BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I17

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAA64415.1|  lipoxygenase (LOX)                                     151   1e-41   Solanum lycopersicum
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5               157   5e-41   Solanum tuberosum [potatoes]
gb|KGN60927.1|  Lipoxygenase                                            145   7e-41   Cucumis sativus [cucumbers]
gb|AGN75068.1|  lipoxygenase 2                                          155   3e-40   Momordica charantia [balsam pear]
ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    154   6e-40   Solanum lycopersicum
gb|KGN60934.1|  hypothetical protein Csa_2G028460                       142   1e-39   Cucumis sativus [cucumbers]
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    153   2e-39   Nicotiana sylvestris
gb|KGN60931.1|  hypothetical protein Csa_2G027440                       141   2e-39   Cucumis sativus [cucumbers]
gb|AFU51542.1|  lipoxygenase 3                                          152   3e-39   Capsicum annuum
gb|ACO57136.1|  lipoxygenase 1                                          152   3e-39   Capsicum annuum
gb|ABF60001.1|  lipoxygenase 5                                          149   4e-39   Actinidia deliciosa [Chinese gooseberry]
ref|NP_001234098.1|  lipoxygenase                                       151   5e-39   Solanum lycopersicum
emb|CAA64769.1|  lipoxygenase                                           150   7e-39   Solanum tuberosum [potatoes]
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    151   7e-39   Fragaria vesca subsp. vesca
gb|ABF19102.2|  9-lipoxygenase                                          150   1e-38   Capsicum annuum
gb|AGL96414.1|  9-lipoxygenase                                          150   1e-38   Nicotiana benthamiana
emb|CAA64765.1|  lipoxygenase                                           150   2e-38   Solanum tuberosum [potatoes]
emb|CAD10740.1|  lipoxygenase                                           150   2e-38   Corylus avellana [European hazelnut]
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    150   2e-38   Solanum tuberosum [potatoes]
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    150   2e-38   Solanum tuberosum [potatoes]
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    150   2e-38   Solanum tuberosum [potatoes]
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like          150   2e-38   Solanum tuberosum [potatoes]
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    150   2e-38   Solanum tuberosum [potatoes]
gb|KGN60918.1|  hypothetical protein Csa_2G023850                       142   2e-38   Cucumis sativus [cucumbers]
gb|ABF60002.1|  lipoxygenase 2                                          149   3e-38   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    149   3e-38   Nicotiana sylvestris
gb|KGN60920.1|  hypothetical protein Csa_2G023870                       139   3e-38   Cucumis sativus [cucumbers]
ref|XP_006355846.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    148   4e-38   
ref|XP_009625817.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    149   4e-38   
emb|CDP20620.1|  unnamed protein product                                149   4e-38   Coffea canephora [robusta coffee]
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                        149   4e-38   Solanum lycopersicum
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                        149   4e-38   Solanum tuberosum [potatoes]
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    149   5e-38   Solanum tuberosum [potatoes]
emb|CAA58859.1|  lipoxygenase                                           148   7e-38   Nicotiana tabacum [American tobacco]
ref|NP_001275351.1|  5-lipoxygenase                                     148   7e-38   Solanum tuberosum [potatoes]
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    148   7e-38   Nicotiana tomentosiformis
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    148   8e-38   Solanum tuberosum [potatoes]
gb|ADN92993.2|  lipoxygenase LOX1                                       148   9e-38   Ipomoea nil [qian niu]
gb|KJB80991.1|  hypothetical protein B456_013G124500                    147   1e-37   Gossypium raimondii
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    148   1e-37   Solanum tuberosum [potatoes]
ref|XP_004150981.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    142   2e-37   
gb|AAM28283.1|  lipoxygenase III                                        138   2e-37   Ananas comosus
emb|CDP20618.1|  unnamed protein product                                147   2e-37   Coffea canephora [robusta coffee]
ref|XP_010041703.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    139   2e-37   Eucalyptus grandis [rose gum]
ref|XP_009779646.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    147   2e-37   Nicotiana sylvestris
ref|XP_009779645.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    147   2e-37   Nicotiana sylvestris
gb|AAP82016.1|  putative lipoxygenase                                   137   2e-37   Brassica oleracea var. capitata
ref|XP_008245951.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    144   3e-37   Prunus mume [ume]
gb|KJB80990.1|  hypothetical protein B456_013G124500                    147   3e-37   Gossypium raimondii
ref|XP_007030817.1|  Lipoxygenase 1                                     147   3e-37   
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    147   3e-37   Sesamum indicum [beniseed]
gb|KJB80989.1|  hypothetical protein B456_013G124500                    146   3e-37   Gossypium raimondii
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase                146   3e-37   Gossypium hirsutum [American cotton]
gb|ACG56281.1|  lipoxygenase                                            146   4e-37   Olea europaea
gb|KGN60923.1|  Lipoxygenase                                            135   5e-37   Cucumis sativus [cucumbers]
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5               145   6e-37   
gb|AGK82779.1|  lipoxygenase                                            146   6e-37   Malus domestica [apple tree]
ref|XP_009365899.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    142   7e-37   Pyrus x bretschneideri [bai li]
ref|XP_010094672.1|  putative linoleate 9S-lipoxygenase 5               145   8e-37   
ref|XP_004170689.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    141   9e-37   
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g             145   1e-36   Phaseolus vulgaris [French bean]
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    145   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_009365971.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    142   1e-36   
ref|XP_006838252.1|  hypothetical protein AMTR_s00103p00053060          138   2e-36   
gb|AAZ04411.1|  lipoxygenase                                            144   2e-36   Cynanchum gracillimum
ref|XP_008465603.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    140   2e-36   
ref|XP_010468375.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    137   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002319014.2|  lipoxygenase family protein                        144   2e-36   
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    144   2e-36   Populus euphratica
emb|CDP15504.1|  unnamed protein product                                144   2e-36   Coffea canephora [robusta coffee]
ref|XP_007034722.1|  PLAT/LH2 domain-containing lipoxygenase fami...    141   2e-36   
ref|XP_009621679.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    144   2e-36   Nicotiana tomentosiformis
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg             144   3e-36   Prunus persica
gb|AGI37654.1|  lipoxygenase                                            144   3e-36   Cucumis sativus [cucumbers]
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    144   3e-36   Eucalyptus grandis [rose gum]
gb|EPS72460.1|  lipoxygenase                                            139   3e-36   Genlisea aurea
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    144   3e-36   
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    143   4e-36   Fragaria vesca subsp. vesca
gb|AEZ50135.1|  lipoxygenase                                            140   4e-36   Diospyros kaki [Japanese persimmon]
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                        143   4e-36   Morus notabilis
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    143   5e-36   Nelumbo nucifera [Indian lotus]
gb|KGN60922.1|  hypothetical protein Csa_2G023890                       133   6e-36   Cucumis sativus [cucumbers]
gb|AAO12866.1|  lipoxygenase                                            137   7e-36   Vitis vinifera
gb|KCW61801.1|  hypothetical protein EUGRSUZ_H044981                    142   8e-36   Eucalyptus grandis [rose gum]
ref|XP_007034721.1|  PLAT/LH2 domain-containing lipoxygenase fami...    141   9e-36   
gb|KGN60916.1|  hypothetical protein Csa_2G023340                       139   1e-35   Cucumis sativus [cucumbers]
gb|KHN20224.1|  Putative linoleate 9S-lipoxygenase 5                    132   1e-35   Glycine soja [wild soybean]
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...    142   1e-35   Glycine max [soybeans]
gb|AAD09861.1|  lipoxygenase                                            142   1e-35   Persea americana
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                    142   1e-35   Glycine soja [wild soybean]
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    142   1e-35   Eucalyptus grandis [rose gum]
gb|KGN60936.1|  hypothetical protein Csa_2G028480                       132   1e-35   Cucumis sativus [cucumbers]
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    142   1e-35   Populus euphratica
gb|AAP83135.1|  lipoxygenase                                            142   1e-35   Nicotiana attenuata
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g             142   1e-35   Phaseolus vulgaris [French bean]
gb|AAP83134.1|  lipoxygenase                                            142   1e-35   Nicotiana attenuata
emb|CAB94852.1|  lipoxygenase                                           142   1e-35   Prunus dulcis [sweet almond]
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        142   1e-35   Phoenix dactylifera
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg             142   1e-35   
ref|XP_006344836.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    142   2e-35   Solanum tuberosum [potatoes]
emb|CBI36802.3|  unnamed protein product                                142   2e-35   Vitis vinifera
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5               142   2e-35   Malus domestica [apple tree]
gb|AGI16377.1|  lipoxygenase                                            141   2e-35   Malus domestica [apple tree]
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    141   2e-35   Nicotiana sylvestris
gb|AGI16379.1|  lipoxygenase                                            141   2e-35   Malus domestica [apple tree]
gb|AGK82798.1|  lipoxygenase                                            141   2e-35   Malus domestica [apple tree]
gb|AGI16380.1|  lipoxygenase                                            141   2e-35   Malus domestica [apple tree]
gb|AGI16382.1|  lipoxygenase                                            141   2e-35   Malus domestica [apple tree]
gb|ABW75772.2|  lipoxygenase                                            141   2e-35   Camellia sinensis [black tea]
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g             141   2e-35   
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    141   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...    141   2e-35   
gb|AAA74393.1|  lipoxygenase                                            141   2e-35   Solanum lycopersicum
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                        141   2e-35   
gb|AHX56187.1|  lipoxygenase                                            141   3e-35   Diospyros kaki [Japanese persimmon]
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    141   3e-35   Vitis vinifera
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g             141   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004156417.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    140   4e-35   
ref|XP_010094673.1|  putative linoleate 9S-lipoxygenase 5               140   4e-35   
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    140   4e-35   Cucumis sativus [cucumbers]
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    140   4e-35   Glycine max [soybeans]
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                    140   4e-35   Glycine soja [wild soybean]
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6             140   4e-35   Nicotiana sylvestris
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    140   4e-35   Phoenix dactylifera
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        140   4e-35   Cucumis melo [Oriental melon]
gb|AGI16378.1|  lipoxygenase                                            140   5e-35   Malus domestica [apple tree]
emb|CAD10779.2|  lipoxygenase                                           140   6e-35   Prunus dulcis [sweet almond]
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    140   6e-35   Sesamum indicum [beniseed]
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    140   6e-35   Sesamum indicum [beniseed]
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    140   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg                140   6e-35   Erythranthe guttata [common monkey flower]
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    140   6e-35   
gb|KHF98567.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              140   7e-35   Gossypium arboreum [tree cotton]
gb|KHF98566.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              140   7e-35   Gossypium arboreum [tree cotton]
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    140   7e-35   Cucumis melo [Oriental melon]
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg             140   7e-35   Eutrema salsugineum [saltwater cress]
ref|XP_002315780.1|  lipoxygenase family protein                        140   7e-35   
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    140   8e-35   Sesamum indicum [beniseed]
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    140   8e-35   Sesamum indicum [beniseed]
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg                140   8e-35   Erythranthe guttata [common monkey flower]
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    139   9e-35   Cucumis sativus [cucumbers]
ref|XP_004156418.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    139   9e-35   
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    139   1e-34   Cucumis sativus [cucumbers]
gb|AAA79186.1|  lipoxygenase                                            139   1e-34   Cucumis sativus [cucumbers]
ref|XP_004169780.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    139   1e-34   
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6             139   1e-34   Nicotiana tomentosiformis
gb|KJB28315.1|  hypothetical protein B456_005G041900                    139   1e-34   Gossypium raimondii
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    139   1e-34   
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1                 139   1e-34   
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    139   1e-34   Populus euphratica
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    139   1e-34   
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    139   1e-34   Populus euphratica
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    139   1e-34   
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        139   1e-34   Cucumis melo [Oriental melon]
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    139   1e-34   Elaeis guineensis
gb|KJB38138.1|  hypothetical protein B456_006G238200                    139   1e-34   Gossypium raimondii
gb|ACU81176.1|  13S-lipoxygenase                                        139   1e-34   Cucumis melo var. inodorus [casaba melon]
gb|KJB38137.1|  hypothetical protein B456_006G238200                    139   2e-34   Gossypium raimondii
gb|KDP40158.1|  hypothetical protein JCGZ_02156                         139   2e-34   Jatropha curcas
ref|NP_001268178.1|  lipoxygenase                                       139   2e-34   Vitis vinifera
gb|AGU28274.1|  lipoxygenase 1                                          139   2e-34   Vitis vinifera
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g             139   2e-34   
ref|XP_007030814.1|  Lipoxygenase 1                                     138   2e-34   
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    139   2e-34   Eucalyptus grandis [rose gum]
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    138   2e-34   Elaeis guineensis
emb|CAP59449.1|  lipoxygenase                                           138   3e-34   Momordica charantia [balsam pear]
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    138   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    138   3e-34   
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    138   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009387658.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    137   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002512386.1|  lipoxygenase, putative                             137   5e-34   Ricinus communis
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                    137   5e-34   Arabis alpina [alpine rockcress]
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg             137   5e-34   
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    137   5e-34   Prunus mume [ume]
ref|XP_007030813.1|  Lipoxygenase 1                                     137   6e-34   
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...    137   6e-34   Gossypium arboreum [tree cotton]
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    137   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    137   7e-34   Brassica rapa
emb|CDY64191.1|  BnaA01g36630D                                          137   7e-34   Brassica napus [oilseed rape]
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        137   8e-34   Tarenaya hassleriana [spider flower]
emb|CDY46325.1|  BnaC01g31590D                                          137   8e-34   Brassica napus [oilseed rape]
ref|XP_009406046.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        137   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415714.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    137   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        137   1e-33   Tarenaya hassleriana [spider flower]
gb|KGN48009.1|  Lipoxygenase                                            134   1e-33   Cucumis sativus [cucumbers]
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like        136   1e-33   Solanum tuberosum [potatoes]
emb|CDY38326.1|  BnaC05g30190D                                          136   1e-33   Brassica napus [oilseed rape]
ref|XP_010277588.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    135   1e-33   
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                  136   2e-33   Medicago truncatula
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    136   2e-33   Brassica rapa
gb|ABB82552.1|  13S-lipoxygenase                                        135   2e-33   Cucumis melo var. inodorus [casaba melon]
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    135   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    135   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    135   3e-33   Eucalyptus grandis [rose gum]
ref|XP_002883361.1|  lipoxygenase                                       135   3e-33   
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    135   4e-33   Citrus sinensis [apfelsine]
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg             135   5e-33   Citrus clementina [clementine]
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                   135   5e-33   Citrus sinensis [apfelsine]
gb|ADL41189.1|  lipoxygenase                                            134   5e-33   Camellia sinensis [black tea]
gb|AHX56188.1|  lipoxygenase                                            135   5e-33   Diospyros kaki [Japanese persimmon]
ref|XP_004231274.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    134   5e-33   Solanum lycopersicum
ref|XP_004494612.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    134   6e-33   Cicer arietinum [garbanzo]
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    134   7e-33   Solanum tuberosum [potatoes]
gb|KDO74648.1|  hypothetical protein CISIN_1g002776mg                   134   7e-33   Citrus sinensis [apfelsine]
dbj|BAB01777.1|  lipoxygenase                                           134   7e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAC19365.1|  lipoxygenase                                           134   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188879.2|  lipoxygenase 5                                        134   7e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                   134   8e-33   Citrus sinensis [apfelsine]
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg             134   8e-33   Citrus clementina [clementine]
gb|KDP23508.1|  hypothetical protein JCGZ_23341                         134   9e-33   Jatropha curcas
ref|XP_003591120.1|  Lipoxygenase                                       134   9e-33   Medicago truncatula
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like          134   9e-33   Cucumis sativus [cucumbers]
ref|XP_009406047.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        134   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004296897.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    134   9e-33   Fragaria vesca subsp. vesca
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    134   9e-33   Nicotiana tomentosiformis
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    134   1e-32   Nicotiana tomentosiformis
gb|AHI86055.1|  lipoxygenase                                            134   1e-32   Cucumis melo var. makuwa
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    134   1e-32   Cucumis melo [Oriental melon]
gb|AGH13205.1|  lipoxygenase                                            134   1e-32   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    134   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004230207.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    134   1e-32   Solanum lycopersicum
ref|XP_002521992.1|  lipoxygenase, putative                             133   1e-32   Ricinus communis
ref|XP_007030811.1|  Lipoxygenase 1                                     133   2e-32   
gb|KJB80909.1|  hypothetical protein B456_013G121100                    127   2e-32   Gossypium raimondii
ref|XP_003626279.1|  Chalcone synthase                                  134   2e-32   
emb|CDY70916.1|  BnaCnng70330D                                          130   2e-32   Brassica napus [oilseed rape]
gb|KDP23726.1|  hypothetical protein JCGZ_23559                         133   2e-32   Jatropha curcas
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    132   3e-32   Solanum tuberosum [potatoes]
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g             132   3e-32   Phaseolus vulgaris [French bean]
gb|AGE44830.1|  lipoxygenase                                            124   3e-32   Zea mays [maize]
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    132   3e-32   Solanum tuberosum [potatoes]
ref|XP_006650442.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        132   3e-32   Oryza brachyantha
ref|XP_009387657.1|  PREDICTED: linoleate 9S-lipoxygenase A-like        132   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004156414.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    132   3e-32   
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    132   3e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|ABF98394.1|  Lipoxygenase 3, putative, expressed                     129   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002516771.1|  lipoxygenase, putative                             132   3e-32   
ref|XP_004139169.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    132   4e-32   
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    132   4e-32   Fragaria vesca subsp. vesca
emb|CAN62372.1|  hypothetical protein VITISV_036476                     127   4e-32   Vitis vinifera
gb|AAB20898.1|  lipoxygenase                                            130   4e-32   Glycine max [soybeans]
ref|XP_004139170.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    132   5e-32   
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    132   5e-32   
ref|XP_004156415.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        132   5e-32   
gb|AAC61785.1|  lipoxygenase 1                                          132   5e-32   Cucumis sativus [cucumbers]
emb|CAA63483.1|  lipoxygenase                                           132   5e-32   Cucumis sativus [cucumbers]
emb|CAE17327.1|  lipoxygenase                                           132   6e-32   Fragaria x ananassa
ref|XP_003597558.1|  Lipoxygenase                                       131   6e-32   Medicago truncatula
dbj|BAD02945.1|  9-lipoxigenase                                         131   6e-32   Oryza sativa Japonica Group [Japonica rice]
gb|ACE79245.1|  lipoxygenase-1                                          131   6e-32   Oryza sativa Indica Group [Indian rice]
gb|EAY91521.1|  hypothetical protein OsI_13155                          131   6e-32   Oryza sativa Indica Group [Indian rice]
gb|ABS72447.1|  lipoxygenase-1                                          131   6e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050990.1|  Os03g0699700                                       131   6e-32   
gb|ABX57825.1|  lipoxygenase-1                                          131   6e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    131   6e-32   Populus euphratica
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    131   7e-32   
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    131   7e-32   Cucumis melo [Oriental melon]
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg             131   7e-32   Eutrema salsugineum [saltwater cress]
ref|XP_006344625.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    131   7e-32   Solanum tuberosum [potatoes]
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    131   7e-32   Populus euphratica
ref|XP_006344624.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    131   7e-32   Solanum tuberosum [potatoes]
ref|XP_002311617.1|  lipoxygenase family protein                        131   8e-32   Populus trichocarpa [western balsam poplar]
gb|AHH24969.2|  lipoxygenase                                            131   8e-32   Eleusine coracana
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    131   8e-32   Populus euphratica
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5               131   8e-32   Malus domestica [apple tree]
gb|EAZ28259.1|  hypothetical protein OsJ_12231                          131   9e-32   Oryza sativa Japonica Group [Japonica rice]
gb|AGK82783.1|  lipoxygenase                                            131   9e-32   Malus domestica [apple tree]
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g             131   1e-31   Populus trichocarpa [western balsam poplar]
gb|AGK82776.1|  lipoxygenase                                            131   1e-31   Malus domestica [apple tree]
ref|XP_010025191.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    131   1e-31   
gb|AGK82774.1|  lipoxygenase                                            131   1e-31   Malus domestica [apple tree]
gb|AGK82775.1|  lipoxygenase                                            131   1e-31   Malus domestica [apple tree]
ref|XP_007150486.1|  hypothetical protein PHAVU_005G156700g             131   1e-31   Phaseolus vulgaris [French bean]
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    131   1e-31   Pisum sativum [garden pea]
gb|AGE44756.1|  lipoxygenase                                            124   1e-31   Zea mays [maize]
dbj|BAJ97592.1|  predicted protein                                      130   1e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGE44706.1|  lipoxygenase                                            124   1e-31   Zea mays [maize]
ref|XP_003560916.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    130   1e-31   Brachypodium distachyon [annual false brome]
gb|AGE44855.1|  lipoxygenase                                            124   1e-31   Zea mays [maize]
gb|AGE44684.1|  lipoxygenase                                            124   1e-31   
gb|AGE44857.1|  lipoxygenase                                            124   1e-31   
gb|AGE44869.1|  lipoxygenase                                            124   1e-31   
gb|AGE44648.1|  lipoxygenase                                            124   1e-31   
gb|AGE44646.1|  lipoxygenase                                            124   1e-31   
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1                 130   1e-31   
gb|AGE44649.1|  lipoxygenase                                            124   2e-31   
gb|AGE44884.1|  lipoxygenase                                            124   2e-31   
gb|AGE44882.1|  lipoxygenase                                            124   2e-31   
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3                 130   2e-31   
gb|ABV32552.1|  lipoxygenase                                            130   2e-31   
gb|AGE44874.1|  lipoxygenase                                            124   2e-31   
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2                 130   2e-31   
emb|CDO99039.1|  unnamed protein product                                130   2e-31   
ref|XP_006589595.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    127   2e-31   
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1             130   2e-31   
gb|AAO03558.1|  lipoxygenase 1                                          130   2e-31   
gb|AAB60715.1|  lipoxygenase                                            130   2e-31   
gb|AGE45032.1|  lipoxygenase                                            124   2e-31   
gb|AGE44972.1|  lipoxygenase                                            124   2e-31   
gb|AGE44911.1|  lipoxygenase                                            124   2e-31   
gb|AGE44907.1|  lipoxygenase                                            124   2e-31   
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        130   2e-31   
gb|AGE44940.1|  lipoxygenase                                            124   2e-31   
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    130   2e-31   
ref|XP_004169568.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    130   2e-31   
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        130   2e-31   
dbj|BAJ97226.1|  predicted protein                                      130   2e-31   
gb|AGE44906.1|  lipoxygenase                                            124   2e-31   
gb|KHN39333.1|  Seed linoleate 9S-lipoxygenase-2                        129   2e-31   
gb|KHN30072.1|  Seed linoleate 9S-lipoxygenase-2                        130   2e-31   
gb|AGE44909.1|  lipoxygenase                                            124   2e-31   
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    130   2e-31   
gb|ABX60407.1|  lipoxygease L-2                                         130   3e-31   
ref|NP_001237685.1|  seed linoleate 9S-lipoxygenase-2                   130   3e-31   
emb|CDY43490.1|  BnaA01g21450D                                          130   3e-31   
sp|P24095.1|LOXX_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    130   3e-31   
gb|AGE44758.1|  lipoxygenase                                            123   3e-31   
gb|KHN01372.1|  Linoleate 9S-lipoxygenase 1                             124   3e-31   
pdb|2IUK|A  Chain A, Crystal Structure Of Soybean Lipoxygenase-D        129   3e-31   
gb|ADG03092.1|  lipoxygenase 2                                          129   3e-31   
ref|NP_001238676.1|  seed linoleate 9S-lipoxygenase                     129   3e-31   
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    130   3e-31   
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    129   3e-31   
gb|AFK32352.1|  lipoxygenase-2                                          129   3e-31   
gb|ADG03091.1|  lipoxygenase 2                                          129   3e-31   
gb|AAM28285.1|  lipoxygenase I                                          125   3e-31   
gb|AEW08113.1|  hypothetical protein 1_5675_01                          120   3e-31   
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                    129   3e-31   
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                    129   3e-31   
gb|ABZ05753.1|  lipoxygenase                                            128   3e-31   
ref|NP_001050995.2|  Os03g0700700                                       129   3e-31   
gb|ACH91370.1|  lipoxygenase LOX-3                                      129   4e-31   
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                        129   4e-31   
gb|ADG03095.1|  lipoxygenase 3                                          129   4e-31   
gb|ABX60408.1|  lipoxygenase L-3                                        129   4e-31   
emb|CAA31664.1|  unnamed protein product                                129   4e-31   
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...    129   4e-31   
prf||1502333A  lipoxygenase 3                                           129   4e-31
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    129   4e-31   
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                   129   4e-31   
gb|AGE45022.1|  lipoxygenase                                            124   4e-31   
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    129   4e-31   
ref|XP_004495725.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    129   4e-31   
gb|AGE44912.1|  lipoxygenase                                            124   4e-31   
gb|AGE44953.1|  lipoxygenase                                            124   5e-31   
gb|AGE44918.1|  lipoxygenase                                            124   5e-31   
ref|XP_004982080.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    129   5e-31   
gb|AGE44936.1|  lipoxygenase                                            124   5e-31   
gb|AGE44926.1|  lipoxygenase                                            123   5e-31   
gb|AGE44908.1|  lipoxygenase                                            123   5e-31   
gb|AGE45041.1|  lipoxygenase                                            123   5e-31   
gb|EAY91532.1|  hypothetical protein OsI_13165                          129   5e-31   
gb|AGE44915.1|  lipoxygenase                                            123   5e-31   
ref|XP_004982081.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    129   5e-31   
sp|Q53RB0.1|LOX4_ORYSJ  RecName: Full=Probable linoleate 9S-lipox...    129   5e-31   
gb|AGE44934.1|  lipoxygenase                                            123   5e-31   
gb|AGE45046.1|  lipoxygenase                                            123   5e-31   
gb|AIC82456.1|  lipoxygenase                                            129   6e-31   
gb|AFB33131.1|  hypothetical protein 1_5675_01                          120   6e-31   
gb|ACF79478.1|  unknown                                                 124   6e-31   
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg             129   6e-31   
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    129   7e-31   
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg             128   7e-31   
gb|AGE44843.1|  lipoxygenase                                            122   7e-31   
gb|AGE44916.1|  lipoxygenase                                            123   8e-31   
ref|XP_006650444.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    128   8e-31   
gb|AGE45067.1|  lipoxygenase                                            123   8e-31   
gb|AGE44864.1|  lipoxygenase                                            122   8e-31   
gb|AGE44881.1|  lipoxygenase                                            122   9e-31   
gb|ACF83061.1|  unknown                                                 126   9e-31   
gb|AGE44897.1|  lipoxygenase                                            122   9e-31   
gb|AGE45002.1|  lipoxygenase                                            122   1e-30   
gb|KJB67981.1|  hypothetical protein B456_010G220400                    122   1e-30   
gb|AGE44891.1|  lipoxygenase                                            122   1e-30   
gb|AGE45065.1|  lipoxygenase                                            122   1e-30   
ref|NP_175900.1|  lipoxygenase 1                                        128   1e-30   
ref|XP_007030815.1|  Lipoxygenase 1                                     128   1e-30   
gb|AAF60270.1|  lipoxygenase 1                                          127   1e-30   
gb|AEZ50136.1|  lipoxygenase                                            128   1e-30   
gb|AGE45011.1|  lipoxygenase                                            122   1e-30   
ref|XP_006650559.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        127   1e-30   
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    127   2e-30   
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...    127   2e-30   
ref|XP_007150487.1|  hypothetical protein PHAVU_005G1568001g            125   2e-30   
gb|AAY87057.1|  13-lipoxygenase                                         127   2e-30   
gb|AAY87056.1|  13-lipoxygenase                                         127   2e-30   
ref|XP_008340970.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    127   2e-30   
gb|AAD09202.1|  lipoxygenase                                            127   2e-30   
ref|XP_007135504.1|  hypothetical protein PHAVU_010G134700g             127   2e-30   
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg             127   2e-30   
gb|AGE44910.1|  lipoxygenase                                            122   2e-30   
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    127   2e-30   
ref|XP_008246452.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    127   2e-30   
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    127   2e-30   
gb|KHN39331.1|  Seed linoleate 9S-lipoxygenase                          127   2e-30   
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        127   2e-30   
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    127   2e-30   
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        127   2e-30   
emb|CAA45738.1|  lipoxygenase                                           127   3e-30   
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    127   3e-30   
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              127   3e-30   
ref|NP_001235189.1|  lipoxygenase                                       127   3e-30   
ref|NP_001051212.1|  Os03g0738600                                       127   3e-30   
ref|XP_002278007.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    127   3e-30   
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776             127   3e-30   
gb|EAY91797.1|  hypothetical protein OsI_13441                          127   3e-30   
gb|ABD47523.1|  dual positional specificity lipoxygenase                127   3e-30   
gb|KHN11254.1|  Seed linoleate 9S-lipoxygenase                          127   3e-30   
gb|ADZ31265.1|  lipoxygenase 3                                          127   3e-30   
gb|AGE44783.1|  lipoxygenase                                            120   3e-30   
ref|XP_003597559.1|  Seed lipoxygenase-3                                126   4e-30   
ref|XP_003531597.1|  PREDICTED: seed linoleate 9S-lipoxygenase-li...    126   4e-30   
pdb|1FGO|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495a Mutant     126   4e-30   
gb|AFW67906.1|  hypothetical protein ZEAMMB73_739462                    124   4e-30   
pdb|1FGT|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697n Mutant     126   4e-30   
ref|NP_001236153.1|  seed linoleate 13S-lipoxygenase-1                  126   4e-30   
pdb|3BNE|A  Chain A, Lipoxygenase-1 (Soybean) I553a Mutant              126   4e-30   
gb|ADG03093.1|  lipoxygenase 1                                          126   4e-30   
pdb|3BND|A  Chain A, Lipoxygenase-1 (Soybean), I553v Mutant             126   4e-30   
pdb|1Y4K|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694g Mutant     126   4e-30   
pdb|1FGM|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694h Mutant     126   4e-30   
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    126   4e-30   
pdb|1FGR|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697e Mutant     126   4e-30   
pdb|1FGQ|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495e Mutant     126   4e-30   
pdb|3BNC|A  Chain A, Lipoxygenase-1 (Soybean) I553g Mutant              126   4e-30   
pdb|3PZW|A  Chain A, Soybean Lipoxygenase-1 - Re-Refinement             126   5e-30   
pdb|3BNB|A  Chain A, Lipoxygenase-1 (Soybean) I553l Mutant              126   5e-30   
gb|ACN26318.1|  unknown                                                 123   5e-30   
ref|XP_004486858.1|  PREDICTED: seed linoleate 9S-lipoxygenase-2-...    126   6e-30   
ref|XP_002458905.1|  hypothetical protein SORBIDRAFT_03g042440          126   6e-30   
ref|XP_003559938.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        126   6e-30   
ref|XP_007208174.1|  hypothetical protein PRUPE_ppa001016mg             126   6e-30   
ref|XP_008246454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    126   6e-30   
gb|EMT25349.1|  Lipoxygenase 2                                          126   6e-30   
ref|XP_007135512.1|  hypothetical protein PHAVU_010G135500g             125   6e-30   
gb|AGV54475.1|  lipoxygenase                                            125   7e-30   
gb|KHN39332.1|  Seed linoleate 9S-lipoxygenase                          125   7e-30   
gb|EPS66868.1|  lipoxygenase                                            120   8e-30   
gb|AGE45079.1|  lipoxygenase                                            120   8e-30   
emb|CAA55318.1|  lipoxygenase                                           125   9e-30   
sp|P14856.1|LOX2_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    125   9e-30   
ref|XP_007135506.1|  hypothetical protein PHAVU_010G134900g             125   9e-30   
ref|XP_006606941.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    119   9e-30   
gb|AFB33130.1|  hypothetical protein 1_5675_01                          117   1e-29   
ref|XP_003559944.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        125   1e-29   
dbj|BAJ91632.1|  predicted protein                                      125   1e-29   
gb|ABF19103.2|  9-lipoxygenase                                          125   1e-29   
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    125   1e-29   
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3        125   1e-29   
gb|KHN11251.1|  Seed linoleate 9S-lipoxygenase-2                        125   2e-29   
gb|EMS64854.1|  Putative lipoxygenase 3                                 124   2e-29   
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1             125   2e-29   
gb|AAB70865.1|  lipoxygenase 2                                          125   2e-29   
dbj|BAJ87153.1|  predicted protein                                      124   2e-29   
ref|XP_008454442.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    124   2e-29   
gb|AFK44000.1|  unknown                                                 117   2e-29   
ref|XP_004970878.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        124   2e-29   
gb|AAP04432.1|  lipoxygenase 1 protein                                  121   2e-29   
pdb|4WHA|A  Chain A, Lipoxygenase-1 (soybean) L546a/l754a Mutant        124   2e-29   
gb|AET01657.2|  seed linoleate 9S-lipoxygenase                          124   2e-29   
gb|EMT18292.1|  Putative lipoxygenase 3                                 124   2e-29   
gb|AAG42354.1|  lipoxygenase                                            124   2e-29   
ref|XP_006359922.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    124   2e-29   
ref|XP_003627181.1|  Lipoxygenase                                       124   2e-29   
gb|KHN11255.1|  Linoleate 9S-lipoxygenase                               124   3e-29   
gb|KFK39529.1|  hypothetical protein AALP_AA3G256200                    124   3e-29   
gb|KHN37773.1|  Linoleate 9S-lipoxygenase-4                             116   3e-29   
gb|EAZ28267.1|  hypothetical protein OsJ_12238                          124   3e-29   
dbj|BAH57745.1|  lipoxygenase                                           124   3e-29   
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g             124   3e-29   
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    124   3e-29   
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              124   3e-29   
gb|ACS34908.1|  lipoxygenase 2                                          124   3e-29   
ref|XP_002466613.1|  hypothetical protein SORBIDRAFT_01g011040          124   3e-29   
gb|ADR71860.1|  lipoxygenase-1                                          120   3e-29   
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    123   4e-29   
ref|XP_003592410.1|  Lipoxygenase                                       123   5e-29   
ref|XP_007135505.1|  hypothetical protein PHAVU_010G134800g             123   5e-29   
gb|ACN29156.1|  unknown                                                 123   5e-29   
gb|ACR36074.1|  unknown                                                 122   5e-29   
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g             123   5e-29   
ref|NP_001050993.1|  Os03g0700400                                       123   5e-29   
sp|P09439.1|LOX2_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    123   5e-29   
ref|XP_007135515.1|  hypothetical protein PHAVU_010G135800g             123   5e-29   
ref|XP_006850112.1|  hypothetical protein AMTR_s00022p00225940          118   5e-29   
ref|NP_001105974.1|  lipoxygenase                                       123   5e-29   
sp|P27480.1|LOXA_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    123   6e-29   
gb|AJD18612.1|  lipoxygenase                                            120   6e-29   
gb|EMS61461.1|  Lipoxygenase 2                                          123   6e-29   
gb|AAV50006.1|  lipoxygenase                                            116   6e-29   
ref|XP_006599243.1|  PREDICTED: linoleate 9S-lipoxygenase-4-like        115   6e-29   
ref|XP_003528382.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like ...    123   6e-29   
gb|KHN05134.1|  Linoleate 9S-lipoxygenase-4                             113   7e-29   
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg             123   7e-29   
gb|AFH89626.1|  lipoxygenase                                            120   7e-29   
gb|KHN28545.1|  Linoleate 9S-lipoxygenase-4                             117   7e-29   
ref|XP_004247367.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    122   8e-29   
gb|EYU41500.1|  hypothetical protein MIMGU_mgv1a001165mg                123   8e-29   
gb|ACL53637.1|  unknown                                                 122   1e-28   
ref|NP_001105975.1|  lipoxygenase                                       122   1e-28   



>emb|CAA64415.1| lipoxygenase (LOX) [Solanum lycopersicum]
Length=246

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GISLIE+LSRHASD +YLGQR+ PEWTKD+E L AFERFGK L  IE+RI++MNGD 
Sbjct  151  TLVGISLIELLSRHASDTLYLGQRDSPEWTKDQEPLSAFERFGKKLGEIEDRIIQMNGDN  210

Query  192  -KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             K KNR+GPV VPYT LFPT EEGL+GKGIPNS+SI
Sbjct  211  QKWKNRSGPVKVPYTFLFPTSEEGLTGKGIPNSVSI  246



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRHASDEIYLGQR+  EWTKD+E + AFERFGK L  IE++I++MNGD 
Sbjct  768  TLLGISLIEILSRHASDEIYLGQRDSSEWTKDQEPIAAFERFGKKLSEIEDQIIQMNGDK  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR+GPVNVPYTLLFPT E+GL+GKGIPNS+SI
Sbjct  828  KWKNRSGPVNVPYTLLFPTSEQGLTGKGIPNSVSI  862



>gb|KGN60927.1| Lipoxygenase [Cucumis sativus]
Length=124

 Score =   145 bits (366),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR+  +WT DK+A+E FE+FGK +  +E RI++ N DG
Sbjct  30   TLLGVSLIEILSRHASDEVYLGQRDSIKWTSDKDAIERFEKFGKDMYDVESRIIERNKDG  89

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  90   NLKNRSGPVNVPYTLLLPSSTEGLTGRGIPNSISI  124



>gb|AGN75068.1| lipoxygenase 2 [Momordica charantia]
Length=845

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH+SDE+YLGQR+ PEWT DKE LEAFE+FGK L  IE+ I+K NGD 
Sbjct  751  TLLGVSLIEILSRHSSDEVYLGQRDSPEWTTDKEPLEAFEKFGKKLAEIEDGIIKRNGDL  810

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPV VPYTLL+PTGEEGLSGKGIPNS+SI
Sbjct  811  RLKNRVGPVVVPYTLLYPTGEEGLSGKGIPNSVSI  845



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRHASDEIYLGQR+  EWTKD+E++ AFERFGK L  IE++I++MNGD 
Sbjct  767  TLLGISLIEILSRHASDEIYLGQRDSSEWTKDQESIAAFERFGKKLSEIEDQIIQMNGDE  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR+GPV VPYTLLFPT E+GL+GKGIPNS+SI
Sbjct  827  QWKNRSGPVKVPYTLLFPTSEQGLTGKGIPNSVSI  861



>gb|KGN60934.1| hypothetical protein Csa_2G028460 [Cucumis sativus]
Length=124

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR   EWT DK ALE FE FGK +  +E RI++ N D 
Sbjct  30   TLLGVSLIEILSRHASDEVYLGQRASIEWTSDKAALEVFENFGKQVFEVESRIIERNKDV  89

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  90   NLKNRNGPVNVPYTLLLPSSTEGLTGRGIPNSISI  124



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SD +YLGQRE PEWTKD+E L AFERFGK L  IE++I++MNGD 
Sbjct  768  TLLGISLIEILSRHSSDTLYLGQRESPEWTKDQEPLSAFERFGKKLSDIEDQIMEMNGDE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR+GPV VPYTLLFPT E GL+GKGIPNS+SI
Sbjct  828  KWKNRSGPVKVPYTLLFPTSEGGLTGKGIPNSVSI  862



>gb|KGN60931.1| hypothetical protein Csa_2G027440 [Cucumis sativus]
Length=129

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR   EWT DK A+E FE FGK +  +E RI++ N D 
Sbjct  35   TLLGVSLIEILSRHASDEVYLGQRASIEWTSDKAAVEVFENFGKKVFEVESRIIERNKDV  94

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  95   NLKNRSGPVNVPYTLLLPSSTEGLTGRGIPNSISI  129



>gb|AFU51542.1| lipoxygenase 3 [Capsicum annuum]
Length=859

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH SDEIYLGQRE PEWTKDKE L AF+RFGK L  IE  I++ NGD 
Sbjct  765  TLLGVSLIEILSRHTSDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTEIENHIIQRNGDQ  824

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  825  ILKNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  859



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH SDE+YLGQR+  EWTKD+E L AFERFGK L  IE++I++MNGD 
Sbjct  767  TLLGISLIEILSRHTSDEVYLGQRDSSEWTKDQEPLAAFERFGKKLSEIEDQIVQMNGDE  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              KNR+GPV VPYTLLFPT EEGL+GKGIPNS+SI
Sbjct  827  NWKNRSGPVKVPYTLLFPTSEEGLTGKGIPNSVSI  861



>gb|ABF60001.1| lipoxygenase 5 [Actinidia deliciosa]
Length=450

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+ PEWT D E L+AF RFG  L  +EE+I+ MN D 
Sbjct  356  TLLGISLIEILSRHSSDEVYLGQRDTPEWTTDAEPLKAFARFGNKLDEVEEKIIDMNNDK  415

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPVNVPYTLLFPT E GL+GKGIPNS+SI
Sbjct  416  ELKNRVGPVNVPYTLLFPTSEGGLTGKGIPNSVSI  450



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 84/96 (88%), Gaps = 1/96 (1%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GISLIE+LSRHASD +YLGQR+ PEWTKD+E L AFERFGK L  IE+RI++MNGD 
Sbjct  767  TLVGISLIELLSRHASDTLYLGQRDSPEWTKDQEPLSAFERFGKKLGEIEDRIIQMNGDN  826

Query  192  -KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             K KNR+GPV VPYTLLFPT EEGL+GKGIPNS+SI
Sbjct  827  QKWKNRSGPVKVPYTLLFPTSEEGLTGKGIPNSVSI  862



>emb|CAA64769.1| lipoxygenase [Solanum tuberosum]
Length=697

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SL+EILSRH +DEIYLGQRE PEWTKDKE L AF+RFGK L  IE++I++ NGD 
Sbjct  603  TLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDN  662

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  663  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  697



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=860

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T++G+SLIEILSRHASDE+YLGQR+ P WT D + LEAFERFGK L  IE+ I+ MN DG
Sbjct  766  TVIGVSLIEILSRHASDEVYLGQRDTPGWTSDTKVLEAFERFGKRLAEIEDSIICMNNDG  825

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV +PYTLL+PTGE GLSGKGIPNSISI
Sbjct  826  KLKNRVGPVKMPYTLLYPTGEAGLSGKGIPNSISI  860



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRHASD +YLGQR+ PEWTKD+E L AFERFG+ L  IE +IL+MNGD 
Sbjct  767  TLLGISLIEILSRHASDTLYLGQRDSPEWTKDQEPLSAFERFGQKLSDIEAQILQMNGDH  826

Query  192  -KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             K KNR+GPV VPYTLLFPT EEGL+GKGIPNS+SI
Sbjct  827  EKWKNRSGPVKVPYTLLFPTSEEGLTGKGIPNSVSI  862



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SD +YLGQRE PEWTKD+E L AF RFGK L  IE++I++MNGD 
Sbjct  768  TLLGISLIEILSRHSSDTLYLGQRESPEWTKDQEPLSAFGRFGKKLSDIEDQIMQMNGDE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR+GPV VPYTLLFPT E GL+GKGIPNS+SI
Sbjct  828  KWKNRSGPVKVPYTLLFPTSEGGLTGKGIPNSVSI  862



>emb|CAA64765.1| lipoxygenase [Solanum tuberosum]
Length=844

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SL+EILSRH +DEIYLGQRE PEWTKDKE L AF+RFGK L  IE++I++ NGD 
Sbjct  750  TLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDN  809

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  810  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  844



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILS H+SDE+YLGQR+ PEWT D EALEAFERFG+ L  IE+RI+KMN D 
Sbjct  779  TLLGVSLIEILSTHSSDEVYLGQRDTPEWTLDAEALEAFERFGQKLAGIEDRIIKMNNDK  838

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR GPV VPYTLL+PT E G++GKGIPNS+SI
Sbjct  839  KWKNRVGPVKVPYTLLYPTSEGGITGKGIPNSVSI  873



>sp|O22508.1|LOX18_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 8 [Solanum tuberosum]
 gb|AAB81595.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SL+EILSRH +DEIYLGQRE PEWTKDKE L AF+RFGK L  IE++I++ NGD 
Sbjct  767  TLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDN  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  827  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  861



>sp|O22507.1|LOX17_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 7 [Solanum tuberosum]
 gb|AAB81594.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SL+EILSRH +DEIYLGQRE PEWTKDKE L AF+RFGK L  IE++I++ NGD 
Sbjct  767  TLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDN  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  827  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  861



>sp|P37831.1|LOX11_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=StLOX1 [Solanum tuberosum]
 emb|CAA55724.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SL+EILSRH +DEIYLGQRE PEWTKDKE L AF+RFGK L  IE++I++ NGD 
Sbjct  767  TLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDN  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  827  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  861



>ref|NP_001275169.1| probable linoleate 9S-lipoxygenase 8-like [Solanum tuberosum]
 emb|CAB65460.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SL+EILSRH +DEIYLGQRE PEWTKDKE L AF+RFGK L  IE++I++ NGD 
Sbjct  767  TLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDN  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  827  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  861



>sp|Q43189.1|LOX13_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 3 [Solanum tuberosum]
 gb|AAB67858.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SL+EILSRH +DEIYLGQRE PEWTKDKE L AF+RFGK L  IE++I++ NGD 
Sbjct  767  TLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDN  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  827  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  861



>gb|KGN60918.1| hypothetical protein Csa_2G023850 [Cucumis sativus]
Length=223

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             L+G+S+IEILSRH+SDE+YLGQR +PEWT DKEALEAFE+FG+ L  IE++I   N D 
Sbjct  129  ALVGVSVIEILSRHSSDEVYLGQRSNPEWTLDKEALEAFEKFGEKLGEIEKKIAMRNKDP  188

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPV++PYTLLFPT  EGL+G+GIPNSISI
Sbjct  189  QLKNRVGPVDMPYTLLFPTSSEGLTGRGIPNSISI  223



>gb|ABF60002.1| lipoxygenase 2 [Actinidia deliciosa]
Length=865

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            L++LGISLIEILSRH +DE++LGQR+ PEWT DKEAL+AFERFG+ L  IE+RI +MN D
Sbjct  770  LSILGISLIEILSRHTADEVFLGQRDTPEWTTDKEALKAFERFGEKLTEIEDRITRMNND  829

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             KL+NRTGP  +PYTLLFPT E GL+GKGIPNS+SI
Sbjct  830  EKLRNRTGPAKMPYTLLFPTSEVGLTGKGIPNSVSI  865



>ref|XP_009774054.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=844

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GIS IEILS H+SDEIYLGQR+ PEWTKDKE L+A ERFGK L  IEE+I+KMN D 
Sbjct  750  TLIGISAIEILSIHSSDEIYLGQRDTPEWTKDKEPLQALERFGKKLAEIEEKIMKMNNDT  809

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV +PYTLL+PT E GL+GKGIPNS+SI
Sbjct  810  KLKNRIGPVKMPYTLLYPTSEPGLTGKGIPNSVSI  844



>gb|KGN60920.1| hypothetical protein Csa_2G023870 [Cucumis sativus]
Length=156

 Score =   139 bits (350),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISL+EILSRH+SDEIYLG+RE  EW  D+ ALEAFE+FGK L  IE  I+K N D 
Sbjct  62   TLLGISLVEILSRHSSDEIYLGKRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDP  121

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K+KNR GP+NVPYT L+PT  EGL+GKGIPNSISI
Sbjct  122  KMKNRVGPINVPYTSLYPTSNEGLTGKGIPNSISI  156



>ref|XP_006355846.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
8-like [Solanum tuberosum]
Length=737

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SL+EILSRH +DEIYLGQRE PEWTKDKE L AF++FGK L  IE++I++ NGD 
Sbjct  643  TLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDN  702

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  703  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  737



>ref|XP_009625817.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=844

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GIS IEILS H+SDEIYLGQR+ PEWTKDKE ++A ERFGK L  IEE+I+KMN D 
Sbjct  750  TLIGISAIEILSTHSSDEIYLGQRDTPEWTKDKEPIQALERFGKKLAEIEEKIIKMNNDK  809

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV +PYTLL+PT E GL+GKGIPNS+SI
Sbjct  810  KLKNRMGPVKMPYTLLYPTSEPGLTGKGIPNSVSI  844



>emb|CDP20620.1| unnamed protein product [Coffea canephora]
Length=772

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+S IEILSRH +DE+YLGQRE+P+WTKD E LEAF+RFG+ L  IE++IL+MNGD 
Sbjct  678  TLLGLSTIEILSRHTTDEVYLGQRENPQWTKDTEPLEAFKRFGQTLSEIEDQILQMNGDP  737

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K +NR GPVN+PYTLLFPT + G++G+GIPNSI+I
Sbjct  738  KWRNRVGPVNIPYTLLFPTSDSGITGRGIPNSIAI  772



>ref|NP_001234856.1| linoleate 9S-lipoxygenase A [Solanum lycopersicum]
 sp|P38415.1|LOXA_SOLLC RecName: Full=Linoleate 9S-lipoxygenase A; AltName: Full=Lipoxygenase 
A [Solanum lycopersicum]
 gb|AAA53184.1| lipoxygenase [Solanum lycopersicum]
Length=860

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH +DEIYLGQRE PEWTKDKE L AFERFG  L  IE++I++ NG+ 
Sbjct  766  TLLGVSLIEILSRHTTDEIYLGQRESPEWTKDKEPLAAFERFGNKLTDIEKQIMQRNGNN  825

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NRTGPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  826  ILTNRTGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  860



>ref|NP_001275357.1| linoleate 9S-lipoxygenase 2 [Solanum tuberosum]
 sp|O24379.1|LOX12_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 2; AltName: Full=Lipoxygenase 
1-2 [Solanum tuberosum]
 emb|CAA64766.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH +DEIYLGQRE PEWTKDKE L AF++FGK L  IE++I++ NGD 
Sbjct  767  TLLGVSLIEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDN  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  827  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  861



>sp|Q41238.1|LOX16_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 6; AltName: Full=Lipoxygenase 
1-5; Short=StLOX1; Short=lox1:St:3, partial [Solanum 
tuberosum]
 gb|AAB31252.1| linoleate:oxygen oxidoreductase, partial [Solanum tuberosum]
Length=857

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH +DEIYLGQRE PEWTKDKE L AF++FGK L  IE++I++ NGD 
Sbjct  763  TLLGVSLIEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDN  822

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  823  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  857



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SD +YLGQRE PEWTKD+E L AF RFGK L  IE++I++MN D 
Sbjct  768  TLLGISLIEILSRHSSDTLYLGQRESPEWTKDQEPLSAFARFGKKLSDIEDQIMQMNVDE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR+GPV VPYTLLFPT E GL+GKGIPNS+SI
Sbjct  828  KWKNRSGPVKVPYTLLFPTSEGGLTGKGIPNSVSI  862



>ref|NP_001275351.1| 5-lipoxygenase [Solanum tuberosum]
 gb|AAD04258.1| 5-lipoxygenase [Solanum tuberosum]
Length=864

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SL+EILSRH +DEIYLGQRE PEWTKDKE L AF++FGK L  IE++I++ NGD 
Sbjct  770  TLLGVSLVEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDN  829

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  830  ILTNRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  864



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SD +YLGQRE PEWTKD+E L AF RFGK L  IE++I++MN D 
Sbjct  768  TLLGISLIEILSRHSSDTLYLGQRESPEWTKDQEPLSAFARFGKKLSDIEDQIMQMNVDE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR+GPV VPYTLLFPT E GL+GKGIPNS+SI
Sbjct  828  KWKNRSGPVKVPYTLLFPTSEGGLTGKGIPNSVSI  862



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GISLIE+LSRH+SD +YLGQ + PEWTKD+E L AFERFGK L  IE+RI++MNGD 
Sbjct  767  TLVGISLIELLSRHSSDTLYLGQNDSPEWTKDQEPLSAFERFGKKLSDIEDRIMQMNGDP  826

Query  192  -KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             K KNR+GPV VPYTLLFPT EEGL+GKGIPNS+SI
Sbjct  827  EKWKNRSGPVKVPYTLLFPTSEEGLTGKGIPNSVSI  862



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLG+RE PEWT D+EAL+AF +FG+ L  IE  I +MN  G
Sbjct  763  TLLGVSLIEILSRHASDEVYLGKREFPEWTNDQEALDAFAQFGRNLSKIEVNIKRMNTVG  822

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNRTGPV VPYTLLFPT E GL+GKGIPNS+SI
Sbjct  823  KLKNRTGPVEVPYTLLFPTSEVGLTGKGIPNSVSI  857



>gb|KJB80991.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=693

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR  PEWT D+  L AF+ FGK L  IEERI++MN D 
Sbjct  599  TLLGISLIEILSRHSSDEVYLGQRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDE  658

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPVN+PYTLL+PT E GL+GKGIPNS+SI
Sbjct  659  QLKNRVGPVNMPYTLLYPTSEGGLTGKGIPNSVSI  693



>sp|Q43190.1|LOX14_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 4; AltName: 
Full=Root lipoxygenase [Solanum tuberosum]
 gb|AAB67860.1| lipoxygenase [Solanum tuberosum]
Length=860

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH +DEIYLGQRE PEWTKDKE L AF++FGK L  IE++I++ NGD 
Sbjct  766  TLLGVSLIEILSRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDN  825

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR+GPVN PYTLLFPT E GL+GKGIPNS+SI
Sbjct  826  ILINRSGPVNAPYTLLFPTSEGGLTGKGIPNSVSI  860



>ref|XP_004150981.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=303

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR   EWT DK ALE FE FGK +  +E RI++ N D 
Sbjct  209  TLLGVSLIEILSRHASDEVYLGQRASIEWTSDKAALEVFENFGKQVFEVESRIIERNKDV  268

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  269  NLKNRNGPVNVPYTLLLPSSTEGLTGRGIPNSISI  303



>gb|AAM28283.1| lipoxygenase III, partial [Ananas comosus]
Length=167

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIEILS H+SDE+YLGQR+ PEWT D+ AL+AFERF   L  IE  I+K NGD 
Sbjct  73   TILGVSLIEILSTHSSDEVYLGQRDTPEWTADQSALQAFERFKARLAQIEADIVKRNGDP  132

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTLL+PT   G++GKGIPNS+SI
Sbjct  133  SLKNRNGPVKMPYTLLYPTSTVGITGKGIPNSVSI  167



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+S IEILSRH +DE+YLGQRE+P+WTKD E LEAF+RFG+ L  IE++IL+MNGD 
Sbjct  763  TLLGLSTIEILSRHTTDEVYLGQRENPQWTKDTEPLEAFKRFGQTLSEIEDQILQMNGDP  822

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K +NR GP N+PYTLLFPT + G++G+GIPNSI+I
Sbjct  823  KWRNRVGPANIPYTLLFPTSDSGITGRGIPNSIAI  857



>ref|XP_010041703.1| PREDICTED: probable linoleate 9S-lipoxygenase 5, partial [Eucalyptus 
grandis]
Length=224

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLL ISL+EILS H++DE+YLGQR+ PEWT D E LEAFERFGK L  +EERI++MNGD 
Sbjct  130  TLLVISLMEILSMHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDK  189

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + +NR GPV VPY LL+PT E G + KGIPNS+SI
Sbjct  190  RWRNRVGPVEVPYMLLYPTSEGGATAKGIPNSVSI  224



>ref|XP_009779646.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=822

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GIS +E+LS H SDEIYLGQR+  EWTKDKEAL+AFERFGK L  IEE I KMN D 
Sbjct  728  TLIGISALEVLSTHTSDEIYLGQRDSAEWTKDKEALQAFERFGKKLAEIEENITKMNNDK  787

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNRTGPV +PYTLL+PT E GL+ KGIPNSISI
Sbjct  788  KWKNRTGPVKMPYTLLYPTSEPGLTAKGIPNSISI  822



>ref|XP_009779645.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=849

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GIS +E+LS H SDEIYLGQR+  EWTKDKEAL+AFERFGK L  IEE I KMN D 
Sbjct  755  TLIGISALEVLSTHTSDEIYLGQRDSAEWTKDKEALQAFERFGKKLAEIEENITKMNNDK  814

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNRTGPV +PYTLL+PT E GL+ KGIPNSISI
Sbjct  815  KWKNRTGPVKMPYTLLYPTSEPGLTAKGIPNSISI  849



>gb|AAP82016.1| putative lipoxygenase, partial [Brassica oleracea var. capitata]
Length=170

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D+E LEAF+RFGK L  IE  I++ N D 
Sbjct  71   TLLGISIIEILSMHSTDEIYLGQRDSPNWTADEEPLEAFKRFGKSLELIENNIIRRNNDK  130

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            K KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  131  KFKNRTGPVNIPYTLLYPNTTDYTRESGLTGKGIPNSVSI  170



>ref|XP_008245951.1| PREDICTED: probable linoleate 9S-lipoxygenase 5, partial [Prunus 
mume]
Length=504

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   LLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDGK  194
            +LGI+LIEILSRH++DE+YLGQR+ PEWT D E L+AF++FGK L  IE+RI  MN D K
Sbjct  411  VLGIALIEILSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGKKLAEIEDRITSMNNDEK  470

Query  195  LKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            LKNR GPV VPYTLLFPT E GL+G+GIPNS+SI
Sbjct  471  LKNRVGPVKVPYTLLFPTSEGGLTGRGIPNSVSI  504



>gb|KJB80990.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=860

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR  PEWT D+  L AF+ FGK L  IEERI++MN D 
Sbjct  766  TLLGISLIEILSRHSSDEVYLGQRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDE  825

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPVN+PYTLL+PT E GL+GKGIPNS+SI
Sbjct  826  QLKNRVGPVNMPYTLLYPTSEGGLTGKGIPNSVSI  860



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+ PEWT D   L AFE FGK L  IEERI++MN D 
Sbjct  772  TLLGISLIEILSRHSSDEVYLGQRDTPEWTSDATPLAAFEEFGKRLSGIEERIVEMNKDE  831

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPVN+PYTLL+PT E GL+GKGIPNS+SI
Sbjct  832  QLKNRVGPVNMPYTLLYPTSEGGLTGKGIPNSVSI  866



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GI+LIEILSRH+SDEIYLGQR+ PEWT D + LEAF++FGK L  IEE I+KMN DG
Sbjct  773  TLVGIALIEILSRHSSDEIYLGQRDTPEWTADAQVLEAFDKFGKKLGEIEEGIVKMNNDG  832

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR G V VPYTLL+PT E+GL+GKGIPNS+SI
Sbjct  833  KWKNRVGAVKVPYTLLYPTSEDGLTGKGIPNSVSI  867



>gb|KJB80989.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=865

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR  PEWT D+  L AF+ FGK L  IEERI++MN D 
Sbjct  771  TLLGISLIEILSRHSSDEVYLGQRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDE  830

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPVN+PYTLL+PT E GL+GKGIPNS+SI
Sbjct  831  QLKNRVGPVNMPYTLLYPTSEGGLTGKGIPNSVSI  865



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR  PEWT D+  L AF+ FGK L  IEERI++MN D 
Sbjct  771  TLLGISLIEILSRHSSDEVYLGQRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDE  830

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPVN+PYTLL+PT E GL+GKGIPNS+SI
Sbjct  831  QLKNRVGPVNMPYTLLYPTSEGGLTGKGIPNSVSI  865



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILS H+SDE+YLGQR+  EWTKD E LEAF+RFG  L  +EERI +MN D 
Sbjct  770  TLLGISLIEILSSHSSDEVYLGQRDALEWTKDVEPLEAFDRFGTKLREVEERIKQMNNDK  829

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K +NR GPVNVPYTLL+PT EEGL+GKGIPNS+SI
Sbjct  830  KWRNRVGPVNVPYTLLYPTSEEGLTGKGIPNSVSI  864



>gb|KGN60923.1| Lipoxygenase [Cucumis sativus]
Length=124

 Score =   135 bits (340),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLG+R   EWT +K+ALE  E FGK +  +E  I++ N D 
Sbjct  30   TLLGVSLIEILSRHASDELYLGERASTEWTSEKDALELCEYFGKAMSEVESNIIERNKDV  89

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNRTGPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  90   NLKNRTGPVNVPYTLLLPSSAEGLTGRGIPNSISI  124



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GIS+IE+LSRHASDE+YLGQR+ PEWT D   LEAFERFGK L  IE++I+ MN D 
Sbjct  788  TLIGISIIELLSRHASDEVYLGQRDTPEWTTDTNPLEAFERFGKKLGEIEDKIISMNNDE  847

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPV +PYTLLFPT E GL+GKGIPNS+SI
Sbjct  848  RLKNRVGPVKMPYTLLFPTSEGGLTGKGIPNSVSI  882



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH++DE+YLGQR+ PEWT D   LEAF++FGK L  IE+RI  MN D 
Sbjct  858  TLLGISLIEILSRHSTDEVYLGQRDTPEWTVDAAQLEAFDKFGKKLAEIEDRITSMNNDA  917

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV VPYTLLFPT   GL+GKGIPNS+SI
Sbjct  918  KLKNRVGPVKVPYTLLFPTSGGGLTGKGIPNSVSI  952



>ref|XP_009365899.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=424

 Score =   142 bits (358),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAFE+FGK L  IE+RI  MN D 
Sbjct  330  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDIAALEAFEKFGKKLAEIEDRITSMNNDD  389

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  390  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  424



>ref|XP_010094672.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56580.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=792

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            L++LGI+L+EILSRH+SDE+YLGQR+ PEWT D E LEAFERFGK L  IEE+I++MN D
Sbjct  697  LSVLGIALVEILSRHSSDEVYLGQRDTPEWTTDGEVLEAFERFGKKLREIEEKIVRMNKD  756

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             KLKNR GP  +PYTLL+P+ E GL+GKGIPNS+SI
Sbjct  757  EKLKNRVGPAKMPYTLLYPSSEGGLTGKGIPNSVSI  792



>ref|XP_004170689.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like, partial 
[Cucumis sativus]
Length=372

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR   EWT DK A+E FE FGK +  +E RI++ N D 
Sbjct  278  TLLGVSLIEILSRHASDEVYLGQRASIEWTSDKAAVEVFENFGKKVFEVESRIIERNKDV  337

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  338  NLKNRSGPVNVPYTLLLPSSTEGLTGRGIPNSISI  372



>ref|XP_007147045.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
 gb|ESW19039.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
Length=863

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+G+SLIEILS+H+SDE+YLGQR+ P WT D E LEAFERFGK L  IEERI+ MN DG
Sbjct  769  TLIGLSLIEILSKHSSDEVYLGQRDTPNWTSDVEPLEAFERFGKKLAQIEERIVTMNNDG  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR GPVN+PYTLL+P+ + GL+G GIPNS++I
Sbjct  829  KHKNRVGPVNMPYTLLYPSSKAGLTGMGIPNSVAI  863



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH++DE+YLGQR+ PEWT D   LEAF++FGK L  IEERI  MN D 
Sbjct  768  TLLGISLIEILSRHSTDEVYLGQRDTPEWTADAAPLEAFDKFGKKLEEIEERITSMNNDE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV VPYTLLFPT   GL+GKGIPNS+SI
Sbjct  828  KLKNRVGPVKVPYTLLFPTSGGGLTGKGIPNSVSI  862



>ref|XP_009365971.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=506

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAFE+FGK L  IE+RI  MN D 
Sbjct  412  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDIAALEAFEKFGKKLAEIEDRITSMNNDD  471

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  472  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  506



>ref|XP_006838252.1| hypothetical protein AMTR_s00103p00053060 [Amborella trichopoda]
 gb|ERN00821.1| hypothetical protein AMTR_s00103p00053060 [Amborella trichopoda]
Length=254

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 5/102 (5%)
 Frame = +3

Query  6    PLTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNG  185
            PLTLLG+SLIEILSRH+SDE+YLGQRE  EWT D +ALEAFERFGK L  IE++I+  N 
Sbjct  153  PLTLLGVSLIEILSRHSSDELYLGQRESSEWTADAQALEAFERFGKRLEEIEQQIMTRNS  212

Query  186  DGKLKNRTGPVNVPYTLLFPTGEE-----GLSGKGIPNSISI  296
            D + +NR GPV VPYTLL+P   +     GL+G+GIPNS+SI
Sbjct  213  DHQFRNRVGPVKVPYTLLYPGTSDIGTAGGLTGRGIPNSVSI  254



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR+ PEWTKD E L+AFE+FGK L  IE RI++MN D 
Sbjct  769  TLLGVSLIEILSRHASDEVYLGQRDTPEWTKDSEPLKAFEKFGKNLAEIEARIVQMNNDS  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GP   PYTLL+PT E GL+ KGIPNS+SI
Sbjct  829  EWKNRLGPAQFPYTLLYPTSEPGLTAKGIPNSVSI  863



>ref|XP_008465603.1| PREDICTED: probable linoleate 9S-lipoxygenase 5, partial [Cucumis 
melo]
Length=341

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR   EWT DK A+E FE FGK +  +E RI++ N D 
Sbjct  247  TLLGVSLIEILSRHASDEVYLGQRASIEWTSDKAAVELFEYFGKEVSEVESRIIERNKDV  306

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  307  NLKNRSGPVNVPYTLLLPSSSEGLTGRGIPNSISI  341



>ref|XP_010468375.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Camelina 
sativa]
Length=246

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IE LS+H++DE+YLGQRE P WT D EALEAF+RFGK L  IE  I++ N D 
Sbjct  147  TLLGISIIETLSQHSTDEVYLGQRESPNWTADDEALEAFKRFGKELELIENNIIRRNNDK  206

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  207  RFKNRTGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  246



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+ PEWT DKE LEAFE+FGK L  IE+R+  MN D 
Sbjct  742  TLLGISLIEILSRHSSDEVYLGQRDTPEWTADKEPLEAFEKFGKKLAVIEDRMFDMNKDV  801

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR G V VPYTLL PT E GL+G+GIPNS+SI
Sbjct  802  NLKNRVGSVKVPYTLLVPTSEGGLTGRGIPNSVSI  836



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+ PEWT DKE LEAFE+FGK L  IE+R+  MN D 
Sbjct  777  TLLGISLIEILSRHSSDEVYLGQRDTPEWTADKEPLEAFEKFGKKLAVIEDRMFDMNKDV  836

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR G V VPYTLL PT E GL+G+GIPNS+SI
Sbjct  837  NLKNRVGSVKVPYTLLVPTSEGGLTGRGIPNSVSI  871



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR+ PEWT D  ALEAF++FG  L  IE RI++ N D 
Sbjct  762  TLLGVSLIEILSRHASDEVYLGQRDTPEWTIDGNALEAFKKFGSKLAEIEGRIIQSNTDP  821

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K +NRTGPV +PYTLLFPTG+ GL+GKGIPNS+SI
Sbjct  822  KYRNRTGPVKLPYTLLFPTGDPGLTGKGIPNSVSI  856



>ref|XP_007034722.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
 ref|XP_007034723.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
 gb|EOY05648.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
 gb|EOY05649.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
Length=453

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIE+LSRH++DEIYLGQR+ PEWT D E L AFERFGK L+ IE RI+  N D 
Sbjct  354  TLLGVSLIEVLSRHSADEIYLGQRDSPEWTSDAEPLAAFERFGKKLIEIESRIMDRNNDS  413

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +LKNRTGPV +PYTLL+P     + E GL+GKGIPNSISI
Sbjct  414  RLKNRTGPVKMPYTLLYPNTSDYSREGGLTGKGIPNSISI  453



>ref|XP_009621679.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=822

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GIS +E+LS H SDEIYLGQR+  EWTKDKEAL AFERFGK L  IEE I KMN D 
Sbjct  728  TLIGISALEVLSTHTSDEIYLGQRDSAEWTKDKEALLAFERFGKKLAQIEENITKMNNDK  787

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K +NRTGPV +PYTLL+PT E GL+ KGIPNSISI
Sbjct  788  KWRNRTGPVKMPYTLLYPTSEPGLTAKGIPNSISI  822



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+LIEILSRH++DE+YLGQR+ PEWT D E L+AF++FG+ L  IE+RI +MN D 
Sbjct  768  TVLGIALIEILSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGRKLAEIEDRITRMNNDE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV +PYTLLFPT E GL+G+GIPNS+SI
Sbjct  828  KLKNRVGPVKMPYTLLFPTSEGGLTGRGIPNSVSI  862



>gb|AGI37654.1| lipoxygenase [Cucumis sativus]
Length=879

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR+  +WT DK+A+E FE+FGK +  +E RI++ N DG
Sbjct  785  TLLGVSLIEILSRHASDEVYLGQRDSIKWTSDKDAIERFEKFGKDMYDVESRIIERNKDG  844

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  845  NLKNRSGPVNVPYTLLLPSSTEGLTGRGIPNSISI  879



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILS H++DE+YLGQR+ PEWT D E LEAFERFGK L  +EERI++MNGD 
Sbjct  777  TLLGISLIEILSTHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDK  836

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + +NR GPV VPY LL+PT E G++ KGIPNS+SI
Sbjct  837  RWRNRVGPVEVPYMLLYPTSEGGVTAKGIPNSVSI  871



>gb|EPS72460.1| lipoxygenase, partial [Genlisea aurea]
Length=338

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            ++LGISLIEILSRH+SDE++LGQRE PEWT D EA+ AF RFGK L  IE++I +MN D 
Sbjct  244  SVLGISLIEILSRHSSDEVFLGQRESPEWTADSEAITAFGRFGKKLEDIEKKISEMNDDS  303

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV VPYTLL+P+ + GL+GKGIPNSISI
Sbjct  304  RWKNRYGPVKVPYTLLYPSSDVGLTGKGIPNSISI  338



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   LLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDGK  194
            +LGI+LIEILSRH++DE+YLGQR+ PEWT D E L+AF++FGK L  IE+RI  MN D K
Sbjct  854  VLGIALIEILSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGKKLAEIEDRITSMNNDEK  913

Query  195  LKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            LKNR GPV VPYTLLFPT E GL+G+GIPNS+SI
Sbjct  914  LKNRVGPVKVPYTLLFPTSEGGLTGRGIPNSVSI  947



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=863

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+LIEILSRH++DE+YLGQR+ P WT D EAL+AF RFGK L  IEE+I  MN D 
Sbjct  769  TVLGIALIEILSRHSTDEVYLGQRDTPNWTADAEALQAFNRFGKKLAEIEEKITNMNNDE  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR G V VPYTLL+PTGE G++GKGIPNS+SI
Sbjct  829  NLKNRVGKVEVPYTLLYPTGESGIAGKGIPNSVSI  863



>gb|AEZ50135.1| lipoxygenase, partial [Diospyros kaki]
Length=500

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGISLIE+LS H++DE+YLGQR+  EWT D E LEAF+RFGK L  IEE I+ MN D 
Sbjct  406  TVLGISLIEVLSAHSTDEVYLGQRDTAEWTTDIEPLEAFQRFGKKLGEIEENIIDMNNDE  465

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV VPYTLLFPT E G++GKGIPNS+SI
Sbjct  466  KLKNRVGPVKVPYTLLFPTSEGGVTGKGIPNSVSI  500



>ref|XP_010108010.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXC17575.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=884

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 82/100 (82%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             LLG+SLIEILSRH++DE+YLGQR+ PEWT D EA+EAFERFGK LV IEERIL+ N D 
Sbjct  785  ALLGVSLIEILSRHSTDEVYLGQRDTPEWTDDGEAIEAFERFGKRLVEIEERILERNRDE  844

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +L+NR GPV VPYTLLFP     T E GL+GKGIPNSISI
Sbjct  845  RLRNRVGPVKVPYTLLFPGTSDFTREGGLTGKGIPNSISI  884



>ref|XP_010256003.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256004.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256005.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
Length=874

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 80/100 (80%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH+SDE+YLGQRE PEWT D  ALEAFERFGK LV IE RI++MN D 
Sbjct  775  TLLGVSLIEILSRHSSDEVYLGQRESPEWTSDAAALEAFERFGKKLVEIENRIIEMNNDK  834

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNR GPV VPY LL+P     TG  GL+G+G+PNSISI
Sbjct  835  RWKNRVGPVKVPYMLLYPDTSNYTGVGGLTGRGVPNSISI  874



>gb|KGN60922.1| hypothetical protein Csa_2G023890 [Cucumis sativus]
Length=146

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             L+ IS+IEILS+HASDE+YLGQR   +WT DK ALEAFE+FGK L  +E RI++ N + 
Sbjct  52   ALVSISIIEILSKHASDEVYLGQRASIDWTSDKIALEAFEKFGKNLFEVENRIMERNKEV  111

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVN+PYTLL P+  EGL+G+GIPNSISI
Sbjct  112  NLKNRSGPVNLPYTLLVPSSNEGLTGRGIPNSISI  146



>gb|AAO12866.1| lipoxygenase [Vitis vinifera]
Length=289

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIE+LSRH+SDE++LGQR+ PEWT D   L+AFE+FG+ L  IEE I+  NG+ 
Sbjct  195  TLLGISLIEVLSRHSSDEVHLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNE  254

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+PT E GL+GKGIPNS+SI
Sbjct  255  RFKNRVGPVKIPYTLLYPTSEGGLTGKGIPNSVSI  289



>gb|KCW61801.1| hypothetical protein EUGRSUZ_H044981, partial [Eucalyptus grandis]
Length=795

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILS H++DE+YLGQR+ PEWT D E LEAFERFGK L  +EERI++MNGD 
Sbjct  701  TLLGISLIEILSSHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDK  760

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +  NR GPV VPY LL+PT E G++ KGIPNS+SI
Sbjct  761  RWMNRVGPVEVPYMLLYPTSEGGVTAKGIPNSVSI  795



>ref|XP_007034721.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
1 [Theobroma cacao]
 gb|EOY05647.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
1 [Theobroma cacao]
Length=677

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIE+LSRH++DEIYLGQR+ PEWT D E L AFERFGK L+ IE RI+  N D 
Sbjct  578  TLLGVSLIEVLSRHSADEIYLGQRDSPEWTSDAEPLAAFERFGKKLIEIESRIMDRNNDS  637

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +LKNRTGPV +PYTLL+P     + E GL+GKGIPNSISI
Sbjct  638  RLKNRTGPVKMPYTLLYPNTSDYSREGGLTGKGIPNSISI  677



>gb|KGN60916.1| hypothetical protein Csa_2G023340 [Cucumis sativus]
Length=485

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGI+ IEILSRH+SDE+YLGQR+ P+WT DKEAL+AFE+FGK L  IE+ I K N D 
Sbjct  391  TLLGIASIEILSRHSSDEVYLGQRDSPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDL  450

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L+NR GPV +PYTLL+P+ EEGL+GKGIPNS+SI
Sbjct  451  TLRNRVGPVFMPYTLLYPSSEEGLTGKGIPNSVSI  485



>gb|KHN20224.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=153

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            L +LGISL+EILS+H+SDE+YLGQR+ P+WT D E L+AFE+FGK L  IEERIL+MN D
Sbjct  53   LAVLGISLVEILSKHSSDEVYLGQRDTPDWTSDAEPLQAFEKFGKKLADIEERILRMNSD  112

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  284
             K +NR GPV +PYTLL+PT + GL+G G P 
Sbjct  113  EKFRNRYGPVKMPYTLLYPTSKGGLTGMGFPT  144



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GISLIEILSRH+SDE++LGQR+ P WT D E LEAF+ FGK LV IEERI+ +N DG
Sbjct  764  TLIGISLIEILSRHSSDELHLGQRDTPNWTCDVEPLEAFDEFGKKLVEIEERIMALNNDG  823

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR GPVN+PYTLLFP+ + GL+G GIPNS++I
Sbjct  824  KHKNRVGPVNMPYTLLFPSSKAGLTGMGIPNSVAI  858



>gb|AAD09861.1| lipoxygenase [Persea americana]
Length=858

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH+SDE+YLGQR  PEWT D  ALEAFE+FGK LV IE RI++MN D 
Sbjct  759  TLLGVSLIEILSRHSSDEVYLGQRSTPEWTTDSAALEAFEKFGKKLVEIENRIIEMNDDD  818

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +LKNR GPV VPYTLL+P     +G  GL+G+GIPNS+SI
Sbjct  819  QLKNRVGPVKVPYTLLYPNTSDNSGIGGLTGRGIPNSVSI  858



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GISLIEILSRH+SDE++LGQR+ P WT D E LEAF+ FGK LV IEERI+ +N DG
Sbjct  761  TLIGISLIEILSRHSSDELHLGQRDTPNWTCDVEPLEAFDEFGKKLVEIEERIMALNNDG  820

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR GPVN+PYTLLFP+ + GL+G GIPNS++I
Sbjct  821  KHKNRVGPVNMPYTLLFPSSKAGLTGMGIPNSVAI  855



>ref|XP_010025194.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=871

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILS H++DE+YLGQR+ PEWT D E LEAFERFGK L  +EERI++MNGD 
Sbjct  777  TLLGISLIEILSSHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDK  836

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +  NR GPV VPY LL+PT E G++ KGIPNS+SI
Sbjct  837  RWMNRVGPVEVPYMLLYPTSEGGVTAKGIPNSVSI  871



>gb|KGN60936.1| hypothetical protein Csa_2G028480 [Cucumis sativus]
Length=124

 Score =   132 bits (331),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             LLG+SLIEILSRHASDE+YLG+R   EWT D++ALEAF+ FG+ +  +EERI++ N + 
Sbjct  30   CLLGMSLIEILSRHASDEVYLGKRGSLEWTCDRDALEAFDDFGQEVNEVEERIMERNRNI  89

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNRTG  NVPYTLL P+  EG++GKGIPNSISI
Sbjct  90   KFKNRTGQANVPYTLLLPSSNEGITGKGIPNSISI  124



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+  EWT DK+ LEAFERFGK L  IE+++  MN  G
Sbjct  772  TLLGISLIEILSRHSSDEVYLGQRDTHEWTADKKPLEAFERFGKKLAEIEDKMFDMNKAG  831

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR GPV VPYTLL PT E GL+G+GIPNS+SI
Sbjct  832  KWKNRVGPVEVPYTLLVPTSEGGLTGRGIPNSVSI  866



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH SDEIYLGQR+ P+WT D+E L AF+RFG  L  IE RI++MNGD 
Sbjct  767  TLLGVSLIEILSRHTSDEIYLGQRDSPKWTYDEEPLAAFDRFGNKLSDIENRIIEMNGDQ  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              +NR+GPV  PYTLLFPT E GL+GKG+PNS+SI
Sbjct  827  IWRNRSGPVKAPYTLLFPTSEGGLTGKGVPNSVSI  861



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             +LGISL+EILS+H+SDE+YLGQR+ P+WT D E L+AFE+FGK L +IEERIL+MN D 
Sbjct  767  AVLGISLVEILSKHSSDEVYLGQRDTPDWTSDAEPLQAFEKFGKTLASIEERILRMNSDE  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KL+NR GPV +PYTLL+PT + GL+G G+PNSISI
Sbjct  827  KLRNRFGPVKMPYTLLYPTSKGGLTGMGVPNSISI  861



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH SDEIYLGQR+ P+WT D+E L AF+RFG  L  IE RI++MNGD 
Sbjct  767  TLLGVSLIEILSRHTSDEIYLGQRDSPKWTYDEEPLAAFDRFGNKLSDIENRIIEMNGDQ  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              +NR+GPV  PYTLLFPT E GL+GKG+PNS+SI
Sbjct  827  IWRNRSGPVKAPYTLLFPTSEGGLTGKGVPNSVSI  861



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+LIEILSRH++DE+YLGQR+ PEWT D E L+AF +FG  L  IE+RI +MN D 
Sbjct  768  TVLGIALIEILSRHSTDEVYLGQRDTPEWTADTEPLKAFAKFGSKLAEIEDRITRMNNDE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV +PYTLLFPT E GL+G+GIPNS+SI
Sbjct  828  KLKNRVGPVKMPYTLLFPTSEGGLTGRGIPNSVSI  862



>ref|XP_008777614.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Phoenix dactylifera]
Length=885

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T++G++++EILS HASDE+YLGQR+ PEWT D++ALEAF RFG+ L  IE RIL MN D 
Sbjct  791  TIMGVAILEILSTHASDEVYLGQRDAPEWTTDQKALEAFRRFGERLKEIEARILAMNDDP  850

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTLLFPTGE G+S KGIPNSISI
Sbjct  851  SLKNRKGPVFMPYTLLFPTGERGISAKGIPNSISI  885



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+LIEILSRH++DE+YLGQR+ PEWT D E L+AF++FGK L  IE+RI  MN D 
Sbjct  763  TVLGIALIEILSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGKKLAEIEDRITSMNNDE  822

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV VPYTLLFPT  EGL+G+GIPNS+SI
Sbjct  823  KLKNRVGPVKVPYTLLFPTS-EGLTGRGIPNSVSI  856



>ref|XP_006344836.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=845

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GIS IEILS H+SDEIYLGQR+ P+WT DKE L+A ERFGK L  IEE+I+KMN D 
Sbjct  751  TLIGISAIEILSTHSSDEIYLGQRDTPKWTNDKEPLQALERFGKKLTEIEEKIIKMNNDK  810

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR GP+ +PYTLL+P  E GL+GKGIPNS+SI
Sbjct  811  KWKNRMGPIKMPYTLLYPISEPGLTGKGIPNSVSI  845



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+ PEWT D   L+AFE+FG+ L  IEERI+  NG+ 
Sbjct  806  TLLGISLIEILSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEERIIDRNGNE  865

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+PT E GL+GKGIPNS+SI
Sbjct  866  RFKNRVGPVKIPYTLLYPTSEGGLTGKGIPNSVSI  900



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH++DE+YLGQR+ PEWT D   LEAF++FGK L  IEERI  MN   
Sbjct  768  TLLGISLIEILSRHSTDEVYLGQRDTPEWTADTAPLEAFDKFGKKLEEIEERITSMNNGE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV VPYTLLFPT   GL+GKGIPNS+SI
Sbjct  828  KLKNRVGPVKVPYTLLFPTSGGGLTGKGIPNSVSI  862



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAFE+FGK L  IE+RI  MN D 
Sbjct  769  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDE  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  829  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  863



>ref|XP_009790810.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=853

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIE+LSRH +DE+YLG R+ PEWT D+E L+AFERFGK L  IEERI +MN D 
Sbjct  759  TLLGISLIEMLSRHTADEVYLGLRDTPEWTNDQEPLQAFERFGKRLREIEERITQMNCDE  818

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR+GPV VPYT  +P+ E GL+GKGIPNS+SI
Sbjct  819  KWKNRSGPVKVPYTSFYPSSEMGLTGKGIPNSVSI  853



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAFE+FGK L  IE+RI  MN D 
Sbjct  769  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDE  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  829  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  863



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAFE+FGK L  IE+RI  MN D 
Sbjct  770  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDE  829

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  830  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  864



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAFE+FGK L  IE+RI  MN D 
Sbjct  769  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDE  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  829  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  863



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAFE+FGK L  IE+RI  MN D 
Sbjct  769  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDE  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  829  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  863



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH+SDE+YLGQR+  +WT D E LEAF RFGK L  IEE I++MN D 
Sbjct  767  TLLGVSLIEILSRHSSDEVYLGQRDSADWTTDDEPLEAFGRFGKKLGEIEEMIIEMNNDE  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L+NR GPV VPYTLLFPT E GL+GKGIPNS+SI
Sbjct  827  NLRNRVGPVKVPYTLLFPTSEGGLTGKGIPNSVSI  861



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+  EWT DK+ LEAFE+FGK L  IE+++L MN  G
Sbjct  753  TLLGISLIEILSRHSSDEVYLGQRDTHEWTADKKPLEAFEKFGKKLAEIEDKMLYMNKAG  812

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR GPV VPYTLL PT E GL+G+GIPNS+SI
Sbjct  813  KWKNRVGPVEVPYTLLVPTSEGGLTGRGIPNSVSI  847



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAFE+FGK L  IE+RI  MN D 
Sbjct  769  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDIAALEAFEKFGKKLAEIEDRITSMNNDD  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  829  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  863



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            +LL IS+ E+ SRHASDE+YLGQR+  EWTKDKE L AFERFGK L  IE RI+ MN   
Sbjct  765  SLLEISIFEVSSRHASDEVYLGQRDSIEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHK  824

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              KNR+GPVNVPYTLLFPT EEGL+GKGIPNS+SI
Sbjct  825  SWKNRSGPVNVPYTLLFPTSEEGLTGKGIPNSVSI  859



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            +LL IS+ E+ SRHASDE+YLGQR+  EWTKDKE L AFERFGK L  IE RI+ MN   
Sbjct  765  SLLEISIFEVSSRHASDEVYLGQRDSIEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHK  824

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              KNR+GPVNVPYTLLFPT EEGL+GKGIPNS+SI
Sbjct  825  SWKNRSGPVNVPYTLLFPTSEEGLTGKGIPNSVSI  859



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            +LL IS+ E+ SRHASDE+YLGQR+  EWTKDKE L AFERFGK L  IE RI+ MN   
Sbjct  765  SLLEISIFEVSSRHASDEVYLGQRDSIEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHK  824

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              KNR+GPVNVPYTLLFPT EEGL+GKGIPNS+SI
Sbjct  825  SWKNRSGPVNVPYTLLFPTSEEGLTGKGIPNSVSI  859



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIE+LS H++DE+YLGQR+  EWT D E LEAF+RFGK L  IEE I+ MN D 
Sbjct  778  TLLGISLIEVLSAHSTDEVYLGQRDTAEWTTDIEPLEAFQRFGKKLGEIEENIIDMNNDE  837

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV VPYTLLFPT E G++GKGIPNS+SI
Sbjct  838  KLKNRVGPVKVPYTLLFPTSEGGVTGKGIPNSVSI  872



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+ PEWT D   L+AFE+FG+ L  IEERI+  NG+ 
Sbjct  781  TLLGISLIEILSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEERIIDRNGNE  840

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+PT E G++GKGIPNS+SI
Sbjct  841  RFKNRVGPVKIPYTLLYPTSEGGITGKGIPNSVSI  875



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+  EWT DK+ LEAFE+FGK L  IE+++L MN  G
Sbjct  772  TLLGISLIEILSRHSSDEVYLGQRDTHEWTADKKPLEAFEKFGKKLAEIEDKMLDMNKAG  831

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR GPV VPYTLL PT E GL+G+GIPNS+S+
Sbjct  832  KWKNRVGPVEVPYTLLVPTSEGGLTGRGIPNSVSL  866



>ref|XP_004156417.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=864

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             L+G+S+IEILSRH+SDE+YLGQR +PEWT DKEALEAFE+FG+ L  IE++I   N D 
Sbjct  770  ALVGVSVIEILSRHSSDEVYLGQRSNPEWTLDKEALEAFEKFGEKLGEIEKKIAMRNKDP  829

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPV++PYTLLFPT  EGL+G+GIPNSISI
Sbjct  830  QLKNRVGPVDMPYTLLFPTSSEGLTGRGIPNSISI  864



>ref|XP_010094673.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56581.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=764

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIEILSRHASDE+YLGQR+ PEWT D E  +AFERFG+ L  IE+RI+  N D 
Sbjct  670  TILGVSLIEILSRHASDEVYLGQRDTPEWTADAEPTKAFERFGEKLAQIEDRIMSRNNDK  729

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV  PYTLL P+ EEGL+ +GIPNSISI
Sbjct  730  TLKNRVGPVKFPYTLLCPSSEEGLTARGIPNSISI  764



>ref|XP_004139172.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=864

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             L+G+S+IEILSRH+SDE+YLGQR +PEWT DKEALEAFE+FG+ L  IE++I   N D 
Sbjct  770  ALVGVSVIEILSRHSSDEVYLGQRSNPEWTLDKEALEAFEKFGEKLGEIEKKIAMRNKDP  829

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPV++PYTLLFPT  EGL+G+GIPNSISI
Sbjct  830  QLKNRVGPVDMPYTLLFPTSSEGLTGRGIPNSISI  864



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            L +LGISL+EILS+H+SDE+YLGQR+ P+WT D E L+AFE+FGK L  IEERIL+MN D
Sbjct  770  LAVLGISLVEILSKHSSDEVYLGQRDTPDWTSDAEPLQAFEKFGKKLADIEERILRMNSD  829

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             K +NR GPV +PYTLL+P+ + GL+G G+PNSISI
Sbjct  830  EKFRNRYGPVKMPYTLLYPSSKGGLTGMGVPNSISI  865



>gb|KHN16119.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=852

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            L +LGISL+EILS+H+SDE+YLGQR+ P+WT D E L+AFE+FGK L  IEERIL+MN D
Sbjct  757  LAVLGISLVEILSKHSSDEVYLGQRDTPDWTSDAEPLQAFEKFGKKLADIEERILRMNSD  816

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             K +NR GPV +PYTLL+P+ + GL+G G+PNSISI
Sbjct  817  EKFRNRYGPVKMPYTLLYPSSKGGLTGMGVPNSISI  852



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH SDEIYLGQR+ P+WT D+  L AFERFG  L  IE RI++MNGD 
Sbjct  767  TLLGVSLIEILSRHTSDEIYLGQRDSPKWTNDEVPLAAFERFGNKLSDIENRIIEMNGDQ  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              +NR+GP+  PYTLLFPT E GL+GKGIPNS+SI
Sbjct  827  IWRNRSGPIKAPYTLLFPTSEGGLTGKGIPNSVSI  861



>ref|XP_008801705.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Phoenix dactylifera]
Length=867

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 84/100 (84%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIEILSRH+SDE+YLGQR+ PEWT D++AL+AF+RFG+ LV IE RIL+MN D 
Sbjct  768  TILGVSLIEILSRHSSDEVYLGQRDTPEWTTDRKALDAFKRFGEHLVEIENRILRMNQDK  827

Query  192  KLKNRTGPVNVPYTLLFPTGEE-----GLSGKGIPNSISI  296
            +LKNR GPV +PYTLL+P+  +     GL+G+GIPNS+SI
Sbjct  828  RLKNRNGPVKMPYTLLYPSTSDFSGVGGLTGRGIPNSVSI  867



>ref|XP_008454481.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=863

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   LLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDGK  194
            L+G+S+IEILSRH+SDE+YLGQR +PEWT DKEALEAFE+FG+ L  IE +I   N D +
Sbjct  770  LVGVSVIEILSRHSSDEVYLGQRSNPEWTLDKEALEAFEKFGEKLGEIERKIAMRNKDPQ  829

Query  195  LKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            LKNR GPV++PYTLLFPT  EGL+G+GIPNSISI
Sbjct  830  LKNRVGPVDMPYTLLFPTSSEGLTGRGIPNSISI  863



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAF++FGK L  IE+RI  MN D 
Sbjct  769  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDTAALEAFDKFGKKLAEIEDRITSMNNDE  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  829  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  863



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+LIEILSRH++DE+YLGQR+ PEWT D E L+AF++FG+ L  IE+RI  MN D 
Sbjct  768  TVLGIALIEILSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGRKLAKIEDRITSMNNDE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV +PYTLLFPT   GL+G+GIPNS+SI
Sbjct  828  KLKNRVGPVKMPYTLLFPTSGGGLTGRGIPNSVSI  862



>ref|XP_011092040.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X4 [Sesamum 
indicum]
Length=866

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            ++LGISL+EILSRH+SDEI+LGQRE PEWT D  AL+AFE FG  LV IE+RI++MN DG
Sbjct  772  SVLGISLVEILSRHSSDEIFLGQRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDG  831

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+P+ + GL+G+GIPNS+SI
Sbjct  832  RWKNRFGPVKMPYTLLYPSSDIGLTGRGIPNSVSI  866



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            ++LGISL+EILSRH+SDEI+LGQRE PEWT D  AL+AFE FG  LV IE+RI++MN DG
Sbjct  773  SVLGISLVEILSRHSSDEIFLGQRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDG  832

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+P+ + GL+G+GIPNS+SI
Sbjct  833  RWKNRFGPVKMPYTLLYPSSDIGLTGRGIPNSVSI  867



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIE+LSRH+SDE+YLGQR+ PEWT D+ ALEAFERF   L+ IE RI+ MN D 
Sbjct  773  TILGVSLIEVLSRHSSDEVYLGQRDSPEWTTDRSALEAFERFSHKLIEIENRIISMNQDA  832

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
             L+NRTGPV +PYTLL+P     TG  GL+G+GIPNS+SI
Sbjct  833  SLRNRTGPVKMPYTLLYPNVSDLTGVGGLTGRGIPNSVSI  872



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            ++LGISLIEILSRH++DE+YLGQR+ PEWT D EA++AFE FG+ LV IE+RI++MN DG
Sbjct  770  SVLGISLIEILSRHSADEVYLGQRDSPEWTTDTEAIKAFEMFGERLVKIEKRIIEMNKDG  829

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR+GPV +PYTLL P+ + GL+G+GIPNSIS+
Sbjct  830  RWKNRSGPVKMPYTLLCPSSDIGLTGRGIPNSISM  864



>ref|XP_009625816.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=832

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIE+LSRH +DE+YLGQR+ PEWT D+E L+AFERFGK L  IE+RI +MN D 
Sbjct  738  TLLGISLIEMLSRHTADEVYLGQRDTPEWTNDQEPLQAFERFGKRLREIEKRITQMNCDE  797

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR+GPV VPYT  + + E GL+GKGIPNS+SI
Sbjct  798  KWKNRSGPVKVPYTSFYASSEMGLTGKGIPNSVSI  832



>gb|KHF98567.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Gossypium arboreum]
Length=832

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH +DEIYLGQR+ PEWT D E L AFERFGK LV IE+ + + N DG
Sbjct  733  TLLGVSLIEILSRHTTDEIYLGQRDTPEWTSDNEPLAAFERFGKKLVEIEKTVTERNNDG  792

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +LKNR GPV VPYTLLFP     + E GL+GKGIPNSISI
Sbjct  793  RLKNRIGPVKVPYTLLFPNTSDYSKEGGLTGKGIPNSISI  832



>gb|KHF98566.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Gossypium arboreum]
Length=845

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH +DEIYLGQR+ PEWT D E L AFERFGK LV IE+ + + N DG
Sbjct  746  TLLGVSLIEILSRHTTDEIYLGQRDTPEWTSDNEPLAAFERFGKKLVEIEKTVTERNNDG  805

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +LKNR GPV VPYTLLFP     + E GL+GKGIPNSISI
Sbjct  806  RLKNRIGPVKVPYTLLFPNTSDYSKEGGLTGKGIPNSISI  845



>ref|XP_008454500.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=858

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDEIYLG+RE  EW  D+ ALEAFE+FGK L  IE  I+K N D 
Sbjct  764  TLLGISLIEILSRHSSDEIYLGKRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDP  823

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K+KNR GP+NVPYT L+PT  EGL+GKGIPNSISI
Sbjct  824  KMKNRVGPINVPYTSLYPTSNEGLTGKGIPNSISI  858



>ref|XP_006406169.1| hypothetical protein EUTSA_v10020023mg [Eutrema salsugineum]
 gb|ESQ47622.1| hypothetical protein EUTSA_v10020023mg [Eutrema salsugineum]
Length=888

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D EALEAF+RFGK L  IE  I++ NGD 
Sbjct  789  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEALEAFKRFGKTLEMIENNIIRRNGDK  848

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  849  RFKNRTGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  888



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH++DE+YLGQR+ PEWT D E L AFERFG+ LV IE +I+ MN D 
Sbjct  781  TLLGVSLIEILSRHSTDEVYLGQRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDN  840

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNR GPV VPYTLLFP     + E GL+GKGIPNS+SI
Sbjct  841  RWKNRVGPVQVPYTLLFPNTTDYSREGGLTGKGIPNSVSI  880



>ref|XP_011092038.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=906

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            ++LGISL+EILSRH+SDEI+LGQRE PEWT D  AL+AFE FG  LV IE+RI++MN DG
Sbjct  812  SVLGISLVEILSRHSSDEIFLGQRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDG  871

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+P+ + GL+G+GIPNS+SI
Sbjct  872  RWKNRFGPVKMPYTLLYPSSDIGLTGRGIPNSVSI  906



>ref|XP_011092037.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=907

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            ++LGISL+EILSRH+SDEI+LGQRE PEWT D  AL+AFE FG  LV IE+RI++MN DG
Sbjct  813  SVLGISLVEILSRHSSDEIFLGQRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDG  872

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+P+ + GL+G+GIPNS+SI
Sbjct  873  RWKNRFGPVKMPYTLLYPSSDIGLTGRGIPNSVSI  907



>gb|EYU26430.1| hypothetical protein MIMGU_mgv1a023655mg [Erythranthe guttata]
Length=963

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            ++LGISLIEILSRH++DE+YLGQR+ PEWT D EA++AFE FG+ LV IE RI++MN DG
Sbjct  869  SVLGISLIEILSRHSADEVYLGQRDSPEWTTDTEAIKAFEMFGERLVQIENRIIEMNKDG  928

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR+GPV +PYTLL P+ + GL+G+GIPNSIS+
Sbjct  929  RWKNRSGPVKMPYTLLCPSSDIGLTGRGIPNSISM  963



>ref|XP_004139173.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGI+ IEILSRH+SDE+YLGQR+ P+WT DKEAL+AFE+FGK L  IE+ I K N D 
Sbjct  758  TLLGIASIEILSRHSSDEVYLGQRDSPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDL  817

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L+NR GPV +PYTLL+P+ EEGL+GKGIPNS+SI
Sbjct  818  TLRNRVGPVFMPYTLLYPSSEEGLTGKGIPNSVSI  852



>ref|XP_004156418.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGI+ IEILSRH+SDE+YLGQR+ P+WT DKEAL+AFE+FGK L  IE+ I K N D 
Sbjct  758  TLLGIASIEILSRHSSDEVYLGQRDSPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDL  817

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L+NR GPV +PYTLL+P+ EEGL+GKGIPNS+SI
Sbjct  818  TLRNRVGPVFMPYTLLYPSSEEGLTGKGIPNSVSI  852



>ref|XP_004139356.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=860

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISL+EILSRH+SDEIYLG+RE  EW  D+ ALEAFE+FGK L  IE  I+K N D 
Sbjct  766  TLLGISLVEILSRHSSDEIYLGKRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDP  825

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K+KNR GP+NVPYT L+PT  EGL+GKGIPNSISI
Sbjct  826  KMKNRVGPINVPYTSLYPTSNEGLTGKGIPNSISI  860



>gb|AAA79186.1| lipoxygenase [Cucumis sativus]
Length=877

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR   EWT DK A+E FE FGK +  +E RI++ N D 
Sbjct  783  TLLGVSLIEILSRHASDEVYLGQRASIEWTSDKAAVEVFENFGKKVFEVESRIIERNKDV  842

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  843  NLKNRSGPVNVPYTLLLPSSTEGLTGRGIPNSISI  877



>ref|XP_004169780.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=860

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISL+EILSRH+SDEIYLG+RE  EW  D+ ALEAFE+FGK L  IE  I+K N D 
Sbjct  766  TLLGISLVEILSRHSSDEIYLGKRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDP  825

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K+KNR GP+NVPYT L+PT  EGL+GKGIPNSISI
Sbjct  826  KMKNRVGPINVPYTSLYPTSNEGLTGKGIPNSISI  860



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH SDEIYLGQR+ P+WT D+E L AFERFG  L  IE RI++MNGD 
Sbjct  767  TLLGVSLIEILSRHTSDEIYLGQRDSPKWTNDEEPLAAFERFGNKLSDIENRIIEMNGDQ  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              +NR GP+  PYTLLFPT + GL+ KGIPNS+SI
Sbjct  827  IWRNRLGPIKAPYTLLFPTSQGGLTAKGIPNSVSI  861



>gb|KJB28315.1| hypothetical protein B456_005G041900 [Gossypium raimondii]
Length=877

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH +DEIYLGQR+ PEWT D E L AFERFGK LV IE+R+ + N DG
Sbjct  778  TLLGVSLIEILSRHTTDEIYLGQRDTPEWTSDNEPLAAFERFGKKLVEIEKRVTERNNDG  837

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +LKNR G V VPYTLLFP     + E GL+GKGIPNSISI
Sbjct  838  RLKNRIGAVKVPYTLLFPNTSDYSKEGGLTGKGIPNSISI  877



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+ IEILSRH++DE+YLGQR+ P+WT D  ALEAF +FGK L  IE+RI  MN D 
Sbjct  769  TVLGIATIEILSRHSTDEVYLGQRDTPDWTSDTAALEAFXKFGKKLAEIEDRITSMNNDE  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V +PYTLLFPT E G++GKGIPNS+SI
Sbjct  829  KLKNRVGSVKIPYTLLFPTSEGGITGKGIPNSVSI  863



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIE+LSRH+SDE+YLGQR+ PEWT D   L+AFE+FG+ L  IEE I++ NGD 
Sbjct  765  TLLGISLIEVLSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIERNGDE  824

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GP+ +PYTLL+PT E GL+GKGIPNS+SI
Sbjct  825  RFKNRVGPLKIPYTLLYPTSEGGLTGKGIPNSVSI  859



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH++DE+YLGQR+ PEWT D E L AFERFG+ LV IE +I+ MN D 
Sbjct  782  TLLGVSLIEILSRHSTDEVYLGQRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDK  841

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNR GPV VPYTLLFP     + E GL+GKGIPNS+SI
Sbjct  842  RWKNRVGPVQVPYTLLFPNTTDYSREGGLTGKGIPNSVSI  881



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH++DE+YLG+R+ PEWT D   LEAF +FGK L  IEERI+ MN D 
Sbjct  869  TLLGISLIEILSRHSTDEVYLGKRDTPEWTADAAPLEAFNKFGKKLEEIEERIISMNNDE  928

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V VPYTLLFPT   GL+GKGIPNS+SI
Sbjct  929  KLKNRVGLVKVPYTLLFPTSGGGLTGKGIPNSVSI  963



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH++DE+YLGQR+ PEWT D E L AFERFG+ LV IE +I+ MN D 
Sbjct  781  TLLGVSLIEILSRHSTDEVYLGQRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDK  840

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNR GPV VPYTLLFP     + E GL+GKGIPNS+SI
Sbjct  841  RWKNRVGPVQVPYTLLFPNTTDYSREGGLTGKGIPNSVSI  880



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH++DE+YLG+R+ PEWT D   LEAF +FGK L  IEERI+ MN D 
Sbjct  741  TLLGISLIEILSRHSTDEVYLGKRDTPEWTADAAPLEAFNKFGKKLEEIEERIISMNNDE  800

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR G V VPYTLLFPT   GL+GKGIPNS+SI
Sbjct  801  KLKNRVGLVKVPYTLLFPTSGGGLTGKGIPNSVSI  835



>ref|XP_008454470.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=877

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR   EWT D+ ALE FE FGK +  +E RI++ N D 
Sbjct  783  TLLGVSLIEILSRHASDEVYLGQRASIEWTSDRAALEVFENFGKEVSEVENRIIQRNKDV  842

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  843  SLKNRSGPVNVPYTLLLPSSTEGLTGRGIPNSISI  877



>ref|XP_010934565.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Elaeis guineensis]
Length=885

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T++G+ ++EILS HASDE+YLGQR+ PEWTKD++ LEAF RFG+ L  IE +IL MN D 
Sbjct  791  TIMGVGILEILSSHASDEVYLGQRDTPEWTKDQKTLEAFHRFGERLKKIEAKILAMNEDP  850

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTLLFPTGE+G++ KGIPNSISI
Sbjct  851  SLKNRKGPVMMPYTLLFPTGEKGITAKGIPNSISI  885



>gb|KJB38138.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=869

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIE+LSRH++DEIYLGQR+  EWT D E L AFERFGK LV IE RI++ N D 
Sbjct  770  TLLGVSLIEVLSRHSTDEIYLGQRDTAEWTTDDEPLAAFERFGKKLVEIESRIMERNNDS  829

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            KLKNR GPV VPYTLL+P+      E GL+GKGIPNSISI
Sbjct  830  KLKNRVGPVKVPYTLLYPSTSDYSREGGLTGKGIPNSISI  869



>gb|ACU81176.1| 13S-lipoxygenase [Cucumis melo var. inodorus]
Length=877

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLGQR   EWT D+ ALE FE FGK +  +E RI++ N D 
Sbjct  783  TLLGVSLIEILSRHASDEVYLGQRASIEWTSDRAALEVFENFGKEVSEVENRIIQRNKDV  842

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  843  SLKNRSGPVNVPYTLLLPSSTEGLTGRGIPNSISI  877



>gb|KJB38137.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=900

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIE+LSRH++DEIYLGQR+  EWT D E L AFERFGK LV IE RI++ N D 
Sbjct  801  TLLGVSLIEVLSRHSTDEIYLGQRDTAEWTTDDEPLAAFERFGKKLVEIESRIMERNNDS  860

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            KLKNR GPV VPYTLL+P+      E GL+GKGIPNSISI
Sbjct  861  KLKNRVGPVKVPYTLLYPSTSDYSREGGLTGKGIPNSISI  900



>gb|KDP40158.1| hypothetical protein JCGZ_02156 [Jatropha curcas]
Length=867

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH++DE+YLGQR+ PEWT D+E L AFERF K L  IE +I++MN D 
Sbjct  768  TLLGVSLIEILSRHSTDEVYLGQRDTPEWTSDREPLAAFERFAKRLSVIENKIMEMNNDE  827

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            K KNR GPV VPYTLLFP     + E GL+GKGIPNSISI
Sbjct  828  KWKNRNGPVKVPYTLLFPNTSDKSREGGLTGKGIPNSISI  867



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIE+LSRH+SDE+YLGQR+ PEWT D   L+AFE+FG+ L  IEE I+  NG+ 
Sbjct  765  TLLGISLIEVLSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNE  824

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+PT E GL+GKGIPNS+SI
Sbjct  825  RFKNRVGPVKIPYTLLYPTSEGGLTGKGIPNSVSI  859



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIE+LSRH+SDE+YLGQR+ PEWT D   L+AFE+FG+ L  IEE I+  NG+ 
Sbjct  765  TLLGISLIEVLSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNE  824

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+PT E GL+GKGIPNS+SI
Sbjct  825  RFKNRVGPVKIPYTLLYPTSEGGLTGKGIPNSVSI  859



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILSRH+SDE+YLGQR+  EWT +KE +EAF++FG+ L  IE+RIL MN + 
Sbjct  768  TLLGISLIEILSRHSSDEVYLGQRDILEWTAEKEPIEAFKKFGRKLAVIEDRILDMNREA  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV VPYTLL PT E GL+G+GIPNS+SI
Sbjct  828  RYKNRVGPVKVPYTLLVPTSEAGLTGRGIPNSVSI  862



>ref|XP_007030814.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11316.1| Lipoxygenase 1 [Theobroma cacao]
Length=835

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T +G+S++E+LS+HASDE+YLGQR  P WT D   L AFE F K L  IEE I++MN D 
Sbjct  741  TFIGMSVVEVLSKHASDEVYLGQRASPNWTADAIPLAAFEAFHKRLAEIEEEIIRMNKDK  800

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPVNVPYTLL+PTGE G+ GKGIPNSISI
Sbjct  801  KLKNRVGPVNVPYTLLYPTGEVGICGKGIPNSISI  835



>ref|XP_010025193.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61802.1| hypothetical protein EUGRSUZ_H04499 [Eucalyptus grandis]
Length=871

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLL ISL+EILS H++DE+YLGQR+ PEWT D E LEAFERFGK L  +EERI++MNGD 
Sbjct  777  TLLVISLMEILSMHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDK  836

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + +NR GPV VPY LL+PT E G + KGIPNS+SI
Sbjct  837  RWRNRVGPVEVPYMLLYPTSEGGATAKGIPNSVSI  871



>ref|XP_010905215.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Elaeis guineensis]
Length=866

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 82/100 (82%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIEILSRH+SDE+YLGQR+ PEWT D++AL+AF+RFG  LV IE+RIL MN D 
Sbjct  767  TILGVSLIEILSRHSSDEVYLGQRDTPEWTTDRKALDAFKRFGDNLVEIEKRILTMNEDT  826

Query  192  KLKNRTGPVNVPYTLLFPTGEE-----GLSGKGIPNSISI  296
            ++KNR GPV +PYTLL+P   +     GL+GKGIPNS+SI
Sbjct  827  RIKNRNGPVKMPYTLLYPNTSDFSRVGGLTGKGIPNSVSI  866



>emb|CAP59449.1| lipoxygenase [Momordica charantia]
Length=880

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            + LLG+S+IEILS+HASDE+YLGQR   EWT DK A+EAFE+FGK L  +E+RI++ N D
Sbjct  785  VALLGLSIIEILSKHASDEVYLGQRASIEWTSDKSAIEAFEKFGKELFEVEDRIMRRNQD  844

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              LKNR GPVN+PYTLL P+  EGL+G+GIPNSISI
Sbjct  845  VNLKNRAGPVNMPYTLLVPSSTEGLTGRGIPNSISI  880



>ref|XP_010488263.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=890

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IE LS H++DEIYLGQRE P WT D EALEAF+RFGK L  IE  I+K N D 
Sbjct  791  TLLGISIIETLSMHSTDEIYLGQRESPNWTADDEALEAFKRFGKELELIENNIIKRNNDK  850

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            K KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  851  KFKNRTGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  890



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGI+ IEILSRH+SDE+YLGQR+ P+WT DKE L+AFE+FGK L  IE+ I K N D 
Sbjct  758  TLLGIASIEILSRHSSDEVYLGQRDSPKWTADKEVLDAFEKFGKKLAEIEDGITKRNEDL  817

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L+NR GPV +PYTLL+P+ EEGL+GKGIPNS+SI
Sbjct  818  TLRNRVGPVFMPYTLLYPSSEEGLTGKGIPNSVSI  852



>ref|XP_010488264.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=889

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IE LS H++DEIYLGQRE P WT D EALEAF+RFGK L  IE  I+K N D 
Sbjct  790  TLLGISIIETLSMHSTDEIYLGQRESPNWTADDEALEAFKRFGKELELIENNIIKRNNDK  849

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            K KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  850  KFKNRTGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  889



>ref|XP_009387658.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            LT+LG++ IEILS HASDE+YLGQR+ PEWT D+ A++AFERFG+ L AIE  I+K NGD
Sbjct  752  LTMLGLNTIEILSNHASDEVYLGQRDTPEWTSDERAVKAFERFGQRLKAIEAEIMKRNGD  811

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              LKNR GPV +PYTLLFP+   G++G+GIPNSISI
Sbjct  812  PSLKNRNGPVKMPYTLLFPSSGVGVTGRGIPNSISI  847



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGISLIEILSRH+SDE+YLGQR+ PEWT D + LEAF++FGK L  IE+RI++MN D 
Sbjct  777  TVLGISLIEILSRHSSDEVYLGQRDTPEWTTDSKPLEAFKKFGKKLEKIEDRIIEMNKDV  836

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPV VPYTLL P+ + GL+G+GIPNS+SI
Sbjct  837  ELKNRIGPVLVPYTLLVPSSDVGLTGRGIPNSVSI  871



>gb|KFK39531.1| hypothetical protein AALP_AA3G256400 [Arabis alpina]
Length=882

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D EALEAF+RFGK L  IE  I++ N D 
Sbjct  783  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEALEAFKRFGKNLELIENNIIRRNNDK  842

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  843  RFKNRTGPVNIPYTLLYPNTTDFTREGGLTGKGIPNSVSI  882



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGI+LIEILSRH++DE+YLGQR+ PEWT D E L+ F++FG+ L  IE+RI  MN D 
Sbjct  768  TVLGIALIEILSRHSTDEVYLGQRDTPEWTADTEPLKVFDKFGRKLAEIEDRIESMNNDE  827

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV +PYTLLFPT   GL+G+GIPNS+SI
Sbjct  828  KLKNRVGPVKMPYTLLFPTSGGGLTGRGIPNSVSI  862



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   LLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDGK  194
            +LGI+LIEILSRH++DE+YLG+R+ PEWT D+E L+AF++FG+ L  IE+RI  MN D K
Sbjct  822  VLGIALIEILSRHSTDEVYLGKRDTPEWTADREPLKAFDKFGRKLAEIEDRITSMNNDEK  881

Query  195  LKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            LKNR GPV +PYTLLFPT   GL+G+GIPNS+SI
Sbjct  882  LKNRVGPVKMPYTLLFPTSGGGLTGRGIPNSVSI  915



>ref|XP_007030813.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11315.1| Lipoxygenase 1 [Theobroma cacao]
Length=843

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPE-WTKDKEALEAFERFGKXLVAIEERILKMNG  185
            +TLLG+SLIEILS+H+ DE+YLGQR  P+ WT D   L+AF  FG  L  IE+RI++MN 
Sbjct  747  MTLLGVSLIEILSKHSPDEVYLGQRSDPDKWTTDAAPLKAFNDFGNKLSQIEQRIIQMNH  806

Query  186  DGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            D  LKNR+GPVNVPYTLLFPT E GL+GKGIPNS+SI
Sbjct  807  DKTLKNRSGPVNVPYTLLFPTSESGLTGKGIPNSVSI  843



>gb|KHG03761.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG17470.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
Length=873

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIE+LSRH++DEIYLGQR+  EWT D E L AFERFGK L+ IE RI++ N D 
Sbjct  774  TLLGVSLIEVLSRHSTDEIYLGQRDTAEWTTDDEPLAAFERFGKKLLEIESRIMERNNDS  833

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            KLKNR GPV VPYTLL+P     + E GL+GKGIPNSISI
Sbjct  834  KLKNRVGPVKVPYTLLYPNTSDYSREGGLTGKGIPNSISI  873



>ref|XP_010511287.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic isoform 
X1 [Camelina sativa]
Length=886

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IE LS H++DEIYLGQRE P WT D EALEAF+RFGK L  IE  I+K N D 
Sbjct  787  TLLGISIIETLSMHSTDEIYLGQRESPNWTADDEALEAFKRFGKELELIENNIIKRNNDK  846

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  847  RFKNRTGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  886



>ref|XP_009108895.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic [Brassica 
rapa]
Length=889

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D E LEAF+RFGK L  IE  I++ N D 
Sbjct  790  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKSLEVIENNIIRRNNDK  849

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +LKNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  850  RLKNRTGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  889



>emb|CDY64191.1| BnaA01g36630D [Brassica napus]
Length=907

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D E LEAF+RFGK L  IE  I++ N D 
Sbjct  808  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKSLEVIENNIIRRNNDK  867

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +LKNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  868  RLKNRTGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  907



>ref|XP_010549787.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=861

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+S+IE+LSRH++DE+YLGQR+  EWT + EALEAF RFG+ LV IE++I++ N D 
Sbjct  767  TLLGVSIIEVLSRHSTDEVYLGQRDSKEWTAENEALEAFSRFGERLVEIEKKIVERNEDV  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTLLFPT E G++GKGIPNS+SI
Sbjct  827  SLKNRNGPVKMPYTLLFPTSEGGITGKGIPNSVSI  861



>emb|CDY46325.1| BnaC01g31590D [Brassica napus]
Length=882

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D E LEAF+RFGK L  IE  I++ N D 
Sbjct  783  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKSLEVIENNIIRRNNDK  842

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            KLKNR+GPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  843  KLKNRSGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  882



>ref|XP_009406046.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=873

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T++G+SL+EILS H+SDE+YLGQR+ PEWT D++ALEAF+RFGK L +IEE I K N D 
Sbjct  779  TIIGVSLLEILSTHSSDEVYLGQRDTPEWTTDQKALEAFQRFGKALNSIEEEINKKNADP  838

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GP  +P+TLLFP+ E G++GKGIPNS+SI
Sbjct  839  SLKNRNGPAKMPFTLLFPSSEVGITGKGIPNSVSI  873



>ref|XP_009415714.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            LT+LG++ IEILS HASDE+YLGQR+ PEWT D  A++AFERFGK L AIE  I+K N D
Sbjct  752  LTVLGLNTIEILSNHASDEVYLGQRDTPEWTSDDRAVKAFERFGKRLKAIEAEIMKKNED  811

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             +LKNR GPV +PYTLLFP+   G++GKGIPNSISI
Sbjct  812  PRLKNRNGPVKMPYTLLFPSSGVGITGKGIPNSISI  847



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILSRH+SDE+YLGQR+  EWT + EALEAF RFG+ L  IE +I++ N D 
Sbjct  765  TLLGISIIEILSRHSSDEVYLGQRDSNEWTTENEALEAFSRFGERLAEIERKIVERNDDV  824

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTL+FPT E G++GKGIPNS+SI
Sbjct  825  SLKNRNGPVKMPYTLMFPTSEGGITGKGIPNSVSI  859



>gb|KGN48009.1| Lipoxygenase [Cucumis sativus]
Length=555

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIE LSRH+ DEIYLGQR+ PEWTKD+EAL AFERFG  L  IEE+I++MN + 
Sbjct  456  TILGVSLIESLSRHSVDEIYLGQRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEE  515

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            K +NR GPV +PYT LFP       EEGL+ +GIPNSISI
Sbjct  516  KWRNRVGPVKMPYTFLFPNTSNYYEEEGLNARGIPNSISI  555



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLL +S+ E+LSRH SDE+YLGQR+ PEWTKDKE L AFERF K L  IE RI+ MN   
Sbjct  766  TLLEMSIFEVLSRHDSDEVYLGQRDSPEWTKDKEPLVAFERFVKMLNDIENRIMIMNSHK  825

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              KNR+GPV VPYTLLFP  +EGL+GKGIPNS+SI
Sbjct  826  SWKNRSGPVKVPYTLLFPKSQEGLTGKGIPNSVSI  860



>emb|CDY38326.1| BnaC05g30190D [Brassica napus]
Length=887

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D+E LEAF+RFGK L  IE  I++ N D 
Sbjct  788  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADEEPLEAFKRFGKSLELIENNIIRRNNDK  847

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            K KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  848  KFKNRTGPVNIPYTLLYPDTTDYTREGGLTGKGIPNSVSI  887



>ref|XP_010277588.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nelumbo 
nucifera]
Length=703

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH+SDE+YLGQR+ PEWT D   LEAFERF + LV IE RI +MN D 
Sbjct  604  TLLGVSLIEILSRHSSDEVYLGQRDTPEWTTDAAPLEAFERFREKLVEIENRIREMNLDK  663

Query  192  KLKNRTGPVNVPYTLLFPT-----GEEGLSGKGIPNSISI  296
            +LKNR GPV VPYTLLFP      G  GL+G+GIPNSISI
Sbjct  664  RLKNRVGPVKVPYTLLFPDTSNVYGVGGLTGRGIPNSISI  703



>gb|AES82497.2| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=867

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GISLIEILS H+SDE+YLGQR+   WT D E LEAF+RFGK L  IEERI+ MN D 
Sbjct  773  TLVGISLIEILSTHSSDEVYLGQRDSMHWTCDAEPLEAFDRFGKKLKEIEERIVAMNDDV  832

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTLL+P  E GL+G GIPNS+SI
Sbjct  833  NLKNRVGPVKMPYTLLYPRSEAGLTGAGIPNSVSI  867



>ref|XP_009145332.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic [Brassica 
rapa]
Length=887

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D E LEAF+RFGK L  IE  I++ N D 
Sbjct  788  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKSLELIENNIIRRNNDK  847

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            K KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  848  KFKNRTGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  887



>gb|ABB82552.1| 13S-lipoxygenase [Cucumis melo var. inodorus]
Length=877

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+S+IEILSRHASDE+YLGQR   EWT DK ALE FE FGK +  +E RI++ N D 
Sbjct  783  TLLGVSVIEILSRHASDEVYLGQRSSIEWTSDKAALELFEYFGKEVSEVESRIIERNKDV  842

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIP+SISI
Sbjct  843  DLKNRSGPVNVPYTLLLPSSTEGLTGRGIPSSISI  877



>ref|XP_009418148.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=855

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIEILS H+SDE+YLGQR+ PEWT D+ AL AF RFG  L  IE+ I+  NGD 
Sbjct  761  TILGVSLIEILSMHSSDEVYLGQRDTPEWTTDQRALVAFNRFGSTLKRIEDEIIGRNGDE  820

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR G   VPYTLLFPT E GL+GKGIPNS+SI
Sbjct  821  SLKNRNGAAQVPYTLLFPTSERGLTGKGIPNSVSI  855



>ref|XP_010277584.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nelumbo 
nucifera]
Length=883

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH+SDE+YLGQR+ PEWT D   LEAFERF + LV IE RI +MN D 
Sbjct  784  TLLGVSLIEILSRHSSDEVYLGQRDTPEWTTDAAPLEAFERFREKLVEIENRIREMNLDK  843

Query  192  KLKNRTGPVNVPYTLLFPT-----GEEGLSGKGIPNSISI  296
            +LKNR GPV VPYTLLFP      G  GL+G+GIPNSISI
Sbjct  844  RLKNRVGPVKVPYTLLFPDTSNVYGVGGLTGRGIPNSISI  883



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DE+YLGQR+  EWT D E LEAFERFGK L  +EE I++MNGD 
Sbjct  770  TLLGISIIEILSMHSTDEVYLGQRDTREWTADAEPLEAFERFGKKLGEVEETIIRMNGDK  829

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + +NR GPV +PY LL+PT E G++ KGIPNS+SI
Sbjct  830  RWRNRVGPVEIPYMLLYPTSEGGVTAKGIPNSVSI  864



>ref|XP_002883361.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59620.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata]
Length=838

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D E LEAF+RFGK L  IE  I++ N D 
Sbjct  739  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDK  798

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  799  RFKNRTGPVNIPYTLLYPNTSDYTREGGLTGKGIPNSVSI  838



>ref|XP_006472029.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Citrus sinensis]
Length=808

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGISLIEILSRH++DE+YLGQR+ PEWT D+  L+AF+ FGK L  +EE+I+  N + 
Sbjct  714  TILGISLIEILSRHSTDEVYLGQRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNK  773

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTLL PT E GL+GKGIPNS+SI
Sbjct  774  NLKNRVGPVKMPYTLLVPTSEGGLTGKGIPNSVSI  808



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGISLIEILSRH++DE+YLGQR+ PEWT D+  L+AF+ FGK L  +EE+I+  N + 
Sbjct  780  TILGISLIEILSRHSTDEVYLGQRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNK  839

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTLL PT E GL+GKGIPNS+SI
Sbjct  840  NLKNRVGPVKMPYTLLVPTSEGGLTGKGIPNSVSI  874



>gb|KDO56302.1| hypothetical protein CISIN_1g002839mg [Citrus sinensis]
Length=874

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGISLIEILSRH++DE+YLGQR+ PEWT D+  L+AF+ FGK L  +EE+I+  N + 
Sbjct  780  TILGISLIEILSRHSTDEVYLGQRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNK  839

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTLL PT E GL+GKGIPNS+SI
Sbjct  840  NLKNRVGPVKMPYTLLVPTSEGGLTGKGIPNSVSI  874



>gb|ADL41189.1| lipoxygenase [Camellia sinensis]
Length=868

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            ++LGISL+EILSRH +DE++LG+R+  +WT DK+ LEAFERFGK L  IE RI +MN D 
Sbjct  774  SILGISLVEILSRHTADEVFLGRRDTHDWTTDKKPLEAFERFGKTLTEIEARITRMNEDE  833

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K++NR GP  VPYTLLFPT   GL+GKGIPNS+SI
Sbjct  834  KMRNRVGPARVPYTLLFPTSGVGLTGKGIPNSVSI  868



>gb|AHX56188.1| lipoxygenase [Diospyros kaki]
Length=876

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHA+DEIYLGQRE P+WT D + LEAFERF   LV IE RI++ N D 
Sbjct  777  TLLGVSLIEILSRHATDEIYLGQRESPDWTSDAQPLEAFERFRMQLVQIEHRIVQRNNDK  836

Query  192  KLKNRTGPVNVPYTLLFPTGEE-----GLSGKGIPNSISI  296
            + KNR GPV VPYTLL+P+  +     GLSG GIPNS+SI
Sbjct  837  RWKNRFGPVKVPYTLLYPSTSDSIRASGLSGMGIPNSVSI  876



>ref|XP_004231274.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=841

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GIS IEILS H+SDEIYLGQR+ PEWT DK  L+A ERFGK L  I E+I+KMN D 
Sbjct  747  TLIGISAIEILSTHSSDEIYLGQRDTPEWTNDKAPLQALERFGKKLAEIAEKIIKMNNDK  806

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            K KNR GP  +PYTLL+   E GL+GKGIPNS+SI
Sbjct  807  KWKNRMGPTKMPYTLLYHISEPGLTGKGIPNSVSI  841



>ref|XP_004494612.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=863

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GISLIEILS H+SDE+YLGQR+   WT D E LEAFERFGK L  IE +I+ MN D 
Sbjct  769  TLIGISLIEILSTHSSDEVYLGQRDTVHWTYDAEPLEAFERFGKKLREIEGKIVAMNDDV  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR G V +PYTLL+PTGE GL+G GIPNS+SI
Sbjct  829  RLKNRVGVVKMPYTLLYPTGESGLAGTGIPNSVSI  863



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD-  188
            TLL IS++E+LS HASD +YLGQR+ PEWTKD+E + AFER GK L  IE++I++MN D 
Sbjct  769  TLLEISVLEVLSTHASDTLYLGQRDSPEWTKDQEPILAFERVGKKLSDIEDQIMQMNSDH  828

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             K KNR+GP  VPYTLLFPT EEGL+GKGIPNSI+I
Sbjct  829  QKWKNRSGPAKVPYTLLFPTSEEGLTGKGIPNSINI  864



>gb|KDO74648.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=803

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH++DE+YLGQR+ PEWT D E L AFERFG  L+ IE RIL+MN D 
Sbjct  704  TLLGVSLIEILSRHSTDEVYLGQRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDK  763

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNR G V VPYTLL+P     + E GL+GKGIPNS+SI
Sbjct  764  RWKNRVGAVKVPYTLLYPNTSDYSREGGLTGKGIPNSVSI  803



>dbj|BAB01777.1| lipoxygenase [Arabidopsis thaliana]
Length=882

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D E LEAF+RFGK L  IE  I++ N D 
Sbjct  783  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDK  842

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNRTGPVN+PYTLL+P     T E G++GKGIPNS+SI
Sbjct  843  RFKNRTGPVNIPYTLLYPNTTDYTREGGITGKGIPNSVSI  882



>emb|CAC19365.1| lipoxygenase [Arabidopsis thaliana]
Length=854

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D E LEAF+RFGK L  IE  I++ N D 
Sbjct  755  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDK  814

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNRTGPVN+PYTLL+P     T E G++GKGIPNS+SI
Sbjct  815  RFKNRTGPVNIPYTLLYPNTTDYTREGGITGKGIPNSVSI  854



>ref|NP_188879.2| lipoxygenase 5 [Arabidopsis thaliana]
 sp|Q9LUW0.2|LOX5_ARATH RecName: Full=Linoleate 9S-lipoxygenase 5, chloroplastic; AltName: 
Full=Lipoxygenase 5; Short=AtLOX5 [Arabidopsis thaliana]
 gb|AEE76630.1| lipoxygenase 5 [Arabidopsis thaliana]
Length=886

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IEILS H++DEIYLGQR+ P WT D E LEAF+RFGK L  IE  I++ N D 
Sbjct  787  TLLGISIIEILSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDK  846

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNRTGPVN+PYTLL+P     T E G++GKGIPNS+SI
Sbjct  847  RFKNRTGPVNIPYTLLYPNTTDYTREGGITGKGIPNSVSI  886



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH++DE+YLGQR+ PEWT D E L AFERFG  L+ IE RIL+MN D 
Sbjct  783  TLLGVSLIEILSRHSTDEVYLGQRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDK  842

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNR G V VPYTLL+P     + E GL+GKGIPNS+SI
Sbjct  843  RWKNRVGAVKVPYTLLYPNTSDYSREGGLTGKGIPNSVSI  882



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH++DE+YLGQR+ PEWT D E L AFERFG  L+ IE RIL+MN D 
Sbjct  783  TLLGVSLIEILSRHSTDEVYLGQRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDK  842

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            + KNR G V VPYTLL+P     + E GL+GKGIPNS+SI
Sbjct  843  RWKNRVGAVKVPYTLLYPNTSDYSREGGLTGKGIPNSVSI  882



>gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGISLIEILSRHASDE+YLGQR+ PEWT D++ LEAF++FGK L  IEE I++MN D 
Sbjct  776  TVLGISLIEILSRHASDEVYLGQRDTPEWTTDEKPLEAFKQFGKKLEKIEEGIIEMNKDV  835

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            +LKNR GPV + YTLL P+ E GL+G+GIPNS+SI
Sbjct  836  QLKNRVGPVLMTYTLLVPSSEVGLTGRGIPNSVSI  870



>ref|XP_003591120.1| Lipoxygenase [Medicago truncatula]
 gb|AES61371.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=858

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             +LG+SL+EILSRHASDE+YLGQR+ P+WT D +ALEAFE+FG  LV IE+RI  MN D 
Sbjct  764  AVLGLSLVEILSRHASDEVYLGQRDTPDWTSDIKALEAFEKFGNKLVEIEKRIGIMNNDE  823

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNR GPV + YTLL PT E GL+G GIPNSISI
Sbjct  824  KLKNRFGPVKMSYTLLKPTSEGGLTGMGIPNSISI  858



>ref|NP_001267584.1| probable linoleate 9S-lipoxygenase 5-like [Cucumis sativus]
 emb|CAB83038.1| lipoxygenase-9 [Cucumis sativus]
Length=881

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIE LSRH+ DEIYLGQR+ PEWTKD+EAL AFERFG  L  IEE+I++MN + 
Sbjct  782  TILGVSLIESLSRHSVDEIYLGQRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEE  841

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            K +NR GPV +PYT LFP       EEGL+ +GIPNSISI
Sbjct  842  KWRNRVGPVKMPYTFLFPNTSNYYEEEGLNARGIPNSISI  881



>ref|XP_009406047.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=873

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T++G+SL+EILS HASDE+YLGQR+  EWT D++ALEAF+RFGK L +IE+ I K N D 
Sbjct  779  TIIGVSLLEILSTHASDEVYLGQRDTSEWTTDRKALEAFQRFGKALKSIEDDINKKNADP  838

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR GP  +P+TLLFP+ E G++GKGIPNS+SI
Sbjct  839  SLKNRNGPAKMPFTLLFPSSEVGITGKGIPNSVSI  873



>ref|XP_004296897.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=884

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIE+LSRHA+DEIYLGQR+ PEWT D EAL AF RFG+ L+ IE+RI + N D 
Sbjct  785  TLLGVSLIEVLSRHATDEIYLGQRDTPEWTSDGEALAAFGRFGEKLIEIEKRITERNRDE  844

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            +LKNR GP+ +PYTLL+P+      E GL+GKGIPNSISI
Sbjct  845  RLKNRVGPIKMPYTLLYPSTSDYSREGGLTGKGIPNSISI  884



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH+SDEIYLGQR+ PEWT D +  +AF+RF   LV +E RI+KMN D 
Sbjct  777  TLLGVSLIEILSRHSSDEIYLGQRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVKMNNDS  836

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            + KNR GPV VPY LL+P       E GL+GKGIPNS+SI
Sbjct  837  RWKNRNGPVKVPYMLLYPNASGDNSESGLTGKGIPNSVSI  876



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH+SDEIYLGQR+ PEWT D +  +AF+RF   LV +E RI+KMN D 
Sbjct  787  TLLGVSLIEILSRHSSDEIYLGQRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVKMNNDS  846

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            + KNR GPV VPY LL+P       E GL+GKGIPNS+SI
Sbjct  847  RWKNRNGPVKVPYMLLYPNASGDNSESGLTGKGIPNSVSI  886



>gb|AHI86055.1| lipoxygenase, partial [Cucumis melo var. makuwa]
Length=880

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIE LSRH+ DEIYLGQR+ PEWTKD+EAL AFERFG  L  IEE+I++MN + 
Sbjct  781  TILGVSLIESLSRHSVDEIYLGQRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEE  840

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            K +NR GPV +PYT LFP       EEGL+ +GIPNSISI
Sbjct  841  KWRNRVGPVKMPYTFLFPNTSNYYEEEGLNARGIPNSISI  880



>ref|XP_008449553.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=881

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIE LSRH+ DEIYLGQR+ PEWTKD+EAL AFERFG  L  IEE+I++MN + 
Sbjct  782  TILGVSLIESLSRHSVDEIYLGQRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEE  841

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            K +NR GPV +PYT LFP       EEGL+ +GIPNSISI
Sbjct  842  KWRNRVGPVKMPYTFLFPNTSNYYEEEGLNARGIPNSISI  881



>gb|AGH13205.1| lipoxygenase [Salvia miltiorrhiza]
Length=856

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   LLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDGK  194
            +LGISL+EILSRH+SDEIYLGQR+ PEWT D EA +AFERFG  L   E++ + +N D +
Sbjct  763  VLGISLVEILSRHSSDEIYLGQRDSPEWTADTEARKAFERFGDRLRETEQKFIDLNNDKR  822

Query  195  LKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             +NR+GPV +PYTLL+P+ E GL+G+GIPNSISI
Sbjct  823  WRNRSGPVKMPYTLLYPSSEIGLTGRGIPNSISI  856



>ref|XP_010466519.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Camelina 
sativa]
Length=889

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGIS+IE LS H++DE+YLGQRE P WT D EALEAF RF K L  IE  I++ N D 
Sbjct  790  TLLGISIIETLSMHSTDEVYLGQRESPNWTADDEALEAFRRFEKELELIENNIIRRNNDK  849

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
            +LKNRTGPVN+PYTLL+P     T E GL+GKGIPNS+SI
Sbjct  850  RLKNRTGPVNIPYTLLYPNTTDYTREGGLTGKGIPNSVSI  889



>ref|XP_004230207.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=863

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  3    LPLTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMN  182
            LP ++LGISLIE LS H SDE++LG+R  PEWT D+E L+AFERFGK L  IE++I+KMN
Sbjct  767  LPQSILGISLIEALSLHTSDEVFLGKRA-PEWTTDEEPLQAFERFGKKLEEIEQKIIKMN  825

Query  183  GDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             D  LKNR GP N+PYTLL P+ E GL+G+GIPNS+SI
Sbjct  826  DDPNLKNRVGPANIPYTLLCPSSELGLTGRGIPNSVSI  863



>ref|XP_002521992.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF40396.1| lipoxygenase, putative [Ricinus communis]
Length=865

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +3

Query  6    PLTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNG  185
            PL LLGISL+EILS H+SDE YL QR +P+WT D E L+AF++F + L  I ERIL+ N 
Sbjct  770  PLALLGISLVEILSMHSSDEEYLDQR-NPDWTSDTEPLQAFKKFQETLKEIGERILERNR  828

Query  186  DGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KLKNR GPVN+PYTLLFPT EEGL+GKGIPNS+SI
Sbjct  829  NAKLKNRVGPVNMPYTLLFPTSEEGLTGKGIPNSVSI  865



>ref|XP_007030811.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11313.1| Lipoxygenase 1 [Theobroma cacao]
Length=843

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPE-WTKDKEALEAFERFGKXLVAIEERILKMNG  185
            +TLLG+SLIEILS+H+ DE+YLGQR  P+ WT D   L+AF  FG  L  IE+RI++MN 
Sbjct  747  MTLLGVSLIEILSKHSPDEVYLGQRSDPDKWTTDAAPLKAFNDFGNKLSQIEQRIIQMNH  806

Query  186  DGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            D  LKNR+GPVNV YTLLFPT E GL+GKGIPNS+SI
Sbjct  807  DKTLKNRSGPVNVLYTLLFPTSESGLTGKGIPNSVSI  843



>gb|KJB80909.1| hypothetical protein B456_013G121100 [Gossypium raimondii]
Length=254

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIE+LSRHA+DEIYLG+R+  EWT D E L  FERFGK LV I+ RI++ N D 
Sbjct  155  TLLGVSLIEVLSRHATDEIYLGKRDTAEWTIDDEPLATFERFGKKLVEIDSRIMETNNDI  214

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
             LKNR G + VPYTLL+P     + E GL+GKGIPNSISI
Sbjct  215  NLKNRVGSMKVPYTLLYPNTSDYSREGGLTGKGIPNSISI  254



>ref|XP_003626279.1| Chalcone synthase [Medicago truncatula]
Length=1317

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+GISLIEILS H+SDE+YLGQR+   WT D E LEAF+RFGK L  IEERI+ MN D 
Sbjct  791  TLVGISLIEILSTHSSDEVYLGQRDSMHWTCDAEPLEAFDRFGKKLKEIEERIVAMNDDV  850

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI*FLWL  311
             LKNR GPV +PYTLL+P  E GL+G GIPNS+    +W+
Sbjct  851  NLKNRVGPVKMPYTLLYPRSEAGLTGAGIPNSVPEITIWI  890


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  15   LLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXL  149
            L+G+SLIEILS H+SDE+YLG+R+   W  D E LEAF++FGK L
Sbjct  932  LVGVSLIEILSAHSSDEVYLGERDTKHWIYDAEPLEAFDKFGKKL  976



>emb|CDY70916.1| BnaCnng70330D, partial [Brassica napus]
Length=504

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLGISLIEILS H+SDE+YLGQR+  EW  +KEALEAFE+FG  +  IE++I + N D 
Sbjct  410  TLLGISLIEILSTHSSDEVYLGQRDSKEWAAEKEALEAFEKFGDKVKEIEKKIDERNLDE  469

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNRTGPV +PYT LFPT E G++G+GIPNS+SI
Sbjct  470  NLKNRTGPVKMPYTSLFPTSEGGVTGRGIPNSVSI  504



>gb|KDP23726.1| hypothetical protein JCGZ_23559 [Jatropha curcas]
Length=868

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +3

Query  6    PLTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNG  185
            P  LLGI+LIEILSRH+SDE+YL QR  P WT DKE L+ F++F   L  I ERIL+ NG
Sbjct  773  PQALLGIALIEILSRHSSDEVYLDQRT-PGWTSDKEPLQEFKKFQDTLKEIGERILERNG  831

Query  186  DGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            D KLKNR GPVN+PYTLLFPT EEGL+ +GIPNSISI
Sbjct  832  DRKLKNRFGPVNMPYTLLFPTSEEGLTCQGIPNSISI  868



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDEIYLGQRE+PEWT D E  ++F+RF   LV +E RI++ N D 
Sbjct  778  TLLGVSLIEILSRHASDEIYLGQRENPEWTSDVEPRQSFQRFHDRLVDVENRIVERNNDS  837

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            + KNR GPV VPY LL+P       E GL+GKGIPNS+SI
Sbjct  838  RWKNRNGPVKVPYMLLYPNASGDNSESGLTGKGIPNSVSI  877



>ref|XP_007150490.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
 gb|ESW22484.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
Length=860

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+ +S+IEILSRHASDE+YLG+R++P WT D  ALEAF+RFGK L  IE+++ + N D 
Sbjct  766  TLVDLSVIEILSRHASDEVYLGERDNPNWTSDTRALEAFKRFGKKLSEIEKKLSQRNNDE  825

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KL+NR GPV +PYTLLFP+ +EGL+ +GIPNSISI
Sbjct  826  KLRNRYGPVMMPYTLLFPSSDEGLTFRGIPNSISI  860



>gb|AGE44830.1| lipoxygenase, partial [Zea mays]
Length=176

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 76/103 (74%), Gaps = 8/103 (8%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPE-WTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            T+LGISLIEILS+H+SDE+YLGQR+ PE WT D  AL+AF RFG  LV IE+RI  MN  
Sbjct  74   TILGISLIEILSKHSSDEVYLGQRDEPERWTSDARALDAFRRFGSRLVEIEKRIRTMNDS  133

Query  189  GKLKNRTGPVNVPYTLLFP-----TGE--EGLSGKGIPNSISI  296
              LKNR GPV +PY LL+P     TGE  EGL+  GIPNSISI
Sbjct  134  PTLKNRKGPVEMPYMLLYPNTSDVTGEKGEGLTAMGIPNSISI  176



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDEIYLGQRE+PEWT D E  ++F+RF   LV +E RI++ N D 
Sbjct  788  TLLGVSLIEILSRHASDEIYLGQRENPEWTSDVEPRQSFQRFHDRLVDVENRIVERNNDS  847

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            + KNR GPV VPY LL+P       E GL+GKGIPNS+SI
Sbjct  848  RWKNRNGPVKVPYMLLYPNASGDNSESGLTGKGIPNSVSI  887



>ref|XP_006650442.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Oryza brachyantha]
Length=863

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 6/101 (6%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGISLIE+LS+H+SDEIYLGQR+ PEWT D +ALEAF+RF + LV IE ++L MN D 
Sbjct  763  TILGISLIEVLSQHSSDEIYLGQRDTPEWTSDLKALEAFKRFSRKLVEIESKVLSMNKDP  822

Query  192  KLKNRTGPVNVPYTLLFPTGEE------GLSGKGIPNSISI  296
            +LKNR GP N PYTLLFP   +      G++ +GIPNSISI
Sbjct  823  RLKNRVGPANFPYTLLFPNTSDNKGAAAGITARGIPNSISI  863



>ref|XP_009387657.1| PREDICTED: linoleate 9S-lipoxygenase A-like [Musa acuminata subsp. 
malaccensis]
Length=861

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  9    LTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGD  188
            LT+LG+S IEILS HASDE+YLGQR+ PEWT D+ A++AFE FG+ L AIE  I+K NGD
Sbjct  766  LTVLGLSTIEILSNHASDEVYLGQRDTPEWTSDETAVKAFEGFGERLKAIEAEIMKRNGD  825

Query  189  GKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
              LKNR GP  +PYTLLFP+   G++G+GIPNSISI
Sbjct  826  PSLKNRNGPAKMPYTLLFPSSGVGITGRGIPNSISI  861



>ref|XP_004156414.1| PREDICTED: probable linoleate 9S-lipoxygenase 4-like [Cucumis 
sativus]
Length=879

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLG+R   EWT +K+ALE  E FGK +  +E  I++ N D 
Sbjct  785  TLLGVSLIEILSRHASDELYLGERASMEWTSEKDALELCEYFGKAMSEVESNIIERNKDV  844

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNRTGPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  845  NLKNRTGPVNVPYTLLLPSSAEGLTGRGIPNSISI  879



>ref|XP_010674736.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            ++LGISLIE+LSRH +DE+YLGQRE  EWT D   LEAFERFGK +  IE++I++ N DG
Sbjct  767  SVLGISLIELLSRHPTDEVYLGQRETREWTADSAPLEAFERFGKKVEEIEDKIVERNKDG  826

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            + KNR GPV +PYTLL+P+ E GL+G+GIPNS S+
Sbjct  827  RWKNRVGPVKLPYTLLYPSSEAGLTGRGIPNSTSV  861



>gb|ABF98394.1| Lipoxygenase 3, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG92325.1| unnamed protein product [Oryza sativa Japonica Group]
Length=459

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 7/102 (7%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LGISLIEILS+H+SDE+YLGQR+ PEWT D +AL+AF+RFG  LV IE RI  MNG+ 
Sbjct  358  TILGISLIEILSKHSSDEVYLGQRDTPEWTSDAKALDAFKRFGSRLVDIENRIKDMNGNS  417

Query  192  KLKNRTGPVNVPYTLLFPTGE-------EGLSGKGIPNSISI  296
             LKNR GPV +PY LL+P          +GL+  GIPNSISI
Sbjct  418  ALKNRNGPVKMPYMLLYPNTSDVTKEKGQGLTAMGIPNSISI  459



>ref|XP_002516771.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF45385.1| lipoxygenase, putative [Ricinus communis]
Length=868

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 75/100 (75%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH +DE+YLGQR+  EWT D+E L AFERF + L  IE +I+ MN D 
Sbjct  769  TLLGVSLIEILSRHPTDEVYLGQRDTAEWTSDREPLAAFERFSERLKEIENKIMDMNSDN  828

Query  192  KLKNRTGPVNVPYTLLFPTGEE-----GLSGKGIPNSISI  296
            K KNR GPV VPYTLLFP   +     GL+GKGIPNSISI
Sbjct  829  KYKNRIGPVKVPYTLLFPNTSDESRQGGLTGKGIPNSISI  868



>ref|XP_004139169.1| PREDICTED: probable linoleate 9S-lipoxygenase 4-like [Cucumis 
sativus]
Length=788

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRHASDE+YLG+R   EWT +K+ALE  E FGK +  +E  I++ N D 
Sbjct  694  TLLGVSLIEILSRHASDELYLGERASTEWTSEKDALELCEYFGKAMSEVESNIIERNKDV  753

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVNVPYTLL P+  EGL+G+GIPNSISI
Sbjct  754  NLKNRSGPVNVPYTLLLPSSAEGLTGRGIPNSISI  788



>ref|XP_004302419.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=919

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG++ IEILSRH++DEIYLGQRE  EWT D + LEA E F   L A+ ER+ KMN D 
Sbjct  825  TLLGMASIEILSRHSADEIYLGQRESQEWTADTKVLEASENFRSKLKAVGERVTKMNKDD  884

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
            KLKNRTGP  +PYTLL+P+ E GL+GKGIPNS+SI
Sbjct  885  KLKNRTGPAKMPYTLLYPSSEPGLTGKGIPNSVSI  919



>emb|CAN62372.1| hypothetical protein VITISV_036476 [Vitis vinifera]
Length=289

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIEILSRH++DEIYLGQR+ PEWT D E L AFERFG  L  IE RI +MN D 
Sbjct  190  TLLGVSLIEILSRHSTDEIYLGQRDTPEWTSDAEPLAAFERFGSRLRGIETRINQMNQDR  249

Query  192  KLKNRTGPVNVPYTLLFPTGEE-----GLSGKGIPNSISI  296
            +  NR GPV + YTLL+P   +     GL+GKGIPNS+SI
Sbjct  250  RWNNRFGPVEMQYTLLYPNTSDYSRQGGLAGKGIPNSVSI  289



>gb|AAB20898.1| lipoxygenase, partial [Glycine max]
Length=599

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+ +S+IEILSRHASDEIYLG+RE P WT DK+ALEAF+RFG  L  IE +I   N D 
Sbjct  505  TLIDLSVIEILSRHASDEIYLGERETPNWTTDKKALEAFKRFGSKLTGIEGKINARNSDP  564

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L+NRTGPV +PYTLL  + EEGL+ KGIPNSISI
Sbjct  565  SLRNRTGPVQLPYTLLHRSSEEGLTFKGIPNSISI  599



>ref|XP_004139170.1| PREDICTED: LOW QUALITY PROTEIN: linoleate 9S-lipoxygenase 6-like 
[Cucumis sativus]
Length=867

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             L+ IS+IEILS+HASDE+YLGQR   +WT DK ALEAFE+FGK L  +E RI++ N + 
Sbjct  773  ALVSISIIEILSKHASDEVYLGQRASIDWTSDKIALEAFEKFGKNLFEVENRIMERNKEV  832

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVN+PYTLL P+  EGL+G+GIPNSISI
Sbjct  833  NLKNRSGPVNLPYTLLVPSSNEGLTGRGIPNSISI  867



>ref|XP_004496744.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496745.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496746.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=858

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIE+LSRH+++EIYLGQRE+P+WT D E L AFERF + L+ IE+ I+K N D 
Sbjct  759  TLLGVSLIEVLSRHSTEEIYLGQRENPDWTLDAEPLAAFERFSQKLLKIEDNIMKRNKDP  818

Query  192  KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  296
             LKNR GPV +PYTLLFP     + E GL+GKGIPNSISI
Sbjct  819  SLKNRNGPVKLPYTLLFPNTSDYSREGGLTGKGIPNSISI  858



>ref|XP_004156415.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis sativus]
Length=878

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             L+ IS+IEILS+HASDE+YLGQR   +WT DK ALEAFE+FGK L  +E RI++ N + 
Sbjct  784  ALVSISIIEILSKHASDEVYLGQRASIDWTSDKIALEAFEKFGKNLFEVENRIMERNKEV  843

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVN+PYTLL P+  EGL+G+GIPNSISI
Sbjct  844  NLKNRSGPVNLPYTLLVPSSNEGLTGRGIPNSISI  878



>gb|AAC61785.1| lipoxygenase 1 [Cucumis sativus]
Length=878

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             L+ IS+IEILS+HASDE+YLGQR   +WT DK ALEAFE+FGK L  +E RI++ N + 
Sbjct  784  ALVSISIIEILSKHASDEVYLGQRASIDWTSDKIALEAFEKFGKNLFEVENRIMERNKEV  843

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVN+PYTLL P+  EGL+G+GIPNSISI
Sbjct  844  NLKNRSGPVNLPYTLLVPSSNEGLTGRGIPNSISI  878



>emb|CAA63483.1| lipoxygenase [Cucumis sativus]
Length=878

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
             L+ IS+IEILS+HASDE+YLGQR   +WT DK ALEAFE+FGK L  +E RI++ N + 
Sbjct  784  ALVSISIIEILSKHASDEVYLGQRASIDWTSDKIALEAFEKFGKNLFEVENRIMERNKEV  843

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             LKNR+GPVN+PYTLL P+  EGL+G+GIPNSISI
Sbjct  844  NLKNRSGPVNLPYTLLVPSSNEGLTGRGIPNSISI  878



>emb|CAE17327.1| lipoxygenase [Fragaria x ananassa]
Length=884

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TLLG+SLIE+LSRHA+DEIYLGQR+ PEWT D EAL AF RFG+ L+ IE+RI +   D 
Sbjct  785  TLLGVSLIEVLSRHATDEIYLGQRDTPEWTSDGEALAAFGRFGEKLIEIEKRITERTRDE  844

Query  192  KLKNRTGPVNVPYTLLFPTG-----EEGLSGKGIPNSISI  296
            +LKNR GP+ +PYTLL+P+      E GL+GKGIPNSISI
Sbjct  845  RLKNRVGPIKMPYTLLYPSTSDYSREGGLTGKGIPNSISI  884



>ref|XP_003597558.1| Lipoxygenase [Medicago truncatula]
 gb|AES67809.1| seed linoleate 9S-lipoxygenase [Medicago truncatula]
Length=863

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            TL+ +S+IEILSRHASDE+YLGQRE+P WT D +AL+AF++FG  L  IE ++ K N D 
Sbjct  769  TLIDLSVIEILSRHASDEVYLGQRENPHWTSDSKALQAFQKFGNKLAEIEAKLAKKNNDP  828

Query  192  KLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  296
             L NR GPV +PYTLL PT EEGL+ +GIPNSISI
Sbjct  829  SLNNRLGPVQLPYTLLHPTSEEGLTFRGIPNSISI  863



>dbj|BAD02945.1| 9-lipoxigenase [Oryza sativa Japonica Group]
Length=863

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 6/101 (6%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIEILS+H++DEIYLGQR+ PEWT D +ALEAF+RF + LV IE ++L MN D 
Sbjct  763  TILGVSLIEILSKHSADEIYLGQRDTPEWTSDPKALEAFKRFSRQLVEIESKVLNMNKDP  822

Query  192  KLKNRTGPVNVPYTLLFPT------GEEGLSGKGIPNSISI  296
             LKNR GP N PYTL+FP         EG++ +GIPNSISI
Sbjct  823  LLKNRVGPANFPYTLMFPNTSDNKGAAEGITARGIPNSISI  863



>gb|ACE79245.1| lipoxygenase-1 [Oryza sativa Indica Group]
Length=867

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 6/101 (6%)
 Frame = +3

Query  12   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKXLVAIEERILKMNGDG  191
            T+LG+SLIEILS+H++DEIYLGQR+ PEWT D +ALEAF+RF + LV IE ++L MN D 
Sbjct  767  TILGVSLIEILSKHSADEIYLGQRDTPEWTSDPKALEAFKRFSRQLVEIESKVLNMNKDP  826

Query  192  KLKNRTGPVNVPYTLLFPT------GEEGLSGKGIPNSISI  296
             LKNR GP N PYTL+FP         EG++ +GIPNSISI
Sbjct  827  LLKNRVGPANFPYTLMFPNTSDNKGAAEGITARGIPNSISI  867



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115