM 
Sbjct  1    MEKVMNILKPKPNPQQQLRDWQRRLRQECRNVERQIRDIQREEKNVQKAIRDAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRS+KTVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSKKTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_007016863.1| SNF7 family protein isoform 3 [Theobroma cacao]
 gb|EOY34482.1| SNF7 family protein isoform 3 [Theobroma cacao]
Length=202

 Score =   197 bits (501),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNI+KPK NPQQ LRDWQRRLRQECRNIERQIRDIQREE+NVQKAI+EAAKRNDM 
Sbjct  1    MEKVMNIIKPKPNPQQQLRDWQRRLRQECRNIERQIRDIQREERNVQKAIREAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSR+TVNRLYENKAQ+NSISMHLGESVAIA TVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSRRTVNRLYENKAQMNSISMHLGESVAIALTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006424467.1| hypothetical protein CICLE_v10029212mg [Citrus clementina]
 gb|ESR37707.1| hypothetical protein CICLE_v10029212mg [Citrus clementina]
 gb|KDO60258.1| hypothetical protein CISIN_1g027050mg [Citrus sinensis]
Length=229

 Score =   198 bits (503),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMN++KPK NPQQLLRDWQR+LRQECRNIERQIRDIQREEKNVQKAIK+AAKRND+ 
Sbjct  1    MEKVMNMIKPKPNPQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDLS  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LA+ELVRSRKTVNRLYENKAQ+NSISMHLGESVAIARTVGHL+KSAEVMKLVNNLM
Sbjct  61   SAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009335972.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Pyrus x bretschneideri]
Length=228

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMN++KPKANPQQ LRDWQR+LRQECRNIERQIRDIQREEK+VQKAI+EA+KRNDMG
Sbjct  1    MERVMNVIKPKANPQQQLRDWQRKLRQECRNIERQIRDIQREEKSVQKAIREASKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSR+TVNRL+EN+AQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSRRTVNRLHENRAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009345744.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Pyrus x bretschneideri]
Length=228

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMN++KPKANPQQ LRDWQR+LRQECRNIERQIRDIQREEK+VQKAI+EA+KRNDMG
Sbjct  1    MERVMNVIKPKANPQQQLRDWQRKLRQECRNIERQIRDIQREEKSVQKAIREASKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSR+TVNRL+EN+AQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSRRTVNRLHENRAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009795413.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Nicotiana sylvestris]
Length=222

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEK+ NILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNV+K+IKEAAKRNDMG
Sbjct  1    MEKMKNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVEKSIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRS+ TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKELVRSKITVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_008385520.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Malus domestica]
Length=228

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMN++KPK NPQQ LRDWQR+LRQECRNIERQIRDIQREEK+VQKAI+EAAKRNDMG
Sbjct  1    MERVMNVIKPKPNPQQQLRDWQRKLRQECRNIERQIRDIQREEKSVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSR+TVNRL+EN+AQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSRRTVNRLHENRAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_007016862.1| SNF7 family protein isoform 2 [Theobroma cacao]
 gb|EOY34481.1| SNF7 family protein isoform 2 [Theobroma cacao]
Length=227

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNI+KPK NPQQ LRDWQRRLRQECRNIERQIRDIQREE+NVQKAI+EAAKRNDM 
Sbjct  1    MEKVMNIIKPKPNPQQQLRDWQRRLRQECRNIERQIRDIQREERNVQKAIREAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSR+TVNRLYENKAQ+NSISMHLGESVAIA TVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSRRTVNRLYENKAQMNSISMHLGESVAIALTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_004287557.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Fragaria vesca subsp. vesca]
Length=228

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNI+KPK NPQQ LRDWQR+LRQECRNIERQIRDI+REEK+VQKAIK+AAKRNDMG
Sbjct  1    MEKVMNIIKPKPNPQQQLRDWQRKLRQECRNIERQIRDIEREEKSVQKAIKDAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LA E+VRSRKTVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKSLAVEIVRSRKTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006347202.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Solanum tuberosum]
Length=222

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV NILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEK VQK+IKEAAKRNDMG
Sbjct  1    MEKVKNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKVVQKSIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKELVRS++TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKSLAKELVRSKRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_004241293.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Solanum lycopersicum]
Length=222

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV NILKPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEK VQK+IKEAAKRNDMG
Sbjct  1    MEKVKNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKVVQKSIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKELVRS++TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKSLAKELVRSKRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010045312.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Eucalyptus grandis]
 gb|KCW87474.1| hypothetical protein EUGRSUZ_B03938 [Eucalyptus grandis]
Length=226

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVM+++KPK NPQQ LRDWQRRLRQECRNIERQIRDI+REEKNVQKAIKEAAKRNDMG
Sbjct  1    MEKVMSMIKPKPNPQQQLRDWQRRLRQECRNIERQIRDIEREEKNVQKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V S+KTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKS+EVMKLVN+LM
Sbjct  61   SAKALAKEIVMSKKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNDLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_007205829.1| hypothetical protein PRUPE_ppa010967mg [Prunus persica]
 gb|EMJ07028.1| hypothetical protein PRUPE_ppa010967mg [Prunus persica]
Length=228

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEK+MN++KPK NPQQ LRDWQR+LRQECRNIERQIRDIQREEK+VQKAIK+AAKRNDMG
Sbjct  1    MEKMMNMIKPKPNPQQQLRDWQRKLRQECRNIERQIRDIQREEKSVQKAIKDAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSR+TVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSRRTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_008226446.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Prunus mume]
Length=228

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEK+MN++KPK NPQQ LRDWQR+LRQECRNIERQIRDIQREEK+VQKAIK+AAKRNDMG
Sbjct  1    MEKMMNMIKPKPNPQQQLRDWQRKLRQECRNIERQIRDIQREEKSVQKAIKDAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSR+TVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSRRTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|KJB20375.1| hypothetical protein B456_003G145500 [Gossypium raimondii]
Length=227

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMN++KPK NPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIK+AAKRNDM 
Sbjct  1    MEKVMNMIKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LA E+VRSR+TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKSLAMEIVRSRRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006288588.1| hypothetical protein CARUB_v10001883mg [Capsella rubella]
 gb|EOA21486.1| hypothetical protein CARUB_v10001883mg [Capsella rubella]
Length=229

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMNI+KPK +P+QLLR+WQR+LRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDM 
Sbjct  1    MERVMNIIKPKPDPKQLLREWQRKLRQECRNIERQIRDIQREEKNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVGSRRTVNRLYENKAQMNSISMHLGESVAVARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_002275903.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Vitis vinifera]
 ref|XP_010651776.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Vitis vinifera]
Length=228

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQ LRDWQR+LRQECRNIERQIRDIQREEK VQKAI+EAAKRNDM 
Sbjct  1    MEKVMNILKPKPNPQQQLRDWQRKLRQECRNIERQIRDIQREEKGVQKAIREAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK LA E+VRSR+TVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKTLAMEIVRSRRTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_008463000.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Cucumis melo]
Length=228

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEK+MNILKPK NPQQ LRDWQRRLRQECRN+ERQIRDIQREEKNV KAI++AAKRNDM 
Sbjct  1    MEKMMNILKPKPNPQQQLRDWQRRLRQECRNVERQIRDIQREEKNVHKAIRDAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRS+KTVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSKKTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010111610.1| Vacuolar protein sorting-associated protein 24-1-like protein 
[Morus notabilis]
 gb|EXC31355.1| Vacuolar protein sorting-associated protein 24-1-like protein 
[Morus notabilis]
Length=261

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQ LRDWQR+LRQECRNIERQIRDI++EEKNVQKAI+EAAKRNDM 
Sbjct  1    MEKVMNILKPKPNPQQQLRDWQRKLRQECRNIERQIRDIEKEEKNVQKAIREAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRS+KTVNRL+ENKAQ+NSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKALAKELVRSKKTVNRLHENKAQMNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_002872026.1| SNF7 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48285.1| SNF7 family protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMNI+KPK +P+QLLRDWQR+LRQECRNIERQIRDIQ+EE+NVQKAIKEAAKRNDM 
Sbjct  1    MERVMNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|NP_197686.1| vacuolar protein sorting-associated protein 24-1 [Arabidopsis 
thaliana]
 sp|Q9FFB3.1|VP241_ARATH RecName: Full=Vacuolar protein sorting-associated protein 24 
homolog 1; Short=AtVPS24-1; AltName: Full=Charged multivesicular 
body protein 3 homolog 1; AltName: Full=ESCRT-III complex 
subunit VPS24 homolog 1 [Arabidopsis thaliana]
 dbj|BAB10616.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK96805.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91142.1| unknown protein [Arabidopsis thaliana]
 gb|AED93100.1| vacuolar protein sorting-associated protein 24-1 [Arabidopsis 
thaliana]
Length=229

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMNI+KPK +P+QLLRDWQR+LRQECRNIERQIRDIQ+EE+NVQKAIKEAAKRNDM 
Sbjct  1    MERVMNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|KFK27621.1| hypothetical protein AALP_AA8G407300 [Arabis alpina]
Length=229

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMNI+KPK +P+ LLRDWQR+LRQECRNIERQIRDIQ+EEKNVQKAIKEAAKRNDM 
Sbjct  1    MERVMNIIKPKPDPKILLRDWQRKLRQECRNIERQIRDIQKEEKNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVGSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006384952.1| hypothetical protein POPTR_0004s22530g [Populus trichocarpa]
 gb|ERP62749.1| hypothetical protein POPTR_0004s22530g [Populus trichocarpa]
Length=225

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNI+KPK NPQQ LRDWQRRLRQECRNIERQIRDIQREEK VQKAI++AAKRNDM 
Sbjct  1    MEKVMNIIKPKPNPQQQLRDWQRRLRQECRNIERQIRDIQREEKTVQKAIRDAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVN+LM
Sbjct  61   SAKALAKEIVMSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNDLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>emb|CBI17151.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNILKPK NPQQ LRDWQR+LRQECRNIERQIRDIQREEK VQKAI+EAAKRNDM 
Sbjct  32   MEKVMNILKPKPNPQQQLRDWQRKLRQECRNIERQIRDIQREEKGVQKAIREAAKRNDMV  91

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK LA E+VRSR+TVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  92   SAKTLAMEIVRSRRTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  151

Query  579  K  581
            K
Sbjct  152  K  152



>gb|KJB74776.1| hypothetical protein B456_012G006500 [Gossypium raimondii]
Length=181

 Score =   192 bits (488),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K  N+LKPK NPQQLLRDWQR+LRQECRNIERQIRD+QREEK+VQKAI+EAAKRNDMG
Sbjct  1    MDKFKNMLKPKPNPQQLLRDWQRKLRQECRNIERQIRDVQREEKSVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_008359644.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Malus domestica]
Length=228

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMNI+KPK NPQQ LRDWQR+L QECRNIERQIRDIQREEK+VQKAI+EA+KRNDMG
Sbjct  1    MERVMNIIKPKPNPQQQLRDWQRKLHQECRNIERQIRDIQREEKSVQKAIREASKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSR+TVN L+EN+AQLNSISMHLGESVAIARTVGHLSKS+EVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSRRTVNXLHENRAQLNSISMHLGESVAIARTVGHLSKSSEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006400804.1| hypothetical protein EUTSA_v10014580mg [Eutrema salsugineum]
 gb|ESQ42257.1| hypothetical protein EUTSA_v10014580mg [Eutrema salsugineum]
Length=229

 Score =   193 bits (491),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMNI+KPK +P+QLLRDWQR+LRQECRNIERQIRDIQ+EE+NVQKAIKEAAKRNDM 
Sbjct  1    MERVMNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAVARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010421095.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Camelina sativa]
 ref|XP_010454578.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Camelina sativa]
 ref|XP_010493405.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Camelina sativa]
Length=229

 Score =   193 bits (491),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VMNI+KPK +P+QLLRDWQR+LRQECRNIERQIRDIQ+EE+NVQKAIKEAAKRNDM 
Sbjct  1    MERVMNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVGSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|KJB74775.1| hypothetical protein B456_012G006500 [Gossypium raimondii]
Length=229

 Score =   193 bits (491),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K  N+LKPK NPQQLLRDWQR+LRQECRNIERQIRD+QREEK+VQKAI+EAAKRNDMG
Sbjct  1    MDKFKNMLKPKPNPQQLLRDWQRKLRQECRNIERQIRDVQREEKSVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|KHG26620.1| Vacuolar sorting-associated protein 24 -like protein [Gossypium 
arboreum]
Length=229

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K  N+LKPK NPQQLLRDWQR+LRQECRNIERQIRD+QREEK+VQKAI+EAAKRNDMG
Sbjct  1    MDKFKNMLKPKPNPQQLLRDWQRKLRQECRNIERQIRDVQREEKSVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVISRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|KJB73430.1| hypothetical protein B456_011G235800 [Gossypium raimondii]
 gb|KJB73431.1| hypothetical protein B456_011G235800 [Gossypium raimondii]
Length=229

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K  N+LKPK NPQQLLRDWQR+LRQECRNIERQIRD+QREEK VQKAI+EAAKRNDMG
Sbjct  1    MDKFKNMLKPKPNPQQLLRDWQRKLRQECRNIERQIRDVQREEKGVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|KHG14933.1| Vacuolar sorting-associated protein 24 -like protein [Gossypium 
arboreum]
Length=229

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K  N+LKPK NPQQLLRDWQR+LRQECRNIERQIRDIQREEK VQKAI+EAAKRNDMG
Sbjct  1    MDKFKNMLKPKPNPQQLLRDWQRKLRQECRNIERQIRDIQREEKGVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE++ SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEILMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>emb|CDY50330.1| BnaA10g13630D [Brassica napus]
Length=229

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VM I+KPK +P+QLLRDWQR+LRQECRNIERQIRDIQ+EE+NVQKAIKEAAKRNDM 
Sbjct  1    MERVMKIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAVARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_002311070.1| SNF7 family protein [Populus trichocarpa]
 gb|EEE88437.1| SNF7 family protein [Populus trichocarpa]
Length=229

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K  ++LKPK NPQQ LRDWQR+LRQECRNIERQIRD+QREEK+V KAIKEAAKRNDMG
Sbjct  1    MDKFKSMLKPKPNPQQQLRDWQRKLRQECRNIERQIRDVQREEKSVHKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_011031663.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 isoform X1 [Populus euphratica]
Length=229

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K  ++LKPK NPQQ LRDWQR+LRQECRNIERQIRD+QREEK+V KAIKEAAKRNDMG
Sbjct  1    MDKFKSMLKPKPNPQQQLRDWQRKLRQECRNIERQIRDVQREEKSVHKAIKEAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_007016861.1| Vacuolar protein sorting-associated protein 24 isoform 1 [Theobroma 
cacao]
 gb|EOY34480.1| Vacuolar protein sorting-associated protein 24 isoform 1 [Theobroma 
cacao]
Length=239

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 117/124 (94%), Gaps = 3/124 (2%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIR---DIQREEKNVQKAIKEAAKRN  389
            MEKVMNI+KPK NPQQ LRDWQRRLRQECRNIERQIR   DIQREE+NVQKAI+EAAKRN
Sbjct  1    MEKVMNIIKPKPNPQQQLRDWQRRLRQECRNIERQIRGNSDIQREERNVQKAIREAAKRN  60

Query  390  DMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVN  569
            DM SAKALAKE+VRSR+TVNRLYENKAQ+NSISMHLGESVAIA TVGHLSKSAEVMKLVN
Sbjct  61   DMVSAKALAKEIVRSRRTVNRLYENKAQMNSISMHLGESVAIALTVGHLSKSAEVMKLVN  120

Query  570  NLMK  581
            NLMK
Sbjct  121  NLMK  124



>ref|XP_010520386.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Tarenaya hassleriana]
Length=229

 Score =   191 bits (484),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VM I+KPK +P+Q LRDWQRRLRQECRNIERQIRDIQREE+NVQKAIK+AAKRNDM 
Sbjct  1    MERVMKIIKPKPDPKQQLRDWQRRLRQECRNIERQIRDIQREERNVQKAIKDAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQLNSI+MHLGESVAIARTVGHLSKSA+VMKLVNNLM
Sbjct  61   SAKALAKEIVGSRRTVNRLYENKAQLNSIAMHLGESVAIARTVGHLSKSADVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009131901.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Brassica rapa]
 emb|CDX88774.1| BnaA03g08750D [Brassica napus]
Length=229

 Score =   190 bits (483),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMN++KPK +P+Q+LRDWQR+LRQECRNIERQIRDIQ+EE+ VQKAIKEAAKRNDM 
Sbjct  1    MEKVMNLIKPKPDPKQILRDWQRKLRQECRNIERQIRDIQKEERTVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V +R+TVNRLYENKAQ+NSISMHLGESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVSARRTVNRLYENKAQMNSISMHLGESVAVARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_007010008.1| Vacuolar protein sorting-associated protein 24 [Theobroma cacao]
 gb|EOY18818.1| Vacuolar protein sorting-associated protein 24 [Theobroma cacao]
Length=229

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K  ++LKPK NPQQLLRDWQR+LRQECRNIERQIRD+QREEK+VQKAI+EAAKRND+G
Sbjct  1    MDKFKSMLKPKTNPQQLLRDWQRKLRQECRNIERQIRDVQREEKSVQKAIREAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>emb|CDX71024.1| BnaC03g11080D [Brassica napus]
Length=229

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMN++KPK +P+Q+LRDWQR+LRQECRNIERQIRDIQ+EE+ VQKAIKEAAKRNDM 
Sbjct  1    MEKVMNLIKPKPDPKQILRDWQRKLRQECRNIERQIRDIQKEERTVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V +R+TVNRLYENKAQ+NSISMHLGESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEVVSARRTVNRLYENKAQMNSISMHLGESVAVARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009120619.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X3 [Brassica rapa]
Length=229

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VM I+KPK +P+QLLRDWQR+LRQECRNIERQIRDIQ+EE+NVQKAIKEAAKRNDM 
Sbjct  1    MERVMKIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+T NRLYENKAQ+NSISMHLGESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVSSRRTANRLYENKAQMNSISMHLGESVAVARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009120618.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X2 [Brassica rapa]
Length=230

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VM I+KPK +P+QLLRDWQR+LRQECRNIERQIRDIQ+EE+NVQKAIKEAAKRNDM 
Sbjct  1    MERVMKIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+T NRLYENKAQ+NSISMHLGESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVSSRRTANRLYENKAQMNSISMHLGESVAVARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_011028257.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Populus euphratica]
 ref|XP_011028258.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Populus euphratica]
Length=225

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNI+KPK NPQQ LRDWQRRLRQE RNIERQIRDIQREEK VQKAI++AAKRNDM 
Sbjct  1    MEKVMNIIKPKPNPQQQLRDWQRRLRQEGRNIERQIRDIQREEKTVQKAIRDAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVN+LM
Sbjct  61   SAKALAKEIVMSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNDLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_011012691.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Populus euphratica]
Length=225

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMNI+KPK NPQQ LRDWQRRLRQE RNIERQIRDIQREEK VQKAI++AAKRNDM 
Sbjct  1    MEKVMNIIKPKPNPQQQLRDWQRRLRQEGRNIERQIRDIQREEKTVQKAIRDAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVN+LM
Sbjct  61   SAKALAKEIVMSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNDLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009397570.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=211

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V N+L+PK NPQQ LR+WQRRLRQECRNIERQIRD+QREEKNVQKAIK+AAKRNDM 
Sbjct  1    METVKNLLRPKPNPQQQLREWQRRLRQECRNIERQIRDVQREEKNVQKAIKDAAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSRRAVNRLYENKAQLNSVSMHLGELVATARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010918614.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Elaeis guineensis]
Length=228

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V N+LKPK NPQQ LR+WQRRLRQECRN+ERQIRD+QREEKNVQKAIKEAAKRNDM 
Sbjct  1    METVKNLLKPKLNPQQQLREWQRRLRQECRNMERQIRDVQREEKNVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSR+ VNRLYENKAQLNSISMHLGE VA ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSRRAVNRLYENKAQLNSISMHLGEIVATARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010267215.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Nelumbo nucifera]
Length=229

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+KV ++LKPK NPQQ LRDWQRRLRQECRNIERQIRD+QREEK+VQKAI+EAAKRNDM 
Sbjct  1    MDKVKSLLKPKPNPQQQLRDWQRRLRQECRNIERQIRDVQREEKSVQKAIREAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSRK VNRL+ENKAQLNSI+MHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSRKAVNRLHENKAQLNSIAMHLGESVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009397569.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=227

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V N+L+PK NPQQ LR+WQRRLRQECRNIERQIRD+QREEKNVQKAIK+AAKRNDM 
Sbjct  1    METVKNLLRPKPNPQQQLREWQRRLRQECRNIERQIRDVQREEKNVQKAIKDAAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKSLAKEIVRSRRAVNRLYENKAQLNSVSMHLGELVATARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|AAN60307.1| unknown [Arabidopsis thaliana]
Length=225

 Score =   188 bits (477),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  231  MNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKA  410
            MNI+KPK +P+QLLRDWQR+LRQECRNIERQIRDIQ+EE+NVQKAIKEAAKRNDM SAKA
Sbjct  1    MNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMVSAKA  60

Query  411  LAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            LAKE+V SR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK
Sbjct  61   LAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  117



>ref|XP_006436508.1| hypothetical protein CICLE_v10032656mg [Citrus clementina]
 ref|XP_006485585.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X1 [Citrus sinensis]
 gb|ESR49748.1| hypothetical protein CICLE_v10032656mg [Citrus clementina]
Length=229

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K+ ++LKPK NPQQ LRDWQRRLRQECRNIER IRDIQREEKNVQK+IKE+AKRNDMG
Sbjct  1    MDKMKSMLKPKPNPQQQLRDWQRRLRQECRNIERSIRDIQREEKNVQKSIKESAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE++ SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKS EVMKLVNNLM
Sbjct  61   SAKALAKEILMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|KDO48252.1| hypothetical protein CISIN_1g027052mg [Citrus sinensis]
Length=229

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K+ ++LKPK NPQQ LRDWQRRLRQECRNIER IRDIQREEKNVQK+IKE+AKRNDMG
Sbjct  1    MDKMKSMLKPKPNPQQQLRDWQRRLRQECRNIERSIRDIQREEKNVQKSIKESAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE++ SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKS EVMKLVNNLM
Sbjct  61   SAKALAKEILMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010243255.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Nelumbo nucifera]
Length=228

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+KV ++LKPK NPQQ LRDWQRRL+QECRNIERQIRD+QREEK+VQKAI+EAAKRNDM 
Sbjct  1    MDKVKSLLKPKPNPQQQLRDWQRRLKQECRNIERQIRDVQREEKSVQKAIREAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSRK VNRL+ENKAQ+NSI+MHLGE+VAIARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVRSRKAVNRLHENKAQMNSIAMHLGENVAIARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_008805716.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Phoenix dactylifera]
Length=319

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 129/162 (80%), Gaps = 10/162 (6%)
 Frame = +3

Query  102  GKLGAVK**NHSKEKTTQFRSLSLVF*VVLEFYHL--KLREMEKVMNILKPKANPqqllr  275
            G+LG        +++T   R + +     ++F+ L      ME V N+LKPK NPQQ LR
Sbjct  60   GELG--------EQRTENERGIRVYSPPCVQFHSLISSRSPMETVKNLLKPKPNPQQQLR  111

Query  276  dwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRL  455
            DWQRRLRQECRNIERQIRD+QREEKNVQKAIKEAAKRNDM SAK+LAKE+VRSR+ VNRL
Sbjct  112  DWQRRLRQECRNIERQIRDVQREEKNVQKAIKEAAKRNDMVSAKSLAKEIVRSRRAVNRL  171

Query  456  YENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            YENKAQLNSISMHLGE VA ARTVGHLSKSAEVMKLVN+LMK
Sbjct  172  YENKAQLNSISMHLGELVATARTVGHLSKSAEVMKLVNSLMK  213



>ref|XP_010685399.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010685400.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 [Beta vulgaris subsp. vulgaris]
Length=228

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+KV ++L  K NPQQL+RDWQRRLRQE RNI+RQIRDIQREEK VQKAI+EAAKRNDMG
Sbjct  1    MDKVKSLLGQKPNPQQLMRDWQRRLRQETRNIDRQIRDIQREEKTVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SRKTVNRLYENKAQLNSISMHLGESVAIARTVGHL KSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVTSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLQKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_007016864.1| Vacuolar protein sorting-associated protein 24 isoform 4, partial 
[Theobroma cacao]
 gb|EOY34483.1| Vacuolar protein sorting-associated protein 24 isoform 4, partial 
[Theobroma cacao]
Length=210

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  240  LKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAK  419
            +KPK NPQQ LRDWQRRLRQECRNIERQIRDIQREE+NVQKAI+EAAKRNDM SAKALAK
Sbjct  1    IKPKPNPQQQLRDWQRRLRQECRNIERQIRDIQREERNVQKAIREAAKRNDMVSAKALAK  60

Query  420  ELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            E+VRSR+TVNRLYENKAQ+NSISMHLGESVAIA TVGHLSKSAEVMKLVNNLMK
Sbjct  61   EIVRSRRTVNRLYENKAQMNSISMHLGESVAIALTVGHLSKSAEVMKLVNNLMK  114



>ref|XP_009389257.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Musa acuminata subsp. malaccensis]
Length=227

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V N+L+PK NPQQ LR+WQRRLRQECRNIERQIRD+QREEKNVQKAIK+AAKRNDM 
Sbjct  1    METVKNLLRPKPNPQQQLREWQRRLRQECRNIERQIRDVQREEKNVQKAIKDAAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRS++ VNRLYENKAQLNS++MHLGE VA ARTVGHLSKSAEVMKLVN+LM
Sbjct  61   SAKSLAKEIVRSKQAVNRLYENKAQLNSVTMHLGELVATARTVGHLSKSAEVMKLVNSLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_004957682.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Setaria italica]
Length=229

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV ++LKP+  PQQ LR+WQRRLR ECR ++RQIRD+QREEKNV+KAI+EAAKRNDMG
Sbjct  1    MEKVKSLLKPRPTPQQQLREWQRRLRNECRVLDRQIRDVQREEKNVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKSAEVMK+VNNLM
Sbjct  61   SAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSAEVMKIVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_003563129.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Brachypodium distachyon]
Length=229

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEK+  +LKP+A PQQ LR+WQRRLR ECR ++RQIRD+QREEKNV+KAI+EAAKRNDMG
Sbjct  1    MEKMKGLLKPRATPQQQLREWQRRLRNECRVLDRQIRDVQREEKNVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKSAEVMK+VNNLM
Sbjct  61   SAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSAEVMKIVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>emb|CDY26972.1| BnaC09g36110D [Brassica napus]
Length=223

 Score =   182 bits (462),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VM I+KPK +P+QLLRDWQ +LRQECRNIERQIRDIQ+EE+NVQKAIKEAA+RN M 
Sbjct  1    MERVMKIIKPKPDPKQLLRDWQHKLRQECRNIERQIRDIQKEERNVQKAIKEAARRNGMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVNRLYENKAQ+NSISMHL ESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   SAKALAKEIVSSRRTVNRLYENKAQMNSISMHLRESVAVARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006649245.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Oryza brachyantha]
Length=229

 Score =   182 bits (463),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V ++LKPK  PQQ LR+WQRRLR ECRNIERQIRD+QREEK V+KAI+EAAKRND+G
Sbjct  1    MEAVKSLLKPKPTPQQQLREWQRRLRNECRNIERQIRDVQREEKKVEKAIREAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSRK VNRLYENKAQLNSISMHLGE VA ARTVGHLSKS EVMKLVNNLM
Sbjct  61   SAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_008650985.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF83889.1| unknown [Zea mays]
 gb|ACG28525.1| charged multivesicular body protein 3 [Zea mays]
 tpg|DAA62690.1| TPA: charged multivesicular body protein 3 [Zea mays]
Length=229

 Score =   182 bits (463),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV N+LKP+  PQQ LR+WQRRLR ECR ++RQIRD+QREEKNV+KAI+EAAKRNDMG
Sbjct  1    MEKVKNMLKPRPTPQQQLREWQRRLRNECRVLDRQIRDVQREEKNVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKS EVMK+VNNLM
Sbjct  61   SAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSTEVMKIVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_002462856.1| hypothetical protein SORBIDRAFT_02g033180 [Sorghum bicolor]
 gb|EER99377.1| hypothetical protein SORBIDRAFT_02g033180 [Sorghum bicolor]
Length=229

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV N+LKP+  PQQ LR+WQRRLR ECR ++RQIRD+QREEKNV+KAI+EAAKRNDMG
Sbjct  1    MEKVKNMLKPRPTPQQQLREWQRRLRNECRVLDRQIRDVQREEKNVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKS EVMK+VNNLM
Sbjct  61   SAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSTEVMKIVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|ACG37446.1| charged multivesicular body protein 3 [Zea mays]
Length=229

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV N+LKP+  PQQ LR WQRRLR ECR ++RQIRD+QREEKNV+KAI+EAAKRNDMG
Sbjct  1    MEKVKNMLKPRPTPQQQLRXWQRRLRNECRVLDRQIRDVQREEKNVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKS EVMK+VNNLM
Sbjct  61   SAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSTEVMKIVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006851293.1| hypothetical protein AMTR_s00050p00108830 [Amborella trichopoda]
 gb|ERN12874.1| hypothetical protein AMTR_s00050p00108830 [Amborella trichopoda]
Length=229

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV N+LKPK NPQQLLRDWQRRLRQECR IERQIRD++REEKNVQK I+EAAKRNDM 
Sbjct  1    MEKVKNLLKPKPNPQQLLRDWQRRLRQECRGIERQIRDVEREEKNVQKVIREAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSR+ VNRLYENKAQLNSISMHLGE V  ARTVGHLSKSAEVMK+VN LM
Sbjct  61   SAKALAKEIVRSRRAVNRLYENKAQLNSISMHLGEIVVTARTVGHLSKSAEVMKIVNGLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_007218313.1| hypothetical protein PRUPE_ppa010938mg [Prunus persica]
 gb|EMJ19512.1| hypothetical protein PRUPE_ppa010938mg [Prunus persica]
Length=229

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M KV ++LKPK NP + LRDWQRRLRQECRN+ERQIRDIQ+EEK V K+I+EAAKRNDMG
Sbjct  1    MNKVKSLLKPKPNPSEQLRDWQRRLRQECRNLERQIRDIQKEEKAVHKSIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +AKALAKE++ SRK VNRL+ENKAQLNSISMHLGESVA+ARTVGHLSKSAEVMKLVNNLM
Sbjct  61   TAKALAKEILMSRKAVNRLHENKAQLNSISMHLGESVALARTVGHLSKSAEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_008233267.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Prunus mume]
Length=271

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  KLREMEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKR  386
            +L++M KV ++LKPK NP + LRDWQRRLRQECRN+ERQIRDIQ+EEK V K+I+EAAKR
Sbjct  39   ELKKMNKVKSLLKPKPNPSEQLRDWQRRLRQECRNLERQIRDIQKEEKAVHKSIREAAKR  98

Query  387  NDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLV  566
            NDMG+AKALAKE++ SRK VNRL+ENKAQLNSISMHLGESVA+ARTVGHLSKSAEVMKLV
Sbjct  99   NDMGTAKALAKEILMSRKAVNRLHENKAQLNSISMHLGESVALARTVGHLSKSAEVMKLV  158

Query  567  NNLMK  581
            NNLMK
Sbjct  159  NNLMK  163



>dbj|BAC45115.1| putative endosomal Vps protein complex subunit [Oryza sativa 
Japonica Group]
Length=229

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV  +LKP+  PQQ LR+WQR+LR ECR ++RQIRD+QREEKNV+K+I+EAAKRND+G
Sbjct  1    MEKVKGLLKPRPTPQQQLREWQRKLRNECRVLDRQIRDVQREEKNVEKSIREAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKSAEVMK+VNNLM
Sbjct  61   SAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSAEVMKIVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|NP_001048700.2| Os03g0108400 [Oryza sativa Japonica Group]
 dbj|BAF10614.2| Os03g0108400 [Oryza sativa Japonica Group]
Length=143

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V ++LKPK  PQQ LR+WQRRLR E RNI+RQIRD+QREEK V+K+I+EAAKRND+G
Sbjct  1    MEAVKSLLKPKPTPQQQLREWQRRLRNEGRNIDRQIRDVQREEKKVEKSIREAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSRK VNRLYENKAQLNSISMHLGE VA ARTVGHLSKS EVMKLVNNLM
Sbjct  61   SAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|ACG25955.1| charged multivesicular body protein 3 [Zea mays]
Length=228

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V ++LKPK  PQQ LR+WQRRLR E RNI+RQIRD+QREEK V+KAI+EAAKRNDMG
Sbjct  1    METVKSLLKPKPTPQQQLREWQRRLRNEGRNIDRQIRDVQREEKKVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSRK VNRLYENKAQLNSISMHLGE VA ARTVGHLSKS EVMKLVN+LM
Sbjct  61   SAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATARTVGHLSKSTEVMKLVNSLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_008363454.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Malus domestica]
Length=229

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M KV ++LKPK NP + LR+WQRRLR ECRN+ERQIRDIQ+EEK V K I+EAAKRNDM 
Sbjct  1    MNKVKSLLKPKPNPSEQLREWQRRLRHECRNMERQIRDIQKEEKAVHKTIREAAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +AKALAKE+V SRK VNRL+ENKAQLNSISMHLGESVA+ARTVGHLSKS EVMKLVNNLM
Sbjct  61   TAKALAKEIVMSRKVVNRLHENKAQLNSISMHLGESVALARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_002468673.1| hypothetical protein SORBIDRAFT_01g050050 [Sorghum bicolor]
 gb|EER95671.1| hypothetical protein SORBIDRAFT_01g050050 [Sorghum bicolor]
Length=229

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME + ++LKPK  PQQ LR+WQRRLR E RNI+RQIRD+QREEK V+KAI+EAAKRNDMG
Sbjct  1    METMKSLLKPKPTPQQQLREWQRRLRNEGRNIDRQIRDVQREEKKVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V+SRK VNRLYENKAQLNSISMHLGE VA ARTVGHLSKS EVMKLVNNLM
Sbjct  61   SAKALAKEVVQSRKAVNRLYENKAQLNSISMHLGEIVATARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|EEC74362.1| hypothetical protein OsI_09672 [Oryza sativa Indica Group]
Length=229

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V ++LKPK  PQQ LR+WQRRLR E RNI+RQIRD+QREEK V+K+I+EAAKRND+G
Sbjct  1    MEAVKSLLKPKPTPQQQLREWQRRLRNEGRNIDRQIRDVQREEKKVEKSIREAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSRK VNRLYENKAQLNSISMHLGE VA ARTVGHLSKS EVMKLVNNLM
Sbjct  61   SAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009368927.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X1 [Pyrus x bretschneideri]
Length=229

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M KV  +LKPK NP + LR+WQRRLR ECRN+ERQIRDIQ+EEK V K I+EAAKRNDM 
Sbjct  1    MNKVKTLLKPKPNPSEQLREWQRRLRHECRNMERQIRDIQKEEKAVHKTIREAAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +AKALAKE+V SRK VNRL+ENKAQLNSISMHLGESVA+ARTVGHLSKS EVMKLVNNLM
Sbjct  61   TAKALAKEIVMSRKVVNRLHENKAQLNSISMHLGESVALARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009368928.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X2 [Pyrus x bretschneideri]
Length=228

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M KV  +LKPK NP + LR+WQRRLR ECRN+ERQIRDIQ+EEK V K I+EAAKRNDM 
Sbjct  1    MNKVKTLLKPKPNPSEQLREWQRRLRHECRNMERQIRDIQKEEKAVHKTIREAAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +AKALAKE+V SRK VNRL+ENKAQLNSISMHLGESVA+ARTVGHLSKS EVMKLVNNLM
Sbjct  61   TAKALAKEIVMSRKVVNRLHENKAQLNSISMHLGESVALARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|ABF93564.1| SNF7 family protein, expressed [Oryza sativa Japonica Group]
 gb|EEE58180.1| hypothetical protein OsJ_09111 [Oryza sativa Japonica Group]
Length=231

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V ++LKPK  PQQ LR+WQRRLR E RNI+RQIRD+QREEK V+K+I+EAAKRND+G
Sbjct  1    MEAVKSLLKPKPTPQQQLREWQRRLRNEGRNIDRQIRDVQREEKKVEKSIREAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSRK VNRLYENKAQLNSISMHLGE VA ARTVGHLSKS EVMKLVNNLM
Sbjct  61   SAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATARTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|EYU36149.1| hypothetical protein MIMGU_mgv1a013379mg [Erythranthe guttata]
Length=222

 Score =   175 bits (444),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEK+ ++LKPK NPQQLL+DWQRRLR E RN++RQIRDIQREEKNV K+IKEAAKRNDM 
Sbjct  1    MEKMKSLLKPKPNPQQLLKDWQRRLRNEGRNVDRQIRDIQREEKNVHKSIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LAKE+VRSRKTV RL ENKAQLNS+SMHLGESVA+ART+GHLSKSAEVMK+VNNL+
Sbjct  61   SAKSLAKEIVRSRKTVERLNENKAQLNSVSMHLGESVAVARTIGHLSKSAEVMKIVNNLL  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_009120617.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X1 [Brassica rapa]
Length=255

 Score =   176 bits (445),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 116/147 (79%), Gaps = 26/147 (18%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME+VM I+KPK +P+QLLRDWQR+LRQECRNIERQIRDIQ+EE+NVQKAIKEAAKRNDM 
Sbjct  1    MERVMKIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMV  60

Query  399  SAK--------------------------ALAKELVRSRKTVNRLYENKAQLNSISMHLG  500
            SAK                          ALAKE+V SR+T NRLYENKAQ+NSISMHLG
Sbjct  61   SAKVEQKKKKSLSLCKLSSFQNVFLMMFQALAKEIVSSRRTANRLYENKAQMNSISMHLG  120

Query  501  ESVAIARTVGHLSKSAEVMKLVNNLMK  581
            ESVA+ARTVGHLSKSAEVMKLVNNLMK
Sbjct  121  ESVAVARTVGHLSKSAEVMKLVNNLMK  147



>ref|XP_008667584.1| PREDICTED: uncharacterized protein LOC100273289 isoform X1 [Zea 
mays]
 tpg|DAA42867.1| TPA: charged multivesicular body protein 3 [Zea mays]
Length=228

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V ++LKPK  PQQ LR+WQRRLR E RNI+RQIRD+QREEK V+KAI+EAAKRNDMG
Sbjct  1    METVKSLLKPKPTPQQQLREWQRRLRNEGRNIDRQIRDVQREEKKVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALA E+VRSRK VNRLYENKAQLNSISMHLGE VA ARTVGHLSKS EVMKLVN LM
Sbjct  61   SAKALAMEVVRSRKAVNRLYENKAQLNSISMHLGEIVATARTVGHLSKSTEVMKLVNGLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_003557475.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Brachypodium distachyon]
Length=230

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V ++LKPK  PQQ LR+WQRRLR E RNIERQIRD+Q+EEK V+KAI+EAAKR+D+G
Sbjct  1    MEAVKSLLKPKPTPQQQLREWQRRLRNEGRNIERQIRDVQKEEKKVEKAIREAAKRDDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+VRSRK VNRLYENKAQLNSISMHLGE VA  RTVGHLSKS EVMKLVNNLM
Sbjct  61   SAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATTRTVGHLSKSTEVMKLVNNLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>dbj|BAJ98079.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95640.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            ME V N+LKPK  PQQ LR+WQRRLR E RNIERQIRD+Q+EEK V+KAI+EAAKR DMG
Sbjct  1    MEAVKNLLKPKPTPQQQLREWQRRLRNEGRNIERQIRDVQKEEKKVEKAIREAAKRGDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V+SRK VNRLYENKAQLNSISMHLGE VA  RTVGHLSKS EVMKLVN+LM
Sbjct  61   SAKALAKEVVQSRKAVNRLYENKAQLNSISMHLGEIVATTRTVGHLSKSTEVMKLVNSLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|EPS67269.1| hypothetical protein M569_07508 [Genlisea aurea]
Length=223

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV+N ++PK NPQQLLR+WQRRLR+ECR+IER+IRDIQREEK VQ ++KEAA+RNDM 
Sbjct  1    MEKVLNAIRPKPNPQQLLREWQRRLRRECRDIEREIRDIQREEKRVQGSVKEAARRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK LAKE+VRS+K VNRL ENKAQLNSISMHLGE +AIARTVGHLSKSAEVMKLVN+LM
Sbjct  61   SAKVLAKEIVRSKKAVNRLNENKAQLNSISMHLGEFIAIARTVGHLSKSAEVMKLVNHLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>emb|CDY09181.1| BnaA02g06070D [Brassica napus]
Length=230

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+KVM I+KPK +P+Q LRDWQR+LRQECR+IERQIRDI++EE+ VQKAIKEAAKRNDM 
Sbjct  1    MKKVMKIIKPKPDPKQRLRDWQRKLRQECRDIERQIRDIEKEERTVQKAIKEAAKRNDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAKALAKE+V SR+TVN+LYENKA +NSISMHLGES+A+A TVG+LSKS EVMKLVN+LM
Sbjct  61   SAKALAKEIVSSRRTVNKLYENKAHMNSISMHLGESIAVAGTVGNLSKSTEVMKLVNDLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>tpg|DAA62692.1| TPA: hypothetical protein ZEAMMB73_817857 [Zea mays]
Length=225

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 4/121 (3%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV N+LKP+  PQQ LR+WQRRLR ECR ++RQIRD+QREEKNV+KAI+EAAKRNDMG
Sbjct  1    MEKVKNMLKPRPTPQQQLREWQRRLRNECRVLDRQIRDVQREEKNVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK    ELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKS EVMK+VNNLM
Sbjct  61   SAK----ELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSTEVMKIVNNLM  116

Query  579  K  581
            K
Sbjct  117  K  117



>gb|KHG17098.1| Vacuolar sorting-associated protein 24 -like protein [Gossypium 
arboreum]
Length=212

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 98/121 (81%), Gaps = 15/121 (12%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKVMN++KPK NP               + + R  + IQREEKNVQKAIK+AAKRNDM 
Sbjct  1    MEKVMNMIKPKPNP---------------QQLLRDWQHIQREEKNVQKAIKDAAKRNDMV  45

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LA E+VRSR+TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM
Sbjct  46   SAKSLAMEIVRSRRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  105

Query  579  K  581
            K
Sbjct  106  K  106



>ref|XP_001766951.1| predicted protein [Physcomitrella patens]
 gb|EDQ68117.1| predicted protein [Physcomitrella patens]
Length=235

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV+++ KPK +PQ+ LR+WQR+LRQE RN ERQIR+IQREEKNVQKAIKEAAKRNDM 
Sbjct  1    MEKVLSVFKPKPSPQEQLREWQRKLRQEARNQERQIREIQREEKNVQKAIKEAAKRNDMQ  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LA+ELV SRK V RLYEN+AQLNSISMHLGES+A AR VGHL KS EVM LVN LM
Sbjct  61   SAKSLARELVSSRKVVGRLYENRAQLNSISMHLGESLATARAVGHLQKSTEVMTLVNKLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>gb|EEC82025.1| hypothetical protein OsI_25990 [Oryza sativa Indica Group]
Length=246

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 111/138 (80%), Gaps = 17/138 (12%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV  +LKP+  PQQ LR+WQR+LR ECR ++RQIRD+QREEKNV+K+I+EAAKRND+G
Sbjct  1    MEKVKGLLKPRPTPQQQLREWQRKLRNECRVLDRQIRDVQREEKNVEKSIREAAKRNDIG  60

Query  399  SAK-----------------ALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTV  527
            SAK                 ALAKELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTV
Sbjct  61   SAKLLSNYEQRTLLVLYPTMALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTV  120

Query  528  GHLSKSAEVMKLVNNLMK  581
            GHLSKSAEVMK+VNNLMK
Sbjct  121  GHLSKSAEVMKIVNNLMK  138



>ref|XP_004307352.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Fragaria vesca subsp. vesca]
Length=229

 Score =   167 bits (424),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+K  ++LKPK NP + L+DWQRRLRQE RNIERQIRD++REEK VQKAI+EAAKRNDMG
Sbjct  1    MKKFKSMLKPKPNPTEQLKDWQRRLRQESRNIERQIRDLEREEKVVQKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            SAK+LA+E++ SRK V+RL ENKAQLNSISMHLGESVA+ARTVGHLSKS EVMKLVN+L 
Sbjct  61   SAKSLAREILGSRKAVSRLQENKAQLNSISMHLGESVALARTVGHLSKSTEVMKLVNDLT  120

Query  579  K  581
            +
Sbjct  121  R  121



>gb|AAN62785.1| Unknown protein [Oryza sativa Japonica Group]
Length=303

 Score =   167 bits (422),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 109/133 (82%), Gaps = 12/133 (9%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIR------------DIQREEKNVQK  362
            ME V ++LKPK  PQQ LR+WQRRLR E RNI+RQIR            D+QREEK V+K
Sbjct  1    MEAVKSLLKPKPTPQQQLREWQRRLRNEGRNIDRQIRAMMLMVESGASADVQREEKKVEK  60

Query  363  AIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSK  542
            +I+EAAKRND+GSAKALAKE+VRSRK VNRLYENKAQLNSISMHLGE VA ARTVGHLSK
Sbjct  61   SIREAAKRNDIGSAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATARTVGHLSK  120

Query  543  SAEVMKLVNNLMK  581
            S EVMKLVNNLMK
Sbjct  121  STEVMKLVNNLMK  133



>tpg|DAA42866.1| TPA: hypothetical protein ZEAMMB73_720763 [Zea mays]
Length=240

 Score =   165 bits (417),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 107/133 (80%), Gaps = 12/133 (9%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIR------------DIQREEKNVQK  362
            ME V ++LKPK  PQQ LR+WQRRLR E RNI+RQIR            D+QREEK V+K
Sbjct  1    METVKSLLKPKPTPQQQLREWQRRLRNEGRNIDRQIRGPGCRPRPRCAADVQREEKKVEK  60

Query  363  AIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSK  542
            AI+EAAKRNDMGSAKALA E+VRSRK VNRLYENKAQLNSISMHLGE VA ARTVGHLSK
Sbjct  61   AIREAAKRNDMGSAKALAMEVVRSRKAVNRLYENKAQLNSISMHLGEIVATARTVGHLSK  120

Query  543  SAEVMKLVNNLMK  581
            S EVMKLVN LMK
Sbjct  121  STEVMKLVNGLMK  133



>ref|XP_002983949.1| hypothetical protein SELMODRAFT_180699 [Selaginella moellendorffii]
 gb|EFJ14961.1| hypothetical protein SELMODRAFT_180699 [Selaginella moellendorffii]
Length=237

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 9/130 (7%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M++V  + KP+  PQ+ LR+WQRRLRQE RN+ERQ+RDIQREEKNVQK+I+EA +RND G
Sbjct  1    MDRVKGVFKPRPTPQEQLREWQRRLRQEARNVERQVRDIQREEKNVQKSIREAVRRNDTG  60

Query  399  SAKA---------LAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAE  551
            SAKA         LAKE+VRSRK ++RLYEN+AQLNSISMHLGESVA A+ VGHL+KSAE
Sbjct  61   SAKARPHFHFFLFLAKEIVRSRKVIDRLYENRAQLNSISMHLGESVATAKAVGHLAKSAE  120

Query  552  VMKLVNNLMK  581
            V+K+VNNLMK
Sbjct  121  VLKMVNNLMK  130



>gb|ACN26066.1| unknown [Zea mays]
Length=219

 Score =   161 bits (408),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 102/115 (89%), Gaps = 4/115 (3%)
 Frame = +3

Query  237  ILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALA  416
            +LKP+  PQQ LR+WQRRLR ECR ++RQIRD+QREEKNV+KAI+EAAKRNDMGSAK   
Sbjct  1    MLKPRPTPQQQLREWQRRLRNECRVLDRQIRDVQREEKNVEKAIREAAKRNDMGSAK---  57

Query  417  KELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             ELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKS EVMK+VNNLMK
Sbjct  58   -ELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSTEVMKIVNNLMK  111



>ref|XP_002960722.1| hypothetical protein SELMODRAFT_75154 [Selaginella moellendorffii]
 gb|EFJ38261.1| hypothetical protein SELMODRAFT_75154 [Selaginella moellendorffii]
Length=238

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 109/130 (84%), Gaps = 9/130 (7%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M++V  + KP+  PQ+ LR+WQRRLRQE RN+ERQ+RDIQREEKNVQK+I+EA +RND G
Sbjct  1    MDRVKGVFKPRPTPQEQLREWQRRLRQEARNVERQVRDIQREEKNVQKSIREAVRRNDTG  60

Query  399  SAKA---------LAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAE  551
            SAKA         LAKE+VRSRK ++RLYEN+AQLNSISMHLGESVA A+ VGHL+KS+E
Sbjct  61   SAKARPHFHFFLFLAKEIVRSRKVIDRLYENRAQLNSISMHLGESVATAKAVGHLAKSSE  120

Query  552  VMKLVNNLMK  581
            V+K+VNNLMK
Sbjct  121  VLKMVNNLMK  130



>gb|KDO36911.1| hypothetical protein CISIN_1g028108mg [Citrus sinensis]
Length=213

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  DIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESV  509
            DIQREEKNVQK+IKE+AKRNDMGSAKALAKE++ SRK VNRLYENKAQLNSISMHLGESV
Sbjct  22   DIQREEKNVQKSIKESAKRNDMGSAKALAKEILMSRKAVNRLYENKAQLNSISMHLGESV  81

Query  510  AIARTVGHLSKSAEVMKLVNNLMK  581
            AIARTVGHLSKS EVMKLVNNLMK
Sbjct  82   AIARTVGHLSKSTEVMKLVNNLMK  105



>ref|XP_006658555.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Oryza brachyantha]
Length=197

 Score =   153 bits (387),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  327  RDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGES  506
            +D+QREEKNV+KAI+EAAKRNDMGSAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE 
Sbjct  6    KDVQREEKNVEKAIREAAKRNDMGSAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEI  65

Query  507  VAIARTVGHLSKSAEVMKLVNNLMK  581
            VA ARTVGHLSKS EVMK+VNNLMK
Sbjct  66   VATARTVGHLSKSTEVMKIVNNLMK  90



>ref|XP_002875706.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51965.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M++VM   K K++P+Q LRDWQR+LRQE RNIERQIRDI+REE+NV KAIK++ KR DM 
Sbjct  1    MKRVMKFFKRKSDPKQKLRDWQRKLRQEVRNIERQIRDIEREERNVHKAIKDSVKRYDMV  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +AKAL +E+VRSR+TV RLYENKA++NSISMHLGES+AI+ TVG LSKS EVMKLVN+LM
Sbjct  61   TAKALVREIVRSRRTVKRLYENKAKMNSISMHLGESIAISGTVGLLSKSGEVMKLVNSLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_006291692.1| hypothetical protein CARUB_v10017855mg, partial [Capsella rubella]
 gb|EOA24590.1| hypothetical protein CARUB_v10017855mg, partial [Capsella rubella]
Length=262

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  213  REMEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRND  392
            +EM+++M ++KPK  P+Q LRDWQ++LR EC NIERQIRDI+REE+ VQK IK +AKRND
Sbjct  32   KEMKRLMKMIKPKPGPKQQLRDWQKKLRHECLNIERQIRDIEREERKVQKDIKGSAKRND  91

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            M +AK LA+++VRSR+ V RLYENKAQL+SISMHL ESV  A TVG+LSKSAEVM LVNN
Sbjct  92   MVTAKGLARDIVRSRRIVKRLYENKAQLSSISMHLAESVGTAVTVGNLSKSAEVMNLVNN  151

Query  573  LMK  581
            LMK
Sbjct  152  LMK  154



>ref|XP_001768641.1| predicted protein [Physcomitrella patens]
 gb|EDQ66579.1| predicted protein [Physcomitrella patens]
Length=233

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 102/130 (78%), Gaps = 9/130 (7%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIR---------DIQREEKNVQKAIK  371
            MEKV+   K KA PQ+ LR+WQR LRQ+ R I+RQ+R          IQREEKNVQK+IK
Sbjct  1    MEKVLGAFKSKATPQEQLREWQRTLRQQSRGIDRQVRGECGPTFDVSIQREEKNVQKSIK  60

Query  372  EAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAE  551
            EAAKRNDM SAK+LA+ELV SRK V RL+EN+AQLNSISMHLGESVA AR VG L KS E
Sbjct  61   EAAKRNDMKSAKSLARELVHSRKAVGRLHENRAQLNSISMHLGESVATARAVGQLQKSTE  120

Query  552  VMKLVNNLMK  581
            VMKLVNNLMK
Sbjct  121  VMKLVNNLMK  130



>tpg|DAA62691.1| TPA: hypothetical protein ZEAMMB73_817857 [Zea mays]
Length=102

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV N+LKP+  PQQ LR+WQRRLR ECR ++RQIRD+QREEKNV+KAI+EAAKRNDMG
Sbjct  1    MEKVKNMLKPRPTPQQQLREWQRRLRNECRVLDRQIRDVQREEKNVEKAIREAAKRNDMG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIA  518
            SAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE V +A
Sbjct  61   SAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVGMA  100



>gb|AGT17311.1| multivesicular body protein [Saccharum hybrid cultivar R570]
 gb|AGT17313.1| multivesicular body protein [Saccharum hybrid cultivar R570]
Length=191

 Score =   143 bits (360),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  339  REEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIA  518
            REEK V+KAI+EAAK NDMGSAKALAKE+VRSRK VNRLYENKAQLNSISMHLGE VA A
Sbjct  4    REEKKVEKAIREAAKHNDMGSAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATA  63

Query  519  RTVGHLSKSAEVMKLVNNLMK  581
            RTVGHLSKS EVMKLVNNLMK
Sbjct  64   RTVGHLSKSTEVMKLVNNLMK  84



>gb|AGT15932.1| charged multivesicular body protein [Saccharum hybrid cultivar 
R570]
Length=191

 Score =   143 bits (360),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  339  REEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIA  518
            REEK  +KAI+EAAKRNDMGSAKALAKE+VRSRK VNRLYENKAQLNSISMHLGE VA A
Sbjct  4    REEKKAEKAIREAAKRNDMGSAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATA  63

Query  519  RTVGHLSKSAEVMKLVNNLMK  581
            RTVGHLSKS EVMK VNNLMK
Sbjct  64   RTVGHLSKSTEVMKFVNNLMK  84



>ref|XP_010425933.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X1 [Camelina sativa]
Length=229

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+++MN+ K K +P+Q LRDWQR+LRQECR IE QIRDI+REE+ V+K IK++AKRNDM 
Sbjct  1    MKRLMNMFKRKPDPKQKLRDWQRKLRQECRKIEHQIRDIEREERKVKKDIKDSAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +AK LA+E+V SR+ V RLYENKA LNSISMHLGE+V  A TVG++SKS EVMKLV  LM
Sbjct  61   TAKGLAREIVSSRRIVKRLYENKAHLNSISMHLGETVGTAITVGNISKSTEVMKLVIILM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|NP_001059635.2| Os07g0479400 [Oryza sativa Japonica Group]
 dbj|BAF21549.2| Os07g0479400 [Oryza sativa Japonica Group]
Length=104

 Score =   136 bits (342),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            MEKV  +LKP+  PQQ LR+WQR+LR ECR ++RQIRD+QREEKNV+K+I+EAAKRND+G
Sbjct  1    MEKVKGLLKPRPTPQQQLREWQRKLRNECRVLDRQIRDVQREEKNVEKSIREAAKRNDIG  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAI  515
            SAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE V +
Sbjct  61   SAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVGM  99



>ref|XP_010425934.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X2 [Camelina sativa]
Length=219

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  231  MNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKA  410
            MN+ K K +P+Q LRDWQR+LRQECR IE QIRDI+REE+ V+K IK++AKRNDM +AK 
Sbjct  1    MNMFKRKPDPKQKLRDWQRKLRQECRKIEHQIRDIEREERKVKKDIKDSAKRNDMATAKG  60

Query  411  LAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            LA+E+V SR+ V RLYENKA LNSISMHLGE+V  A TVG++SKS EVMKLV  LMK
Sbjct  61   LAREIVSSRRIVKRLYENKAHLNSISMHLGETVGTAITVGNISKSTEVMKLVIILMK  117



>ref|XP_010503153.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Camelina sativa]
Length=229

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+++MN+ K K +P+Q LRDWQR+LRQECR IE QIRDI+REE+ V+K IK++AKRNDM 
Sbjct  1    MKRLMNMFKRKPDPKQKLRDWQRKLRQECRKIEHQIRDIEREERKVKKDIKDSAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +AK LA+E+V +R+ V RLYENKA LNS+SMHL E+V  A TVG++SKS EVMKLV  LM
Sbjct  61   TAKGLAREIVSARRIVKRLYENKAHLNSMSMHLAETVGTAITVGNISKSTEVMKLVIKLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010425932.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X2 [Camelina sativa]
Length=223

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+++MN+ K K + +  LRDWQR+LRQEC  IERQIRDI+REE+ V+K IK++AKRNDM 
Sbjct  1    MKRLMNMFKRKPDLKLKLRDWQRKLRQECLKIERQIRDIEREERKVKKDIKDSAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +AK LA+E+V SR+ V RLYENKA LNSISMHLGE+V  A TVG++SKS EVMKLV  LM
Sbjct  61   TAKGLAREIVSSRRIVKRLYENKAHLNSISMHLGETVGTAITVGNISKSTEVMKLVIILM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010425931.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X1 [Camelina sativa]
Length=229

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+++MN+ K K + +  LRDWQR+LRQEC  IERQIRDI+REE+ V+K IK++AKRNDM 
Sbjct  1    MKRLMNMFKRKPDLKLKLRDWQRKLRQECLKIERQIRDIEREERKVKKDIKDSAKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +AK LA+E+V SR+ V RLYENKA LNSISMHLGE+V  A TVG++SKS EVMKLV  LM
Sbjct  61   TAKGLAREIVSSRRIVKRLYENKAHLNSISMHLGETVGTAITVGNISKSTEVMKLVIILM  120

Query  579  K  581
            K
Sbjct  121  K  121



>ref|XP_010514836.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Camelina sativa]
Length=225

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+++MN+ K K +P+Q LRDWQR+LRQECR IE QIRDI+REE+ V+K IK++ KRNDM 
Sbjct  1    MKRLMNMFKRKPDPKQKLRDWQRKLRQECRKIEHQIRDIEREERKVKKDIKDSVKRNDMA  60

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLM  578
            +A+ LA+E+V +R+ V RLYENKAQLNS+SMHL E+V  A TVG++SKS EVMK+V  LM
Sbjct  61   TAEGLAREIVSARRIVKRLYENKAQLNSVSMHLAETVGTAITVGNISKSTEVMKIVIKLM  120

Query  579  K  581
            K
Sbjct  121  K  121



>emb|CDY09182.1| BnaA02g06080D [Brassica napus]
Length=261

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  324  IRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGE  503
            I +I++EE+ VQKAIKEAAKRNDM SAKALAKE+V SR+TVN+LYENKA +NSISMHLGE
Sbjct  2    IENIEKEERTVQKAIKEAAKRNDMVSAKALAKEIVSSRRTVNKLYENKAHMNSISMHLGE  61

Query  504  SVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+A+A TVG+LSKS EVMKLVN+LMK
Sbjct  62   SIAVAGTVGNLSKSTEVMKLVNDLMK  87



>gb|EAZ39797.1| hypothetical protein OsJ_24237 [Oryza sativa Japonica Group]
Length=347

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 80/100 (80%), Gaps = 17/100 (17%)
 Frame = +3

Query  333  IQREEKNVQKAIKEAAKRNDMGSAK-----------------ALAKELVRSRKTVNRLYE  461
            +QREEKNV+K+I+EAAKRND+GSAK                 ALAKELVRSR+ VNRLYE
Sbjct  140  VQREEKNVEKSIREAAKRNDIGSAKLLSNYEQRTLLVLYPTMALAKELVRSRRAVNRLYE  199

Query  462  NKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            NKAQLNS+SMHLGE VA ARTVGHLSKSAEVMK+VNNLMK
Sbjct  200  NKAQLNSVSMHLGEIVATARTVGHLSKSAEVMKIVNNLMK  239



>emb|CDY29920.1| BnaC05g29160D [Brassica napus]
Length=125

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 4/100 (4%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+KVM I+KPK +P+Q LRDWQR+LRQECRNIERQIR    EE+ VQKAIKEAAKRNDM 
Sbjct  1    MKKVMKIIKPKPDPKQRLRDWQRKLRQECRNIERQIR----EERTVQKAIKEAAKRNDMV  56

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIA  518
            SAKALAKE+V SR+TVN+LYENKAQ+NSISMHLGES+  A
Sbjct  57   SAKALAKEIVSSRRTVNKLYENKAQMNSISMHLGESIGFA  96



>ref|NP_190086.1| vacuolar protein sorting protein 24.2 [Arabidopsis thaliana]
 sp|Q9LXH5.1|VP242_ARATH RecName: Full=Putative vacuolar protein sorting-associated protein 
24 homolog 2; Short=AtVPS24-2; AltName: Full=Charged multivesicular 
body protein 3 homolog 2; AltName: Full=ESCRT-III 
complex subunit VPS24 homolog 2 [Arabidopsis thaliana]
 emb|CAB89315.1| putative protein [Arabidopsis thaliana]
 gb|AEE77977.1| vacuolar protein sorting protein 24.2 [Arabidopsis thaliana]
Length=200

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  309  NIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSIS  488
             I+  + DI+REE+NV KAIK++ KRND+ +AKALA+E+V SR+TV RLYENKAQ+NSIS
Sbjct  2    TIKSLLSDIEREERNVHKAIKDSVKRNDLVTAKALAREIVSSRRTVKRLYENKAQVNSIS  61

Query  489  MHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            MHLGES+A A TVG+LSKS EVMKLVN+LMK
Sbjct  62   MHLGESIATAVTVGNLSKSGEVMKLVNSLMK  92



>gb|ACU20533.1| unknown [Glycine max]
Length=169

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            MG AKALAKELVRSR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVNN
Sbjct  1    MGPAKALAKELVRSRQTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  60

Query  573  LMK  581
            LMK
Sbjct  61   LMK  63



>ref|XP_002505454.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66712.1| predicted protein [Micromonas sp. RCC299]
Length=219

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +3

Query  228  VMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAK  407
             M++ K K +P++++R WQ +LR E R ++RQIRDIQREEKNV K+IK+ AKRND+ S K
Sbjct  3    FMDLFKKK-DPKEMVRKWQSKLRSEMRGVDRQIRDIQREEKNVTKSIKDCAKRNDIRSMK  61

Query  408  ALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             LAKE+V SR+ V+RLY NKAQ+NS+SM L E +A  R+VGH++KS EV+K +N L+K
Sbjct  62   VLAKEIVNSRRVVSRLYHNKAQMNSVSMMLTEQLATVRSVGHITKSTEVLKAMNGLIK  119



>gb|AFK41585.1| unknown [Lotus japonicus]
Length=171

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            MGSAK LAKELVRSRKTVNRL+ENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVN+
Sbjct  1    MGSAKTLAKELVRSRKTVNRLHENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVND  60

Query  573  LMK  581
            LMK
Sbjct  61   LMK  63



>ref|XP_011031664.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1 isoform X2 [Populus euphratica]
Length=171

 Score =   121 bits (304),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            MGSAKALAKE+V SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN
Sbjct  1    MGSAKALAKEIVMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  60

Query  573  LMK  581
            LMK
Sbjct  61   LMK  63



>gb|KJB73432.1| hypothetical protein B456_011G235800 [Gossypium raimondii]
 gb|KJB73433.1| hypothetical protein B456_011G235800 [Gossypium raimondii]
 gb|KJB73434.1| hypothetical protein B456_011G235800 [Gossypium raimondii]
Length=171

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            MGSAKALAKE+V SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN
Sbjct  1    MGSAKALAKEIVMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  60

Query  573  LMK  581
            LMK
Sbjct  61   LMK  63



>ref|XP_006485586.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like isoform X2 [Citrus sinensis]
Length=171

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            MGSAKALAKE++ SRK VNRLYENKAQLNSISMHLGESVAIARTVGHLSKS EVMKLVNN
Sbjct  1    MGSAKALAKEILMSRKAVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSTEVMKLVNN  60

Query  573  LMK  581
            LMK
Sbjct  61   LMK  63



>ref|XP_006384951.1| hypothetical protein POPTR_0004s22530g [Populus trichocarpa]
 gb|ERP62748.1| hypothetical protein POPTR_0004s22530g [Populus trichocarpa]
Length=167

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            M SAKALAKE+V SR+TVNRLYENKAQ+NSISMHLGESVAIARTVGHLSKSAEVMKLVN+
Sbjct  1    MVSAKALAKEIVMSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVND  60

Query  573  LMK  581
            LMK
Sbjct  61   LMK  63



>gb|ACG25833.1| hypothetical protein [Zea mays]
Length=171

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            MGSAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKS EVMK+VNN
Sbjct  1    MGSAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSTEVMKIVNN  60

Query  573  LMK  581
            LMK
Sbjct  61   LMK  63



>ref|NP_001136753.1| hypothetical protein [Zea mays]
 gb|ACF82539.1| unknown [Zea mays]
 tpg|DAA62693.1| TPA: hypothetical protein ZEAMMB73_817857 [Zea mays]
 tpg|DAA62694.1| TPA: hypothetical protein ZEAMMB73_817857 [Zea mays]
Length=171

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            MGSAKALAKELVRSR+ VNRLYENKAQLNS+SMHLGE VA ARTVGHLSKS EVMK+VNN
Sbjct  1    MGSAKALAKELVRSRRAVNRLYENKAQLNSVSMHLGEIVATARTVGHLSKSTEVMKIVNN  60

Query  573  LMK  581
            LMK
Sbjct  61   LMK  63



>emb|CDX81905.1| BnaC08g36960D [Brassica napus]
Length=141

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMG  398
            M+KVM I+KPK +P+Q LRDWQ +LRQECRNIERQIR   +EE+ VQKAIKEAAKRNDM 
Sbjct  1    MKKVMKIIKPKPDPKQRLRDWQCKLRQECRNIERQIRG-SKEERTVQKAIKEAAKRNDMV  59

Query  399  SAKALAKELVRSRKTVNRLYENKAQLNSISMHL  497
            SAKALAKE+V SR+TVN+LYENKAQ+NSIS  L
Sbjct  60   SAKALAKEIVSSRRTVNKLYENKAQMNSISTRL  92



>ref|XP_003059726.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55678.1| predicted protein [Micromonas pusilla CCMP1545]
Length=232

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E RN++RQ+RDIQ EEK V+K+IK+ AKRND+ S + LAKE+V SRKTV+RL +NKAQ+N
Sbjct  26   EMRNVDRQVRDIQNEEKKVRKSIKDCAKRNDIKSMRVLAKEVVSSRKTVSRLCQNKAQMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNL  575
            S+SM L E +A  ++VGHL+KS EV+K +N L
Sbjct  86   SVSMMLSEQLATVKSVGHLTKSTEVLKAMNAL  117



>ref|XP_001768580.1| predicted protein [Physcomitrella patens]
 gb|EDQ66518.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 5/86 (6%)
 Frame = +3

Query  324  IRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGE  503
            + +IQREEK VQKAIK+ AK+NDM SAK     LV SRK V RLYE++AQLNSISMHLGE
Sbjct  7    LPEIQREEKCVQKAIKDVAKQNDMQSAK-----LVSSRKVVGRLYEHRAQLNSISMHLGE  61

Query  504  SVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+A AR VGHL KS EVM LV  LMK
Sbjct  62   SLATARAVGHLQKSTEVMTLVKKLMK  87



>ref|XP_002955113.1| hypothetical protein VOLCADRAFT_102242 [Volvox carteri f. nagariensis]
 gb|EFJ43867.1| hypothetical protein VOLCADRAFT_102242 [Volvox carteri f. nagariensis]
Length=212

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +3

Query  249  KANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELV  428
            K +P++L+R WQ  LR E R ++RQ+RDIQ EEK V KAI+EAAKR DMGSAK LAKE++
Sbjct  7    KEDPKELVRKWQATLRAEQRGLDRQVRDIQFEEKKVHKAIREAAKRGDMGSAKHLAKEII  66

Query  429  RSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            +SRK V RLY NKA L S++  L E +A+ R  G LSKS EVMK VN ++K
Sbjct  67   QSRKAVARLYTNKAHLQSLNTALMEQLAMLRVAGTLSKSTEVMKAVNTVIK  117



>ref|XP_001701067.1| subunit of the ESCRT-III complex [Chlamydomonas reinhardtii]
 gb|EDP07321.1| subunit of the ESCRT-III complex [Chlamydomonas reinhardtii]
Length=220

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +3

Query  228  VMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAK  407
            ++  L  K +P++ +R WQ  LR E R ++RQIRDIQ EEK + K+I+EAAKR DMGSAK
Sbjct  1    MLKALFAKEDPKESVRKWQATLRAEQRGLDRQIRDIQFEEKKIHKSIREAAKRGDMGSAK  60

Query  408  ALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             LAKE+V+SRK V+RLY NKA + S++  L E +A+ R  G LSKS EVMK VN ++K
Sbjct  61   HLAKEIVQSRKAVSRLYVNKAHMQSLNTALTEQLAMLRVAGTLSKSTEVMKQVNTIIK  118



>gb|EMT12604.1| Vacuolar protein sorting-associated 24-1-like protein [Aegilops 
tauschii]
Length=286

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 66/95 (69%), Gaps = 23/95 (24%)
 Frame = +3

Query  366  IKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESV------------  509
            I++AAKR DMGSAKALAKELV+SRK VNRLYENKAQLNSISMHLGE V            
Sbjct  13   IRDAAKRGDMGSAKALAKELVQSRKAVNRLYENKAQLNSISMHLGEIVDFVPSWLLNLFA  72

Query  510  -----------AIARTVGHLSKSAEVMKLVNNLMK  581
                       A  RTVGHLSKS EVMKLVNNLMK
Sbjct  73   CEYIPDSILASATTRTVGHLSKSTEVMKLVNNLMK  107



>gb|KJB20376.1| hypothetical protein B456_003G145500 [Gossypium raimondii]
Length=161

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +3

Query  420  ELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            E+VRSR+TVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK
Sbjct  2    EIVRSRRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  55



>ref|XP_010111834.1| Vacuolar protein sorting-associated protein 24-1-like protein 
[Morus notabilis]
 gb|EXC31799.1| Vacuolar protein sorting-associated protein 24-1-like protein 
[Morus notabilis]
Length=165

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  393  MGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNN  572
            M S +ALAKELVRS+KTVNRL+ENKAQ+NSISMHLGES AIA TVGHLSKS+EVMKLVNN
Sbjct  1    MLSWQALAKELVRSKKTVNRLHENKAQMNSISMHLGESDAIACTVGHLSKSSEVMKLVNN  60

Query  573  LMK  581
            LMK
Sbjct  61   LMK  63



>ref|XP_004959675.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 
1-like [Setaria italica]
Length=219

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  339  REEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIA  518
            REEK V+KAI+EAAKRNDM S K LAKELVRSR+ ++RLYENKA ++S+ M LGE +   
Sbjct  33   REEKKVEKAIREAAKRNDMASVKTLAKELVRSRRALSRLYENKAHISSVFMRLGEIIGTK  92

Query  519  RTVGHLSKSAEVMKLVNNLMK  581
            RT   LSKSAEVM +VN+LMK
Sbjct  93   RTTECLSKSAEVMNIVNDLMK  113



>gb|EMS49932.1| Vacuolar protein sorting-associated protein 24-like protein 1 
[Triticum urartu]
Length=362

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 5/83 (6%)
 Frame = +3

Query  324  IRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSISMHLG-  500
            +  +Q+EEK V+KAI++AAKR DMGSAKALAKELV+SRK VNRLYENKAQLNSISMHLG 
Sbjct  37   VPHVQKEEKKVEKAIRDAAKRGDMGSAKALAKELVQSRKAVNRLYENKAQLNSISMHLGE  96

Query  501  ----ESVAIARTVGHLSKSAEVM  557
                E+VA+A++ G L ++ E +
Sbjct  97   IVAFEAVALAKSHGGLEEAGEAV  119



>ref|XP_005643152.1| Snf7-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE18608.1| Snf7-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=222

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +3

Query  228  VMNILKPKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAK  407
            ++N  + + +P++L+R WQ  +R + R ++RQIRDI+R+ K  +K +K+AAKR D+ SAK
Sbjct  8    LLNYFRKQPDPKELVRKWQADIRAQQRALDRQIRDIERDRKLAEKQVKDAAKRGDIQSAK  67

Query  408  ALAKELVRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             LAKE+V ++K ++RLY NKA   S++  L E + +A+  G LSKS E+MK+VN+LMK
Sbjct  68   TLAKEIVHTKKAISRLYVNKAHFISMNSQLTEQLGLAKVAGTLSKSTEIMKIVNDLMK  125



>ref|XP_005846960.1| hypothetical protein CHLNCDRAFT_56197 [Chlorella variabilis]
 gb|EFN54858.1| hypothetical protein CHLNCDRAFT_56197 [Chlorella variabilis]
Length=228

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R +ERQ+ ++QRE+K  +K IKEAAKRNDM SA+ LAKE+V  R+TV +L  NKA   
Sbjct  31   EIRGVERQMLEVQREQKKAEKLIKEAAKRNDMASARILAKEVVNMRRTVTKLAVNKATFL  90

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+S  + E +A+ R  G L+ S EV+KLVNNLMK
Sbjct  91   SLSNQMTEQLAMTRVAGALTNSGEVLKLVNNLMK  124



>ref|XP_011396971.1| Vacuolar protein sorting-associated protein 24-like protein 1 
[Auxenochlorella protothecoides]
 gb|KFM24085.1| Vacuolar protein sorting-associated protein 24-like protein 1 
[Auxenochlorella protothecoides]
Length=182

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  249  KANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELV  428
            K +P+QL+R WQ  +R+E R I+RQI D+QRE++   K IK+AAKR D+ SAK +AKE+V
Sbjct  12   KEDPKQLVRTWQSTIRKEIRGIDRQILDMQREQRGAVKLIKDAAKRGDVTSAKIIAKEVV  71

Query  429  RSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
              R+TV +L  NKA + S+S  L E +A+A   G LSKS+EVMKLVN+L K
Sbjct  72   TIRRTVGKLAVNKATMISLSTQLSEQLAMASVAGTLSKSSEVMKLVNSLTK  122



>gb|KFM60205.1| Charged multivesicular body protein 3, partial [Stegodyphus mimosarum]
Length=220

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E  +++RQIR IQREE+ V++++KEAAKR D    K LAKE+VR+RK +NR+Y +KAQ+N
Sbjct  26   EGYHLDRQIRGIQREEEKVKRSLKEAAKRGDTEVCKVLAKEIVRARKAINRIYTSKAQIN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A  R  G L KS +VMK + NL+K
Sbjct  86   SVQMSMNHQLATLRVAGSLEKSTDVMKSMQNLLK  119



>ref|XP_002523708.1| neuroendocrine differentiation factor, putative [Ricinus communis]
 gb|EEF38648.1| neuroendocrine differentiation factor, putative [Ricinus communis]
Length=217

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 77/127 (61%), Gaps = 24/127 (19%)
 Frame = +3

Query  219  MEKVMNILKPKANPqqllrdwqrrlrqECRNIERQIRD---IQREEKNVQKAIKEAAKRN  389
            MEKVMNI+KPK NP                  ++Q+RD   IQREEK+VQKAI++AAKRN
Sbjct  1    MEKVMNIIKPKPNP------------------QQQLRDWQHIQREEKSVQKAIRDAAKRN  42

Query  390  DMGSAKALAKEL-VRSRKTVNRLYENKAQLNSISMHLGESV--AIARTVGHLSKSAEVMK  560
            DMGSAK +   L +     V    E   Q  S +  L   V   IARTVGHLSKSAEVMK
Sbjct  43   DMGSAKKMKVNLGIMQCSNVQGEGEAAMQEASCTWALLLVVVRTIARTVGHLSKSAEVMK  102

Query  561  LVNNLMK  581
            LVNNLMK
Sbjct  103  LVNNLMK  109



>ref|XP_005759503.1| vacuolar protein sorting protein 24 [Emiliania huxleyi CCMP1516]
 gb|EOD07074.1| vacuolar protein sorting protein 24 [Emiliania huxleyi CCMP1516]
Length=211

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQI  IQREE+ +++++KEAAKR D  S K  AKE+VRSRK V RL+ +KAQ+N
Sbjct  21   ESRKLDRQILKIQREEEKIKRSVKEAAKRGDTASCKTYAKEIVRSRKAVTRLHTSKAQMN  80

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   ++ A+ +G L+KSA++MK +N L+K
Sbjct  81   SVVMQMQNQMSQAKVMGTLTKSADIMKAMNKLVK  114



>gb|KFO55293.1| Charged multivesicular body protein 3, partial [Corvus brachyrhynchos]
Length=204

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+N       LAKEL+RSR+ V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKNQRDVCVILAKELIRSRRAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_009099641.1| PREDICTED: charged multivesicular body protein 3 [Serinus canaria]
Length=226

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+N       LAKELVRSR+ V++LY +KA +N
Sbjct  33   EMRVIDRQIRDIQREEEKVKRSIKDAAKKNQRDVCVILAKELVRSRRAVSKLYASKAHMN  92

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  93   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  126



>ref|XP_008626905.1| PREDICTED: charged multivesicular body protein 3 [Corvus brachyrhynchos]
Length=206

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+N       LAKEL+RSR+ V++LY +KA +N
Sbjct  13   EMRVIDRQIRDIQREEEKVKRSIKDAAKKNQRDVCVILAKELIRSRRAVSKLYASKAHMN  72

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  73   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  106



>gb|KFR04528.1| Charged multivesicular body protein 3, partial [Nipponia nippon]
Length=170

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_009970015.1| PREDICTED: charged multivesicular body protein 3, partial [Tyto 
alba]
Length=185

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_005517975.1| PREDICTED: charged multivesicular body protein 3 isoform X1 [Pseudopodoces 
humilis]
Length=220

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+N       LAKEL+RSR+ V++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSIKDAAKKNQRDVCVILAKELIRSRRAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  119



>gb|ACQ58274.1| Charged multivesicular body protein 3 [Anoplopoma fimbria]
Length=220

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  246  PKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKEL  425
            P  +P++ + +W +++R+E R I+RQIRDIQREE+ V+++IK+AAKR        LAKE+
Sbjct  8    PDKSPKEQVNEWSQKIRKEMRVIDRQIRDIQREEEKVKRSIKDAAKRGQRDVCVVLAKEM  67

Query  426  VRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            + S++ V +LY +KAQ+NS+ + +   +A+AR  G L KS EVMK + NL+K
Sbjct  68   IHSKRAVTKLYASKAQMNSVQLSMKNQLAVARVAGSLQKSTEVMKAMQNLIK  119



>gb|ETE62372.1| E3 ubiquitin-protein ligase, partial [Ophiophagus hannah]
Length=834

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  246  PKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKEL  425
            P+  P++L+ +W  ++R+E R I+RQIRDIQREE+ V+++IK+AAK+        LAKE+
Sbjct  622  PEKPPKELVNEWSLKIRKEMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCIVLAKEM  681

Query  426  VRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            +RSRK V++LY ++A +NS+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  682  IRSRKAVSKLYASRAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  733



>ref|XP_005490896.1| PREDICTED: charged multivesicular body protein 3 [Zonotrichia 
albicollis]
 ref|XP_005428392.1| PREDICTED: charged multivesicular body protein 3 [Geospiza fortis]
Length=248

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+N       LAKELVRSR+ V++LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSIKDAAKKNQRDVCVILAKELVRSRRAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>gb|KFP07073.1| Charged multivesicular body protein 3, partial [Calypte anna]
Length=203

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKELVRSRK V +LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELVRSRKAVGKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KFV91446.1| Charged multivesicular body protein 3, partial [Eurypyga helias]
Length=203

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KFV86979.1| Charged multivesicular body protein 3, partial [Struthio camelus 
australis]
Length=203

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KFR10835.1| Charged multivesicular body protein 3, partial [Opisthocomus 
hoazin]
Length=203

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KGL91258.1| Charged multivesicular body protein 3, partial [Charadrius vociferus]
Length=203

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KFP58659.1| Charged multivesicular body protein 3, partial [Cathartes aura]
 gb|KFP62945.1| Charged multivesicular body protein 3, partial [Cariama cristata]
 gb|KFQ08191.1| Charged multivesicular body protein 3, partial [Haliaeetus albicilla]
 gb|KFQ80968.1| Charged multivesicular body protein 3, partial [Phoenicopterus 
ruber ruber]
 gb|KFV47793.1| Charged multivesicular body protein 3, partial [Gavia stellata]
 gb|KFW01521.1| Charged multivesicular body protein 3, partial [Fulmarus glacialis]
Length=203

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KFP11175.1| Charged multivesicular body protein 3, partial [Egretta garzetta]
Length=203

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_010008173.1| PREDICTED: charged multivesicular body protein 3, partial [Nestor 
notabilis]
 gb|KFQ46160.1| Charged multivesicular body protein 3, partial [Nestor notabilis]
Length=203

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_010576116.1| PREDICTED: charged multivesicular body protein 3 isoform X4 [Haliaeetus 
leucocephalus]
Length=218

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  119



>ref|XP_009922345.1| PREDICTED: charged multivesicular body protein 3, partial [Haliaeetus 
albicilla]
Length=208

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  16   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  75

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  76   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  109



>ref|XP_005045633.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X3 [Ficedula albicollis]
Length=220

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V++++K+AAK+N       LAKEL+RSR+ V++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSVKDAAKKNQRDVCVILAKELIRSRRAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  119



>gb|KFM01751.1| Charged multivesicular body protein 3, partial [Aptenodytes forsteri]
Length=203

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KFP75044.1| Charged multivesicular body protein 3, partial [Apaloderma vittatum]
Length=203

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_006028703.1| PREDICTED: charged multivesicular body protein 3 isoform X1 [Alligator 
sinensis]
Length=220

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLIK  119



>gb|KFQ04463.1| Charged multivesicular body protein 3, partial [Leptosomus discolor]
Length=203

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V +LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVGKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_005029940.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X4 [Anas platyrhynchos]
Length=325

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+    +   LAKEL+RSRK V++LY +KA +N
Sbjct  133  EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDACVILAKELIRSRKAVSKLYASKAHMN  192

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  193  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  226



>gb|KFO94295.1| Charged multivesicular body protein 3, partial [Buceros rhinoceros 
silvestris]
Length=203

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKELVRSR+ V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELVRSRRAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLIK  104



>ref|XP_010141750.1| PREDICTED: charged multivesicular body protein 3, partial [Buceros 
rhinoceros silvestris]
Length=205

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKELVRSR+ V++LY +KA +N
Sbjct  13   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELVRSRRAVSKLYASKAHMN  72

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  73   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLIK  106



>ref|XP_008111320.1| PREDICTED: charged multivesicular body protein 3 isoform X2 [Anolis 
carolinensis]
Length=222

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  119



>ref|XP_001568986.1| SNF7-like protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM44119.1| SNF7-like protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=217

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R IE QI  IQREE  V+ ++K+AAK+ND  + + LAKE++RSRK VNRLY +KAQ+N
Sbjct  27   EQRKIELQINKIQREETKVKMSMKQAAKQNDEVAVRMLAKEMIRSRKAVNRLYASKAQMN  86

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+SM L    +  R  G L KS E+MK +NNL+K
Sbjct  87   SVSMQLQNQSSQMRMSGSLKKSGEIMKEMNNLVK  120



>ref|XP_009287683.1| PREDICTED: charged multivesicular body protein 3 [Aptenodytes 
forsteri]
Length=228

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  36   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  95

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  96   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  129



>ref|XP_005229928.1| PREDICTED: charged multivesicular body protein 3 [Falco peregrinus]
Length=219

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  27   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  86

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  87   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  120



>ref|XP_002130271.1| PREDICTED: charged multivesicular body protein 3-like [Ciona 
intestinalis]
Length=212

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +3

Query  246  PKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKEL  425
            P  +P++  R W   LR+E R ++RQIR IQRE++ V+K++KEAAK+ D  SA  LAKEL
Sbjct  8    PPPDPREKARQWSSELRKEGRLLDRQIRSIQREQEKVKKSLKEAAKKGDKQSAAILAKEL  67

Query  426  VRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            V S K+++R+Y +KA +NS+ M +   VA+AR  G   KS+EVMK +  L+K
Sbjct  68   VHSNKSISRIYASKATINSVDMGIKNQVAMARVSGAFEKSSEVMKAMQELVK  119



>ref|XP_008500084.1| PREDICTED: charged multivesicular body protein 3 [Calypte anna]
Length=247

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKELVRSRK V +LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELVRSRKAVGKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>ref|XP_009975459.1| PREDICTED: charged multivesicular body protein 3, partial [Tauraco 
erythrolophus]
 gb|KFU99257.1| Charged multivesicular body protein 3, partial [Tauraco erythrolophus]
Length=203

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVVDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_002603819.1| hypothetical protein BRAFLDRAFT_124687 [Branchiostoma floridae]
 gb|EEN59830.1| hypothetical protein BRAFLDRAFT_124687 [Branchiostoma floridae]
Length=222

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R ++RQIR IQREE+ V++++KEAAK+ D  + + LAKE+VRSRK V+++Y +KAQ+NS+
Sbjct  28   RLLDRQIRGIQREEEKVKRSLKEAAKKGDKDTCRILAKEMVRSRKAVSKIYTSKAQINSV  87

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            SM +   + + +  G + KS EVMK + NL+K
Sbjct  88   SMGMKNQLGVLKVSGAMEKSTEVMKYMQNLVK  119



>ref|XP_005292502.1| PREDICTED: charged multivesicular body protein 3 isoform X3 [Chrysemys 
picta bellii]
Length=220

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V++++K+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLIK  119



>ref|NP_001232425.1| putative vacuolar protein sorting 24 isoform 1 variant 1 [Taeniopygia 
guttata]
 gb|ACH44802.1| putative vacuolar protein sorting 24 isoform 1 variant 1 [Taeniopygia 
guttata]
Length=247

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+N       LAKELVRSR+ +++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSIKDAAKKNQRDVCVILAKELVRSRRAISKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS +VMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTDVMKAMQNLVK  119



>gb|KFW86821.1| Charged multivesicular body protein 3, partial [Manacus vitellinus]
Length=203

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V++++K+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|EMC83057.1| Charged multivesicular body protein 3, partial [Columba livia]
Length=203

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVVDRQIRDIQREEEKVKRSIKDAAKKGQRDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_010400387.1| PREDICTED: charged multivesicular body protein 3 isoform X2 [Corvus 
cornix cornix]
Length=270

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+N       LAKEL+RSR+ V++LY +KA +N
Sbjct  77   EMRVIDRQIRDIQREEEKVKRSIKDAAKKNQRDVCVILAKELIRSRRAVSKLYASKAHMN  136

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  137  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  170



>ref|XP_009933052.1| PREDICTED: charged multivesicular body protein 3 [Opisthocomus 
hoazin]
Length=247

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>ref|XP_009865174.1| PREDICTED: charged multivesicular body protein 3 [Apaloderma 
vittatum]
Length=237

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  45   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  104

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  105  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  138



>gb|KFU98562.1| Charged multivesicular body protein 3, partial [Pterocles gutturalis]
Length=203

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  11   EMRVVDRQIRDIQREEEKVKRSIKDAAKKGQRDVCVILAKELIRSRKAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_009647170.1| PREDICTED: charged multivesicular body protein 3 [Egretta garzetta]
Length=247

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>ref|XP_005510025.1| PREDICTED: charged multivesicular body protein 3 [Columba livia]
Length=218

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  26   EMRVVDRQIRDIQREEEKVKRSIKDAAKKGQRDVCVILAKELIRSRKAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  119



>ref|XP_009880818.1| PREDICTED: charged multivesicular body protein 3 [Charadrius 
vociferus]
Length=247

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>ref|XP_009330153.1| PREDICTED: LOW QUALITY PROTEIN: charged multivesicular body protein 
3 [Pygoscelis adeliae]
Length=247

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>ref|XP_009684385.1| PREDICTED: charged multivesicular body protein 3 isoform X3 [Struthio 
camelus australis]
Length=254

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  62   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  121

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  122  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  155



>ref|XP_009694260.1| PREDICTED: charged multivesicular body protein 3, partial [Cariama 
cristata]
Length=239

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  47   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  106

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  107  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  140



>ref|XP_005446437.1| PREDICTED: charged multivesicular body protein 3 [Falco cherrug]
Length=247

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>ref|XP_009684386.1| PREDICTED: charged multivesicular body protein 3 isoform X4 [Struthio 
camelus australis]
 ref|XP_009684387.1| PREDICTED: charged multivesicular body protein 3 isoform X4 [Struthio 
camelus australis]
Length=192

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +NS+
Sbjct  2    RVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMNSV  61

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             M +   +A+ R  G L KS EVMK + NL+K
Sbjct  62   LMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  93



>ref|XP_010145409.1| PREDICTED: charged multivesicular body protein 3 [Eurypyga helias]
Length=192

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +NS+
Sbjct  2    RVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMNSV  61

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             M +   +A+ R  G L KS EVMK + NL+K
Sbjct  62   LMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  93



>ref|XP_008933459.1| PREDICTED: charged multivesicular body protein 3, partial [Merops 
nubicus]
 gb|KFQ25021.1| Charged multivesicular body protein 3, partial [Merops nubicus]
Length=202

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSR+ V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRRAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KFU91577.1| Charged multivesicular body protein 3, partial [Chaetura pelagica]
Length=203

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSR+ V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQRDVCVILAKELIRSRRAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KFQ31413.1| Charged multivesicular body protein 3, partial [Mesitornis unicolor]
Length=203

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSR+ V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRRAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>gb|KFO72527.1| Charged multivesicular body protein 3, partial [Cuculus canorus]
Length=203

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSR+ V++LY +KA +N
Sbjct  11   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRRAVSKLYASKAHMN  70

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  71   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  104



>ref|XP_009478017.1| PREDICTED: charged multivesicular body protein 3 [Pelecanus crispus]
 ref|XP_009572266.1| PREDICTED: charged multivesicular body protein 3 [Fulmarus glacialis]
 ref|XP_009817864.1| PREDICTED: charged multivesicular body protein 3 [Gavia stellata]
Length=192

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +NS+
Sbjct  2    RVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMNSV  61

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             M +   +A+ R  G L KS EVMK + NL+K
Sbjct  62   LMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  93



>ref|XP_007175385.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X3 [Balaenoptera acutorostrata scammoni]
Length=221

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V++++K+AAK+        LAKE++RSRKTV++LY +KA +N
Sbjct  26   EMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKTVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + +L+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVK  119



>ref|XP_011444021.1| PREDICTED: charged multivesicular body protein 3-like [Crassostrea 
gigas]
 gb|EKC25074.1| Charged multivesicular body protein 3 [Crassostrea gigas]
Length=215

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E  NI+RQIR IQREE+ V++++K+AAK+ +  S K LAKE+VR+RK VNRLY +KA +N
Sbjct  26   EGYNIDRQIRGIQREEEKVKRSLKDAAKKGEKESCKILAKEIVRARKAVNRLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A  R  G L KS EVMK +  L+K
Sbjct  86   SVQMQMKNQLATLRIAGALEKSTEVMKSMQALVK  119



>ref|XP_006271557.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X2 [Alligator mississippiensis]
 ref|XP_006271558.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X3 [Alligator mississippiensis]
Length=220

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKE++R+RK V++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVVLAKEMIRARKAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLIK  119



>ref|XP_009959146.1| PREDICTED: charged multivesicular body protein 3 [Leptosomus 
discolor]
Length=192

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V +LY +KA +NS+
Sbjct  2    RVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVGKLYASKAHMNSV  61

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             M +   +A+ R  G L KS EVMK + NL+K
Sbjct  62   LMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  93



>ref|XP_009073206.1| PREDICTED: charged multivesicular body protein 3 [Acanthisitta 
chloris]
Length=218

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSR+ V++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRRAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  119



>ref|XP_010576124.1| PREDICTED: charged multivesicular body protein 3 isoform X5 [Haliaeetus 
leucocephalus]
Length=325

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  133  EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  192

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  193  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  226



>ref|XP_005045632.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X2 [Ficedula albicollis]
Length=327

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V++++K+AAK+N       LAKEL+RSR+ V++LY +KA +N
Sbjct  133  EMRVIDRQIRDIQREEEKVKRSVKDAAKKNQRDVCVILAKELIRSRRAVSKLYASKAHMN  192

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  193  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  226



>ref|XP_007063786.1| PREDICTED: charged multivesicular body protein 3 [Chelonia mydas]
Length=232

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V++++K+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  38   EMRVIDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  97

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  98   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  131



>ref|XP_009469965.1| PREDICTED: LOW QUALITY PROTEIN: charged multivesicular body protein 
3 [Nipponia nippon]
Length=328

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  133  EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  192

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  193  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  226



>ref|XP_008929217.1| PREDICTED: charged multivesicular body protein 3 isoform X1 [Manacus 
vitellinus]
Length=247

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V++++K+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>emb|CEP15313.1| hypothetical protein [Parasitella parasitica]
Length=221

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R I+R+IR I  EE  V+K+IK+ AK+ D+ + + LAKELVRS+K  NRLY +KAQ+NSI
Sbjct  30   RQIDREIRSIDNEESKVKKSIKQIAKKGDVKNCRMLAKELVRSQKHKNRLYTSKAQMNSI  89

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNL  575
            +M L   +A  +  G + KSAEVMK+VN L
Sbjct  90   TMQLDHQLATIKLAGSIQKSAEVMKMVNQL  119



>ref|XP_003222421.1| PREDICTED: charged multivesicular body protein 3 isoform X3 [Anolis 
carolinensis]
Length=329

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  133  EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  192

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  193  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  226



>ref|XP_007427680.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X2 [Python bivittatus]
Length=327

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  133  EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  192

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  193  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  226



>ref|XP_420858.2| PREDICTED: charged multivesicular body protein 3 isoformX2 [Gallus 
gallus]
Length=218

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + +L+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVK  119



>ref|XP_009998524.1| PREDICTED: charged multivesicular body protein 3 [Chaetura pelagica]
Length=247

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSR+ V++LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQRDVCVILAKELIRSRRAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>ref|XP_010703289.1| SNF7-like protein [Leishmania panamensis]
 gb|AIO02489.1| SNF7-like protein [Leishmania panamensis]
Length=217

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R IE QI  IQREE  V+ ++K+AAK+ND  + + LAKE++RSRK VNRLY +KAQ+N
Sbjct  27   EQRKIELQINKIQREETKVKMSMKQAAKQNDEVAVRMLAKEMIRSRKAVNRLYASKAQMN  86

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+SM L    +  +  G L KS E+MK +NNL+K
Sbjct  87   SVSMQLQNQSSQMKMSGSLKKSGEIMKEMNNLVK  120



>gb|EMP32190.1| Charged multivesicular body protein 3 [Chelonia mydas]
Length=243

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V++++K+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  49   EMRVIDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  108

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  109  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  142



>ref|XP_010074540.1| PREDICTED: charged multivesicular body protein 3 [Pterocles gutturalis]
Length=192

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R ++RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +NS+
Sbjct  2    RVVDRQIRDIQREEEKVKRSIKDAAKKGQRDVCVILAKELIRSRKAVSKLYASKAHMNSV  61

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             M +   +A+ R  G L KS EVMK + NL+K
Sbjct  62   LMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  93



>ref|XP_008929219.1| PREDICTED: charged multivesicular body protein 3 isoform X2 [Manacus 
vitellinus]
Length=192

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R I+RQIRDIQREE+ V++++K+AAK+        LAKEL+RSRK V++LY +KA +NS+
Sbjct  2    RVIDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMNSV  61

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
             M +   +A+ R  G L KS EVMK + NL+K
Sbjct  62   LMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  93



>ref|XP_009554287.1| PREDICTED: charged multivesicular body protein 3 [Cuculus canorus]
Length=247

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSR+ V++LY +KA +N
Sbjct  55   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRRAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>ref|XP_006111681.1| PREDICTED: charged multivesicular body protein 3 isoform X1 [Pelodiscus 
sinensis]
Length=220

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V++++K+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  26   EMRVLDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  86   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  119



>dbj|GAN01797.1| vacuolar sorting protein VPS24 [Mucor ambiguus]
Length=225

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R I+RQIR I  EE  V+K+IK+ AK+ D+ + K LAKEL+RS++  NRLY +KAQ+NSI
Sbjct  30   RGIDRQIRAIDAEEAKVKKSIKQVAKKGDVKNCKMLAKELIRSQRHKNRLYTSKAQMNSI  89

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNL  575
             M L   +A  +  G L KS EVMKLVN L
Sbjct  90   IMQLEHQLATLKVAGSLQKSGEVMKLVNQL  119



>ref|XP_010708906.1| PREDICTED: charged multivesicular body protein 3 [Meleagris gallopavo]
Length=240

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSRK V++LY +KA +N
Sbjct  48   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRKAVSKLYASKAHMN  107

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + +L+K
Sbjct  108  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVK  141



>ref|XP_001954294.1| GF16818 [Drosophila ananassae]
 gb|EDV42855.1| GF16818 [Drosophila ananassae]
Length=226

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  246  PKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKEL  425
            P  +P++ +++W  ++R+E   ++RQIR IQREE+ V++++K+AA++ND  +   LAKE+
Sbjct  8    PSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEI  67

Query  426  VRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            V SRK VNR+Y +KA LNSI M +   +A  R  G L KS EVM+ + NL++
Sbjct  68   VNSRKAVNRIYTSKAHLNSIQMQMKNQLATLRVAGSLQKSTEVMQAMQNLVR  119



>ref|XP_005292501.1| PREDICTED: charged multivesicular body protein 3 isoform X2 [Chrysemys 
picta bellii]
Length=327

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V++++K+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  133  EMRVIDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  192

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  193  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLIK  226



>ref|XP_010178300.1| PREDICTED: charged multivesicular body protein 3 [Mesitornis 
unicolor]
Length=254

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSR+ V++LY +KA +N
Sbjct  62   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRRAVSKLYASKAHMN  121

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  122  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  155



>ref|XP_006111682.1| PREDICTED: charged multivesicular body protein 3 isoform X2 [Pelodiscus 
sinensis]
Length=212

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V++++K+AAK+        LAKE++RSRK V++LY +KA +N
Sbjct  18   EMRVLDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMN  77

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  78   SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  111



>ref|XP_001626340.1| predicted protein [Nematostella vectensis]
 gb|EDO34240.1| predicted protein, partial [Nematostella vectensis]
Length=176

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +3

Query  246  PKANPqqllrdwqrrlrqECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKEL  425
            PK  P++ +R+W   +R+E R ++RQIR IQ EE  V+++IK+AAKR D      LAKE+
Sbjct  8    PKKTPKEQVREWCATVRKENRQLDRQIRAIQNEEMKVKRSIKDAAKRGDKDVCNILAKEI  67

Query  426  VRSRKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            ++SRK VN++Y +KAQLNS+ M +   +A  R  G + KS EVM ++  L+K
Sbjct  68   IQSRKAVNKMYSSKAQLNSVEMQMKNQLATLRMAGAMEKSTEVMSMMQKLVK  119



>ref|XP_005801162.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X1 [Xiphophorus maculatus]
Length=221

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKE+++S++ V +LY +KAQ+N
Sbjct  26   EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKEMIQSKRAVTKLYASKAQMN  85

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ + +   +A+ R  G L KS EVMK++ NL+K
Sbjct  86   SVLLSMKNQLAVVRVAGALQKSTEVMKVMQNLVK  119



>ref|XP_006271559.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X4 [Alligator mississippiensis]
Length=327

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+RQIRDIQREE+ V+++IK+AAK+        LAKE++R+RK V++LY +KA +N
Sbjct  133  EMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVVLAKEMIRARKAVSKLYASKAHMN  192

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  193  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLIK  226



>ref|XP_010211114.1| PREDICTED: charged multivesicular body protein 3 [Tinamus guttatus]
Length=249

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V+++IK+AAK+        LAKEL+RSR+ V++LY +KA +N
Sbjct  55   EMRVVDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKELIRSRRAVSKLYASKAHMN  114

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + NL+K
Sbjct  115  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQNLVK  148



>ref|XP_007175387.1| PREDICTED: charged multivesicular body protein 3-like isoform 
X5 [Balaenoptera acutorostrata scammoni]
Length=328

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V++++K+AAK+        LAKE++RSRKTV++LY +KA +N
Sbjct  133  EMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKTVSKLYASKAHMN  192

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + +L+K
Sbjct  193  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVK  226



>gb|EHA99121.1| Charged multivesicular body protein 3 [Heterocephalus glaber]
Length=297

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V++++K+AAK+        LAKE++RSRKTV++LY +KA +N
Sbjct  102  EMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKTVSKLYVSKAHMN  161

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + +L+K
Sbjct  162  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVK  195



>gb|EPB82581.1| hypothetical protein HMPREF1544_10665 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=231

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +3

Query  306  RNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLNSI  485
            R I+RQIR I  EE  V+K+IK+ AK+ D+ + K LAKEL+RS++  NRLY +KAQ+NSI
Sbjct  30   RGIDRQIRAIDAEEAKVKKSIKQVAKKGDVKNCKMLAKELIRSQRHKNRLYTSKAQMNSI  89

Query  486  SMHLGESVAIARTVGHLSKSAEVMKLVNNL  575
             M L   +A  +  G L KS EVMKLVN L
Sbjct  90   IMQLEHQLATLKVAGSLQKSGEVMKLVNQL  119



>gb|EPY27103.1| charged multivesicular body protein 3 [Angomonas deanei]
Length=216

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+ QI  I+REE+ V+ ++K+AAK+ND  + K LAKELVRSRK VNR+Y  K Q+N
Sbjct  27   EQRKIDMQITRIRREEQKVKMSMKQAAKQNDTVAVKMLAKELVRSRKAVNRMYTAKTQMN  86

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S++M L   +A A+  G L KS E+MK +N L+K
Sbjct  87   SVAMQLQNQLAQAKVAGGLQKSGEIMKEMNALVK  120



>gb|EPY37420.1| charged multivesicular body protein 3 [Angomonas deanei]
Length=207

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R I+ QI  I+REE+ V+ ++K+AAK+ND  + K LAKELVRSRK VNR+Y  K Q+N
Sbjct  27   EQRKIDMQITRIRREEQKVKMSMKQAAKQNDTVAVKMLAKELVRSRKAVNRMYTAKTQMN  86

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S++M L   +A A+  G L KS E+MK +N L+K
Sbjct  87   SVAMQLQNQLAQAKVAGGLQKSGEIMKEMNALVK  120



>ref|XP_004878597.1| PREDICTED: charged multivesicular body protein 3-like [Heterocephalus 
glaber]
Length=319

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  300  ECRNIERQIRDIQREEKNVQKAIKEAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQLN  479
            E R ++RQIRDIQREE+ V++++K+AAK+        LAKE++RSRKTV++LY +KA +N
Sbjct  124  EMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKTVSKLYVSKAHMN  183

Query  480  SISMHLGESVAIARTVGHLSKSAEVMKLVNNLMK  581
            S+ M +   +A+ R  G L KS EVMK + +L+K
Sbjct  184  SVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVK  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455