BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I16

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362437.1|  PREDICTED: uncharacterized protein LOC102599991    254   5e-80   Solanum tuberosum [potatoes]
ref|XP_009599976.1|  PREDICTED: protein trichome birefringence-li...    248   1e-77   Nicotiana tomentosiformis
ref|XP_009781572.1|  PREDICTED: protein trichome birefringence-li...    247   3e-77   Nicotiana sylvestris
ref|XP_004232960.1|  PREDICTED: protein trichome birefringence-li...    246   2e-76   Solanum lycopersicum
ref|XP_011096427.1|  PREDICTED: protein trichome birefringence-li...    243   4e-75   Sesamum indicum [beniseed]
ref|XP_009599983.1|  PREDICTED: protein trichome birefringence-li...    238   2e-73   Nicotiana tomentosiformis
gb|ACU21157.1|  unknown                                                 230   2e-72   Glycine max [soybeans]
gb|KDO77824.1|  hypothetical protein CISIN_1g017263mg                   229   5e-72   Citrus sinensis [apfelsine]
ref|XP_007148060.1|  hypothetical protein PHAVU_006G177100g             232   2e-71   Phaseolus vulgaris [French bean]
ref|XP_010057074.1|  PREDICTED: protein trichome birefringence-li...    232   2e-71   Eucalyptus grandis [rose gum]
gb|KDO77823.1|  hypothetical protein CISIN_1g017263mg                   228   4e-71   Citrus sinensis [apfelsine]
ref|XP_006449479.1|  hypothetical protein CICLE_v10015687mg             231   5e-71   Citrus clementina [clementine]
ref|XP_006597476.1|  PREDICTED: protein YLS7-like                       230   1e-70   Glycine max [soybeans]
gb|KDO77821.1|  hypothetical protein CISIN_1g017263mg                   228   6e-70   Citrus sinensis [apfelsine]
gb|KDO77820.1|  hypothetical protein CISIN_1g017263mg                   228   7e-70   Citrus sinensis [apfelsine]
gb|KDO77822.1|  hypothetical protein CISIN_1g017263mg                   228   7e-70   Citrus sinensis [apfelsine]
ref|XP_009790075.1|  PREDICTED: protein trichome birefringence-li...    228   8e-70   Nicotiana sylvestris
gb|KDO77819.1|  hypothetical protein CISIN_1g017263mg                   228   8e-70   Citrus sinensis [apfelsine]
ref|XP_007025417.1|  Trichome birefringence-like 37 isoform 1           228   1e-69   
gb|AHN91976.1|  TBL1                                                    227   2e-69   Citrus sinensis [apfelsine]
ref|XP_006467669.1|  PREDICTED: protein YLS7-like                       227   2e-69   
gb|KHG20284.1|  Enolase                                                 226   3e-69   Gossypium arboreum [tree cotton]
ref|XP_004234094.1|  PREDICTED: protein trichome birefringence-li...    226   4e-69   
gb|KHN08449.1|  hypothetical protein glysoja_014214                     226   4e-69   Glycine soja [wild soybean]
ref|XP_003542986.1|  PREDICTED: protein YLS7-like isoform X1            226   5e-69   Glycine max [soybeans]
ref|XP_006594557.1|  PREDICTED: protein YLS7-like isoform X2            226   6e-69   Glycine max [soybeans]
gb|EYU28072.1|  hypothetical protein MIMGU_mgv1a008400mg                225   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_007211863.1|  hypothetical protein PRUPE_ppa010079mg             219   8e-68   
gb|KJB69610.1|  hypothetical protein B456_011G033800                    223   1e-67   Gossypium raimondii
gb|KDP21076.1|  hypothetical protein JCGZ_21547                         222   2e-67   Jatropha curcas
gb|KJB68384.1|  hypothetical protein B456_010G242200                    222   2e-67   Gossypium raimondii
ref|XP_006305057.1|  hypothetical protein CARUB_v10009422mg             222   3e-67   Capsella rubella
ref|XP_007153710.1|  hypothetical protein PHAVU_003G058400g             221   3e-67   Phaseolus vulgaris [French bean]
emb|CAJ40777.1|  alpha galactosidase precursor                          221   3e-67   Coffea arabica [arabica coffee]
emb|CDO96761.1|  unnamed protein product                                221   4e-67   Coffea canephora [robusta coffee]
ref|XP_004485883.1|  PREDICTED: uncharacterized protein LOC101498973    221   4e-67   Cicer arietinum [garbanzo]
gb|KJB34893.1|  hypothetical protein B456_006G088800                    221   8e-67   Gossypium raimondii
ref|XP_011045911.1|  PREDICTED: protein trichome birefringence-li...    220   1e-66   Populus euphratica
ref|XP_009410826.1|  PREDICTED: protein trichome birefringence-li...    220   1e-66   
ref|XP_010460674.1|  PREDICTED: protein trichome birefringence-li...    219   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010480710.1|  PREDICTED: protein trichome birefringence-li...    220   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_008225213.1|  PREDICTED: protein trichome birefringence-li...    219   3e-66   Prunus mume [ume]
ref|XP_010499424.1|  PREDICTED: protein trichome birefringence-li...    219   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_003593750.1|  hypothetical protein MTR_2g015720                  218   4e-66   Medicago truncatula
ref|XP_011005473.1|  PREDICTED: protein trichome birefringence-li...    218   4e-66   Populus euphratica
ref|NP_564318.1|  protein trichome birefringence-like 38                218   8e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565779.1|  trichome birefringence-like 37 protein                218   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149051.1|  PREDICTED: uncharacterized protein LOC101203509    218   1e-65   Cucumis sativus [cucumbers]
ref|XP_008371453.1|  PREDICTED: protein trichome birefringence-li...    216   2e-65   Malus domestica [apple tree]
ref|XP_002893546.1|  hypothetical protein ARALYDRAFT_473111             217   3e-65   
ref|XP_006415616.1|  hypothetical protein EUTSA_v10007896mg             217   3e-65   Eutrema salsugineum [saltwater cress]
ref|XP_010549391.1|  PREDICTED: protein trichome birefringence-li...    217   3e-65   Tarenaya hassleriana [spider flower]
ref|XP_009348409.1|  PREDICTED: protein trichome birefringence-li...    214   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_003529365.1|  PREDICTED: protein YLS7-like                       214   2e-64   Glycine max [soybeans]
ref|XP_008443074.1|  PREDICTED: protein trichome birefringence-li...    216   3e-64   Cucumis melo [Oriental melon]
ref|XP_002522557.1|  conserved hypothetical protein                     213   5e-64   Ricinus communis
ref|XP_011460601.1|  PREDICTED: protein trichome birefringence-li...    213   5e-64   Fragaria vesca subsp. vesca
emb|CAN60202.1|  hypothetical protein VITISV_036403                     213   5e-64   Vitis vinifera
ref|XP_006410551.1|  hypothetical protein EUTSA_v10016785mg             213   6e-64   Eutrema salsugineum [saltwater cress]
emb|CBI30668.3|  unnamed protein product                                213   7e-64   Vitis vinifera
ref|XP_004134666.1|  PREDICTED: uncharacterized protein LOC101216213    212   8e-64   Cucumis sativus [cucumbers]
ref|XP_006294394.1|  hypothetical protein CARUB_v10023411mg             213   9e-64   Capsella rubella
ref|XP_010509796.1|  PREDICTED: protein trichome birefringence-li...    213   9e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002274664.1|  PREDICTED: protein trichome birefringence-li...    213   2e-63   Vitis vinifera
gb|AFK45250.1|  unknown                                                 211   3e-63   Lotus japonicus
ref|XP_010277748.1|  PREDICTED: protein trichome birefringence-li...    211   3e-63   Nelumbo nucifera [Indian lotus]
ref|XP_009102887.1|  PREDICTED: protein trichome birefringence-li...    211   4e-63   Brassica rapa
emb|CDX94643.1|  BnaC07g10150D                                          211   5e-63   
ref|XP_008383643.1|  PREDICTED: protein trichome birefringence-li...    210   8e-63   
ref|XP_010540499.1|  PREDICTED: protein trichome birefringence-li...    210   1e-62   Tarenaya hassleriana [spider flower]
gb|KFK44758.1|  hypothetical protein AALP_AA1G299000                    210   1e-62   Arabis alpina [alpine rockcress]
ref|XP_010469399.1|  PREDICTED: protein trichome birefringence-li...    210   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_008439751.1|  PREDICTED: protein trichome birefringence-li...    209   2e-62   Cucumis melo [Oriental melon]
ref|XP_009411213.1|  PREDICTED: protein trichome birefringence-li...    208   3e-62   
ref|XP_011086013.1|  PREDICTED: protein trichome birefringence-li...    208   3e-62   Sesamum indicum [beniseed]
ref|XP_009123178.1|  PREDICTED: protein trichome birefringence-li...    208   4e-62   Brassica rapa
ref|XP_010413780.1|  PREDICTED: protein trichome birefringence-li...    208   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009396650.1|  PREDICTED: protein trichome birefringence-li...    208   6e-62   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY64767.1|  BnaCnng44810D                                          208   6e-62   Brassica napus [oilseed rape]
ref|XP_003593751.1|  hypothetical protein MTR_2g015720                  208   6e-62   
ref|XP_002279857.1|  PREDICTED: protein trichome birefringence-li...    207   9e-62   Vitis vinifera
ref|XP_009352799.1|  PREDICTED: protein trichome birefringence-li...    207   9e-62   Pyrus x bretschneideri [bai li]
emb|CDX79555.1|  BnaC03g18910D                                          207   1e-61   
ref|XP_010279090.1|  PREDICTED: protein trichome birefringence-li...    206   1e-61   Nelumbo nucifera [Indian lotus]
gb|AES90337.2|  trichome birefringence-like protein                     206   2e-61   Medicago truncatula
ref|XP_003518885.1|  PREDICTED: protein YLS7-like                       206   3e-61   Glycine max [soybeans]
emb|CDY30832.1|  BnaC05g22080D                                          205   6e-61   Brassica napus [oilseed rape]
ref|XP_009141359.1|  PREDICTED: protein trichome birefringence-li...    205   8e-61   Brassica rapa
emb|CDY17220.1|  BnaA05g09680D                                          204   1e-60   Brassica napus [oilseed rape]
gb|KHN32337.1|  hypothetical protein glysoja_032520                     204   2e-60   Glycine soja [wild soybean]
ref|XP_006377552.1|  hypothetical protein POPTR_0011s07540g             199   3e-60   
emb|CDY17219.1|  BnaA05g09690D                                          203   4e-60   Brassica napus [oilseed rape]
ref|XP_009394133.1|  PREDICTED: protein trichome birefringence-li...    203   4e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007149752.1|  hypothetical protein PHAVU_005G096200g             202   9e-60   Phaseolus vulgaris [French bean]
emb|CDX84658.1|  BnaA03g15720D                                          202   1e-59   
ref|XP_009132974.1|  PREDICTED: protein trichome birefringence-li...    202   1e-59   Brassica rapa
ref|XP_010091711.1|  hypothetical protein L484_001474                   195   1e-59   
ref|XP_009143811.1|  PREDICTED: protein trichome birefringence-li...    201   3e-59   Brassica rapa
ref|XP_004149371.1|  PREDICTED: uncharacterized protein LOC101205461    200   5e-59   Cucumis sativus [cucumbers]
ref|XP_008783904.1|  PREDICTED: protein trichome birefringence-li...    200   6e-59   Phoenix dactylifera
ref|XP_002305083.1|  hypothetical protein POPTR_0004s05420g             201   7e-59   
ref|XP_002458239.1|  hypothetical protein SORBIDRAFT_03g029700          200   1e-58   Sorghum bicolor [broomcorn]
ref|XP_010915618.1|  PREDICTED: protein trichome birefringence-li...    198   3e-58   Elaeis guineensis
ref|XP_007132901.1|  hypothetical protein PHAVU_011G1346001g            193   5e-58   Phaseolus vulgaris [French bean]
ref|XP_003608110.1|  hypothetical protein MTR_4g087730                  196   1e-57   Medicago truncatula
ref|XP_010099368.1|  hypothetical protein L484_004794                   196   2e-57   Morus notabilis
ref|XP_003540392.1|  PREDICTED: protein YLS7 isoform 1                  196   2e-57   Glycine max [soybeans]
ref|XP_009143809.1|  PREDICTED: protein trichome birefringence-li...    196   3e-57   Brassica rapa
ref|XP_004487169.1|  PREDICTED: uncharacterized protein LOC101503983    195   3e-57   Cicer arietinum [garbanzo]
ref|XP_003543309.1|  PREDICTED: protein YLS7                            195   3e-57   Glycine max [soybeans]
gb|KHN36688.1|  hypothetical protein glysoja_001419                     195   4e-57   Glycine soja [wild soybean]
gb|ACJ84951.1|  unknown                                                 189   1e-56   Medicago truncatula
gb|ABA29158.1|  unknown                                                 194   1e-56   Pisum sativum [garden pea]
emb|CDM83556.1|  unnamed protein product                                194   2e-56   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003607566.1|  hypothetical protein MTR_4g079700                  190   4e-56   
ref|XP_010686317.1|  PREDICTED: protein trichome birefringence-li...    192   5e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004969334.1|  PREDICTED: uncharacterized protein LOC101766252    193   5e-56   Setaria italica
dbj|BAJ89025.1|  predicted protein                                      192   7e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA29157.1|  unknown                                                 191   1e-55   Pisum sativum [garden pea]
ref|XP_009591836.1|  PREDICTED: protein trichome birefringence-li...    190   2e-55   Nicotiana tomentosiformis
ref|NP_001043736.1|  Os01g0652100                                       191   2e-55   
ref|XP_006646157.1|  PREDICTED: protein YLS7-like                       192   3e-55   
gb|KDO63327.1|  hypothetical protein CISIN_1g017063mg                   186   3e-55   Citrus sinensis [apfelsine]
ref|XP_003569466.1|  PREDICTED: protein trichome birefringence-li...    190   4e-55   Brachypodium distachyon [annual false brome]
ref|XP_010506087.1|  PREDICTED: protein trichome birefringence-li...    190   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010517784.1|  PREDICTED: protein trichome birefringence-li...    189   6e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010912702.1|  PREDICTED: protein trichome birefringence-li...    189   7e-55   Elaeis guineensis
gb|AAF88130.1|AC021043_23  Unknown protein                              189   7e-55   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA58322.1|  TPA: putative DUF231 domain containing family pr...    189   8e-55   
gb|KEH39261.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    189   9e-55   Medicago truncatula
ref|XP_003607565.1|  hypothetical protein MTR_4g079700                  189   1e-54   Medicago truncatula
gb|KFK31236.1|  hypothetical protein AALP_AA6G086200                    189   1e-54   Arabis alpina [alpine rockcress]
ref|XP_011002532.1|  PREDICTED: protein trichome birefringence-li...    189   2e-54   Populus euphratica
gb|KDO63326.1|  hypothetical protein CISIN_1g017063mg                   186   2e-54   Citrus sinensis [apfelsine]
ref|XP_002881861.1|  hypothetical protein ARALYDRAFT_483351             188   2e-54   
ref|XP_010557124.1|  PREDICTED: protein trichome birefringence-li...    189   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_003608141.1|  Alpha galactosidase                                182   2e-54   
ref|NP_565975.1|  protein trichome birefringence-like 39                188   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414182.1|  PREDICTED: protein trichome birefringence-li...    188   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009784314.1|  PREDICTED: protein trichome birefringence-li...    188   2e-54   Nicotiana sylvestris
emb|CDY55393.1|  BnaA05g34290D                                          188   2e-54   Brassica napus [oilseed rape]
ref|XP_009142851.1|  PREDICTED: protein trichome birefringence-li...    188   3e-54   Brassica rapa
ref|XP_010052537.1|  PREDICTED: protein trichome birefringence-li...    187   3e-54   Eucalyptus grandis [rose gum]
ref|XP_009132768.1|  PREDICTED: protein trichome birefringence-li...    187   3e-54   Brassica rapa
ref|XP_006411518.1|  hypothetical protein EUTSA_v10016832mg             187   4e-54   Eutrema salsugineum [saltwater cress]
ref|XP_006294476.1|  hypothetical protein CARUB_v10023492mg             187   4e-54   Capsella rubella
ref|XP_007211024.1|  hypothetical protein PRUPE_ppa019892mg             180   4e-54   
emb|CDY23962.1|  BnaC03g17290D                                          187   4e-54   Brassica napus [oilseed rape]
ref|XP_002325581.2|  hypothetical protein POPTR_0019s11990g             187   4e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010552824.1|  PREDICTED: protein trichome birefringence-li...    187   4e-54   Tarenaya hassleriana [spider flower]
gb|KFK37109.1|  hypothetical protein AALP_AA4G214000                    187   4e-54   Arabis alpina [alpine rockcress]
emb|CAN82331.1|  hypothetical protein VITISV_007322                     187   4e-54   Vitis vinifera
ref|XP_004303168.1|  PREDICTED: protein trichome birefringence-li...    187   4e-54   Fragaria vesca subsp. vesca
ref|XP_010552884.1|  PREDICTED: protein trichome birefringence-li...    187   5e-54   Tarenaya hassleriana [spider flower]
ref|NP_001144145.1|  uncharacterized protein LOC100276997 precursor     187   6e-54   
ref|XP_009142074.1|  PREDICTED: protein trichome birefringence-li...    187   7e-54   
ref|XP_008675272.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    187   7e-54   
ref|XP_010915621.1|  PREDICTED: protein trichome birefringence-li...    184   8e-54   
gb|AAO42294.1|  unknown protein                                         186   8e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469762.1|  PREDICTED: protein trichome birefringence-li...    186   1e-53   Camelina sativa [gold-of-pleasure]
dbj|BAD44658.1|  unnamed protein product                                186   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077985.1|  protein TRICHOME BIREFRINGENCE-LIKE 40             186   1e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65091.1|  unknown                                                 186   1e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51515.1|  BnaC04g02360D                                          186   1e-53   Brassica napus [oilseed rape]
ref|XP_006410237.1|  hypothetical protein EUTSA_v10016834mg             186   1e-53   Eutrema salsugineum [saltwater cress]
ref|XP_004505509.1|  PREDICTED: uncharacterized protein LOC101514285    186   1e-53   Cicer arietinum [garbanzo]
emb|CDY14846.1|  BnaC04g48430D                                          186   1e-53   Brassica napus [oilseed rape]
emb|CDY47981.1|  BnaA04g24590D                                          186   1e-53   Brassica napus [oilseed rape]
ref|XP_010070349.1|  PREDICTED: protein trichome birefringence-li...    186   2e-53   Eucalyptus grandis [rose gum]
ref|XP_009593637.1|  PREDICTED: protein trichome birefringence-li...    186   2e-53   Nicotiana tomentosiformis
ref|XP_006446762.1|  hypothetical protein CICLE_v10015634mg             186   2e-53   Citrus clementina [clementine]
gb|EYU43352.1|  hypothetical protein MIMGU_mgv1a017695mg                185   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_002285609.1|  PREDICTED: protein trichome birefringence-li...    185   2e-53   Vitis vinifera
ref|XP_010552766.1|  PREDICTED: protein trichome birefringence-li...    186   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_010552686.1|  PREDICTED: protein trichome birefringence-li...    186   3e-53   Tarenaya hassleriana [spider flower]
ref|XP_004505135.1|  PREDICTED: uncharacterized protein LOC101503421    185   3e-53   Cicer arietinum [garbanzo]
ref|XP_010510241.1|  PREDICTED: protein trichome birefringence-li...    185   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006582288.1|  PREDICTED: protein YLS7-like                       185   3e-53   Glycine max [soybeans]
ref|XP_010272740.1|  PREDICTED: protein trichome birefringence-li...    185   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_006294317.1|  hypothetical protein CARUB_v10023325mg             186   4e-53   
gb|KDP31782.1|  hypothetical protein JCGZ_12243                         185   4e-53   Jatropha curcas
ref|XP_006469036.1|  PREDICTED: protein YLS7-like                       185   5e-53   Citrus sinensis [apfelsine]
gb|KCW89619.1|  hypothetical protein EUGRSUZ_A01902                     184   5e-53   Eucalyptus grandis [rose gum]
ref|NP_001241538.1|  uncharacterized protein LOC100786668 precursor     184   6e-53   Glycine max [soybeans]
ref|XP_010915620.1|  PREDICTED: protein trichome birefringence-li...    184   7e-53   
gb|EPS71829.1|  hypothetical protein M569_02929                         181   7e-53   Genlisea aurea
gb|KJB71444.1|  hypothetical protein B456_011G124000                    181   8e-53   Gossypium raimondii
ref|XP_002525125.1|  conserved hypothetical protein                     183   9e-53   
ref|XP_002881157.1|  hypothetical protein ARALYDRAFT_482040             184   9e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_011100405.1|  PREDICTED: protein trichome birefringence-li...    184   1e-52   
ref|XP_004967058.1|  PREDICTED: uncharacterized protein LOC101773522    183   1e-52   
ref|XP_009787170.1|  PREDICTED: protein trichome birefringence-li...    183   1e-52   Nicotiana sylvestris
ref|XP_008456435.1|  PREDICTED: protein trichome birefringence-li...    177   2e-52   Cucumis melo [Oriental melon]
gb|EYU41140.1|  hypothetical protein MIMGU_mgv1a008520mg                182   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_007050058.1|  Trichome birefringence-like 39                     182   3e-52   
gb|AFK40281.1|  unknown                                                 182   6e-52   Lotus japonicus
ref|XP_006442366.1|  hypothetical protein CICLE_v10024135mg             182   6e-52   Citrus clementina [clementine]
ref|XP_009357163.1|  PREDICTED: protein trichome birefringence-li...    182   7e-52   
ref|XP_006477896.1|  PREDICTED: protein YLS7-like                       182   7e-52   
ref|XP_008783903.1|  PREDICTED: protein trichome birefringence-li...    181   8e-52   Phoenix dactylifera
ref|XP_006348847.1|  PREDICTED: uncharacterized protein LOC102593679    181   9e-52   Solanum tuberosum [potatoes]
ref|XP_004248190.1|  PREDICTED: protein trichome birefringence-li...    181   1e-51   Solanum lycopersicum
gb|KJB71443.1|  hypothetical protein B456_011G124000                    181   1e-51   Gossypium raimondii
ref|XP_003537664.1|  PREDICTED: protein YLS7-like                       181   1e-51   Glycine max [soybeans]
ref|XP_008381569.1|  PREDICTED: protein trichome birefringence-li...    180   2e-51   Malus domestica [apple tree]
ref|XP_010272738.1|  PREDICTED: protein trichome birefringence-li...    180   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008244484.1|  PREDICTED: protein trichome birefringence-li...    180   2e-51   Prunus mume [ume]
emb|CDX97749.1|  BnaC04g41900D                                          180   3e-51   
ref|XP_006376352.1|  hypothetical protein POPTR_0013s12290g             180   3e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010272737.1|  PREDICTED: protein trichome birefringence-li...    180   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_004243406.1|  PREDICTED: protein trichome birefringence-li...    179   4e-51   Solanum lycopersicum
ref|XP_008781517.1|  PREDICTED: protein trichome birefringence-li...    179   4e-51   
ref|XP_010524990.1|  PREDICTED: protein trichome birefringence-li...    179   4e-51   Tarenaya hassleriana [spider flower]
gb|ACU19344.1|  unknown                                                 179   4e-51   Glycine max [soybeans]
ref|XP_010068952.1|  PREDICTED: protein trichome birefringence-li...    179   6e-51   Eucalyptus grandis [rose gum]
ref|XP_007211411.1|  hypothetical protein PRUPE_ppa007013mg             179   6e-51   Prunus persica
gb|AFW76573.1|  putative DUF231 domain containing family protein        179   8e-51   
gb|EPS72531.1|  hypothetical protein M569_02228                         171   8e-51   Genlisea aurea
emb|CDP15911.1|  unnamed protein product                                179   1e-50   Coffea canephora [robusta coffee]
ref|XP_010273481.1|  PREDICTED: protein trichome birefringence-li...    178   1e-50   Nelumbo nucifera [Indian lotus]
gb|AFK49604.1|  unknown                                                 178   1e-50   Lotus japonicus
ref|XP_008649169.1|  PREDICTED: protein trichome birefringence-li...    179   2e-50   
emb|CDP06046.1|  unnamed protein product                                173   2e-50   Coffea canephora [robusta coffee]
gb|KJB67475.1|  hypothetical protein B456_010G192400                    177   2e-50   Gossypium raimondii
ref|XP_007022285.1|  Trichome birefringence-like 38                     177   4e-50   
gb|KHG02694.1|  putative C7orf58                                        177   5e-50   Gossypium arboreum [tree cotton]
ref|XP_002437078.1|  hypothetical protein SORBIDRAFT_10g020920          177   6e-50   Sorghum bicolor [broomcorn]
ref|XP_008437676.1|  PREDICTED: protein trichome birefringence-li...    176   6e-50   Cucumis melo [Oriental melon]
gb|KJB74418.1|  hypothetical protein B456_011G293800                    176   9e-50   Gossypium raimondii
ref|XP_009354272.1|  PREDICTED: protein trichome birefringence-li...    176   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_011080615.1|  PREDICTED: protein trichome birefringence-li...    175   3e-49   Sesamum indicum [beniseed]
ref|XP_010272739.1|  PREDICTED: protein trichome birefringence-li...    174   3e-49   Nelumbo nucifera [Indian lotus]
gb|EMS68140.1|  hypothetical protein TRIUR3_18149                       170   3e-49   Triticum urartu
ref|XP_003599941.1|  hypothetical protein MTR_3g049330                  174   3e-49   Medicago truncatula
gb|KHN13696.1|  hypothetical protein glysoja_034006                     174   4e-49   Glycine soja [wild soybean]
ref|XP_010273288.1|  PREDICTED: protein trichome birefringence-li...    174   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006591157.1|  PREDICTED: protein YLS7-like                       174   4e-49   Glycine max [soybeans]
ref|XP_010273483.1|  PREDICTED: protein trichome birefringence-li...    174   5e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010925980.1|  PREDICTED: protein trichome birefringence-li...    173   7e-49   
ref|XP_008811067.1|  PREDICTED: protein trichome birefringence-li...    168   8e-49   
ref|XP_010106402.1|  hypothetical protein L484_008607                   174   1e-48   Morus notabilis
ref|XP_010911005.1|  PREDICTED: protein trichome birefringence-li...    167   1e-48   
ref|XP_010052993.1|  PREDICTED: protein trichome birefringence-li...    172   2e-48   Eucalyptus grandis [rose gum]
ref|XP_010670501.1|  PREDICTED: protein trichome birefringence-li...    172   2e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW67609.1|  hypothetical protein EUGRSUZ_F01364                     176   2e-48   Eucalyptus grandis [rose gum]
gb|EMT21950.1|  hypothetical protein F775_18320                         173   4e-48   
ref|XP_004499843.1|  PREDICTED: uncharacterized protein LOC101491454    171   5e-48   Cicer arietinum [garbanzo]
gb|KDO58610.1|  hypothetical protein CISIN_1g018353mg                   170   5e-48   Citrus sinensis [apfelsine]
gb|AAC63839.1|  unknown protein                                         165   8e-48   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02651.1|  unnamed protein product                                170   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009359359.1|  PREDICTED: protein trichome birefringence-li...    170   1e-47   Pyrus x bretschneideri [bai li]
gb|KDO58611.1|  hypothetical protein CISIN_1g018353mg                   170   1e-47   Citrus sinensis [apfelsine]
gb|EEE65823.1|  hypothetical protein OsJ_21562                          171   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002283620.1|  PREDICTED: protein trichome birefringence-li...    169   1e-47   Vitis vinifera
ref|XP_003598798.1|  hypothetical protein MTR_3g021060                  170   1e-47   Medicago truncatula
ref|XP_006448024.1|  hypothetical protein CICLE_v10015743mg             170   2e-47   Citrus clementina [clementine]
ref|XP_006407039.1|  hypothetical protein EUTSA_v10021040mg             170   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_008449501.1|  PREDICTED: protein trichome birefringence-li...    170   2e-47   Cucumis melo [Oriental melon]
ref|XP_006492255.1|  PREDICTED: protein YLS7-like                       170   2e-47   Citrus sinensis [apfelsine]
ref|XP_010547337.1|  PREDICTED: protein trichome birefringence-li...    170   2e-47   
ref|XP_010675282.1|  PREDICTED: protein trichome birefringence-li...    170   2e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010273482.1|  PREDICTED: protein trichome birefringence-li...    170   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_004500006.1|  PREDICTED: uncharacterized protein LOC101510811    169   3e-47   Cicer arietinum [garbanzo]
ref|XP_004305456.2|  PREDICTED: protein trichome birefringence-li...    169   3e-47   Fragaria vesca subsp. vesca
ref|NP_001057784.2|  Os06g0531400                                       170   3e-47   
ref|XP_010487295.1|  PREDICTED: protein trichome birefringence-li...    169   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_004143813.1|  PREDICTED: uncharacterized protein LOC101214809    169   4e-47   
ref|XP_009135400.1|  PREDICTED: protein trichome birefringence-li...    169   4e-47   Brassica rapa
ref|XP_010320724.1|  PREDICTED: protein trichome birefringence-li...    167   5e-47   
ref|XP_010502205.1|  PREDICTED: protein trichome birefringence-li...    168   6e-47   
ref|XP_008792962.1|  PREDICTED: protein PMR5                            169   6e-47   Phoenix dactylifera
ref|XP_007021951.1|  Trichome birefringence-like 37                     168   6e-47   
emb|CDX75793.1|  BnaC03g38760D                                          168   6e-47   
ref|XP_004294162.2|  PREDICTED: protein trichome birefringence-li...    169   6e-47   Fragaria vesca subsp. vesca
ref|XP_006657022.1|  PREDICTED: protein YLS7-like                       169   8e-47   Oryza brachyantha
ref|XP_010465402.1|  PREDICTED: protein trichome birefringence-li...    168   8e-47   
ref|XP_010064517.1|  PREDICTED: protein trichome birefringence-li...    172   9e-47   
ref|XP_007214202.1|  hypothetical protein PRUPE_ppa022459mg             167   9e-47   
ref|XP_010273484.1|  PREDICTED: protein trichome birefringence-li...    168   9e-47   Nelumbo nucifera [Indian lotus]
ref|XP_009769816.1|  PREDICTED: protein trichome birefringence-li...    168   9e-47   
ref|XP_011464795.1|  PREDICTED: protein trichome birefringence-li...    168   1e-46   
ref|XP_009587076.1|  PREDICTED: protein trichome birefringence-li...    168   1e-46   
gb|EEC80749.1|  hypothetical protein OsI_23232                          168   1e-46   
ref|XP_006852467.1|  hypothetical protein AMTR_s00021p00122990          169   1e-46   
ref|NP_974314.2|  protein trichome birefringence-like 41                167   1e-46   
dbj|BAH20432.1|  AT3G14850                                              167   1e-46   
ref|XP_004145251.1|  PREDICTED: uncharacterized protein LOC101208082    168   1e-46   
ref|XP_004229288.2|  PREDICTED: protein trichome birefringence-li...    167   2e-46   
gb|EMS46405.1|  hypothetical protein TRIUR3_26771                       168   2e-46   
ref|XP_004170379.1|  PREDICTED: uncharacterized LOC101217703            167   2e-46   
ref|XP_008386343.1|  PREDICTED: protein trichome birefringence-li...    164   2e-46   
ref|XP_010665974.1|  PREDICTED: protein trichome birefringence-li...    167   2e-46   
ref|XP_010999583.1|  PREDICTED: protein trichome birefringence-li...    167   2e-46   
ref|XP_010272758.1|  PREDICTED: protein trichome birefringence-li...    167   3e-46   
ref|XP_008342762.1|  PREDICTED: protein trichome birefringence-li...    167   3e-46   
ref|XP_010229738.1|  PREDICTED: protein trichome birefringence-li...    167   3e-46   
ref|XP_002304780.1|  hypothetical protein POPTR_0003s20060g             166   3e-46   
ref|XP_002882897.1|  hypothetical protein ARALYDRAFT_478900             166   4e-46   
gb|KJB45823.1|  hypothetical protein B456_007G331200                    166   4e-46   
ref|XP_010675348.1|  PREDICTED: protein trichome birefringence-li...    165   5e-46   
ref|XP_010920821.1|  PREDICTED: protein PMR5                            167   5e-46   
ref|XP_009354245.1|  PREDICTED: protein trichome birefringence-li...    166   5e-46   
ref|XP_008245551.1|  PREDICTED: protein trichome birefringence-li...    166   5e-46   
ref|XP_006387085.1|  hypothetical protein POPTR_1908s00200g             166   5e-46   
ref|XP_008228902.1|  PREDICTED: protein trichome birefringence-li...    166   7e-46   
ref|XP_002516811.1|  conserved hypothetical protein                     166   7e-46   
ref|XP_010685528.1|  PREDICTED: protein PMR5-like                       167   7e-46   
gb|KJB24278.1|  hypothetical protein B456_004G138200                    163   8e-46   
ref|XP_003551901.1|  PREDICTED: protein YLS7-like                       165   8e-46   
ref|XP_008457360.1|  PREDICTED: protein PMR5-like                       166   9e-46   
gb|ACU18958.1|  unknown                                                 165   9e-46   
ref|XP_006368594.1|  hypothetical protein POPTR_0001s06130g             164   1e-45   
ref|XP_011042149.1|  PREDICTED: protein trichome birefringence-li...    165   1e-45   
dbj|BAJ97035.1|  predicted protein                                      166   1e-45   
ref|XP_009409697.1|  PREDICTED: protein trichome birefringence-li...    165   1e-45   
ref|XP_004244290.1|  PREDICTED: protein trichome birefringence-li...    166   1e-45   
ref|XP_011042148.1|  PREDICTED: protein trichome birefringence-li...    165   1e-45   
ref|XP_010064516.1|  PREDICTED: protein trichome birefringence-li...    165   1e-45   
ref|XP_009370963.1|  PREDICTED: protein trichome birefringence-li...    165   2e-45   
ref|XP_008245553.1|  PREDICTED: protein trichome birefringence-li...    165   2e-45   
ref|XP_009790373.1|  PREDICTED: protein trichome birefringence-li...    164   2e-45   
ref|XP_010689958.1|  PREDICTED: protein trichome birefringence-li...    165   2e-45   
ref|XP_008245550.1|  PREDICTED: protein trichome birefringence-li...    164   2e-45   
ref|XP_007211478.1|  hypothetical protein PRUPE_ppa007592mg             164   2e-45   
ref|XP_011082791.1|  PREDICTED: protein trichome birefringence-li...    164   2e-45   
ref|XP_003545134.1|  PREDICTED: protein YLS7-like                       164   2e-45   
ref|XP_008783902.1|  PREDICTED: protein trichome birefringence-li...    164   2e-45   
ref|XP_002513104.1|  conserved hypothetical protein                     164   2e-45   
ref|XP_009334009.1|  PREDICTED: protein trichome birefringence-li...    164   3e-45   
ref|XP_006348399.1|  PREDICTED: uncharacterized protein LOC102583199    164   3e-45   
ref|XP_009790315.1|  PREDICTED: protein trichome birefringence-li...    164   3e-45   
ref|XP_004137309.1|  PREDICTED: uncharacterized protein LOC101211401    164   3e-45   
ref|XP_008451728.1|  PREDICTED: protein trichome birefringence-li...    164   4e-45   
ref|XP_011042150.1|  PREDICTED: protein trichome birefringence-li...    164   4e-45   
ref|XP_003552077.1|  PREDICTED: protein YLS7-like                       164   4e-45   
ref|XP_009590824.1|  PREDICTED: protein trichome birefringence-li...    164   4e-45   
ref|XP_004171432.1|  PREDICTED: uncharacterized LOC101219162            160   4e-45   
emb|CBI20118.3|  unnamed protein product                                171   5e-45   
gb|KDO63324.1|  hypothetical protein CISIN_1g017063mg                   164   5e-45   
ref|XP_004295669.1|  PREDICTED: protein trichome birefringence-li...    164   5e-45   
ref|XP_009340027.1|  PREDICTED: protein trichome birefringence-li...    163   5e-45   
ref|XP_007146400.1|  hypothetical protein PHAVU_006G037200g             164   5e-45   
ref|XP_007146779.1|  hypothetical protein PHAVU_006G069200g             164   6e-45   
ref|XP_002282459.1|  PREDICTED: protein trichome birefringence-li...    163   7e-45   
ref|XP_010670414.1|  PREDICTED: protein trichome birefringence-li...    163   8e-45   
ref|XP_011044588.1|  PREDICTED: protein trichome birefringence-li...    163   8e-45   
ref|XP_004295668.1|  PREDICTED: protein trichome birefringence-li...    163   9e-45   
ref|XP_008345148.1|  PREDICTED: protein trichome birefringence-li...    162   1e-44   
ref|XP_008226367.1|  PREDICTED: protein trichome birefringence-li...    162   1e-44   
ref|XP_002304779.2|  hypothetical protein POPTR_0003s20070g             162   1e-44   
ref|XP_007149000.1|  hypothetical protein PHAVU_005G032100g             162   1e-44   
gb|KHG17132.1|  CAS1 domain-containing 1                                162   1e-44   
ref|XP_008228904.1|  PREDICTED: protein trichome birefringence-li...    162   1e-44   
ref|XP_003552076.2|  PREDICTED: protein YLS7-like                       162   1e-44   
ref|XP_007212437.1|  hypothetical protein PRUPE_ppa016768mg             161   1e-44   
ref|XP_006602443.1|  PREDICTED: protein YLS7-like                       162   1e-44   
gb|KJB12977.1|  hypothetical protein B456_002G048200                    162   2e-44   
ref|XP_007213066.1|  hypothetical protein PRUPE_ppa020515mg             162   2e-44   
ref|XP_002317442.1|  hypothetical protein POPTR_0011s10730g             162   2e-44   
ref|XP_007021952.1|  Lustrin A-like, putative                           162   2e-44   
gb|KJB24277.1|  hypothetical protein B456_004G138200                    162   2e-44   
ref|XP_010264606.1|  PREDICTED: protein PMR5-like                       162   2e-44   
ref|XP_006298019.1|  hypothetical protein CARUB_v10014063mg             161   2e-44   
emb|CBI20116.3|  unnamed protein product                                161   2e-44   
ref|XP_011044590.1|  PREDICTED: protein trichome birefringence-li...    159   3e-44   
ref|XP_009783768.1|  PREDICTED: protein trichome birefringence-li...    161   3e-44   
emb|CDM82173.1|  unnamed protein product                                162   3e-44   
ref|XP_007142244.1|  hypothetical protein PHAVU_008G264500g             161   3e-44   
ref|XP_002283640.1|  PREDICTED: protein trichome birefringence-li...    162   3e-44   
gb|KDP41035.1|  hypothetical protein JCGZ_03567                         162   3e-44   
ref|XP_008381178.1|  PREDICTED: protein trichome birefringence-li...    161   3e-44   
ref|XP_004305820.2|  PREDICTED: protein trichome birefringence-li...    161   4e-44   
emb|CDP09209.1|  unnamed protein product                                160   4e-44   
gb|KHN02079.1|  hypothetical protein glysoja_028282                     161   4e-44   
ref|XP_003551258.1|  PREDICTED: protein YLS7-like                       161   5e-44   
gb|KHN19842.1|  hypothetical protein glysoja_043771                     161   6e-44   
ref|XP_009365265.1|  PREDICTED: protein trichome birefringence-li...    160   6e-44   
ref|XP_009376740.1|  PREDICTED: protein trichome birefringence-li...    160   6e-44   
gb|EYU31623.1|  hypothetical protein MIMGU_mgv1a017870mg                159   6e-44   
ref|XP_006348927.1|  PREDICTED: uncharacterized protein LOC102592...    158   6e-44   
ref|XP_003539337.1|  PREDICTED: protein YLS7-like                       160   9e-44   
ref|XP_008226366.1|  PREDICTED: protein trichome birefringence-li...    160   1e-43   
ref|XP_002277229.1|  PREDICTED: protein PMR5                            160   1e-43   
ref|XP_004140246.1|  PREDICTED: uncharacterized protein LOC101219162    159   1e-43   
ref|XP_009359366.1|  PREDICTED: protein trichome birefringence-li...    160   1e-43   
emb|CDX98498.1|  BnaC05g38770D                                          159   1e-43   
ref|XP_006442365.1|  hypothetical protein CICLE_v10023594mg             159   1e-43   
ref|XP_010552131.1|  PREDICTED: protein trichome birefringence-li...    159   1e-43   
gb|KGN47983.1|  hypothetical protein Csa_6G421770                       159   1e-43   
ref|XP_006852470.1|  hypothetical protein AMTR_s00021p00125740          155   1e-43   
ref|XP_007216008.1|  hypothetical protein PRUPE_ppa014688mg             159   2e-43   
ref|XP_004137221.1|  PREDICTED: uncharacterized protein LOC101208056    159   2e-43   
ref|XP_010535032.1|  PREDICTED: protein trichome birefringence-li...    159   2e-43   
ref|XP_009590818.1|  PREDICTED: protein trichome birefringence-li...    159   2e-43   
gb|KDP39802.1|  hypothetical protein JCGZ_03938                         159   2e-43   
ref|XP_009769585.1|  PREDICTED: protein trichome birefringence-li...    159   3e-43   
emb|CBI22044.3|  unnamed protein product                                163   3e-43   
ref|XP_007149522.1|  hypothetical protein PHAVU_005G077300g             158   4e-43   
ref|XP_008451727.1|  PREDICTED: protein trichome birefringence-li...    158   4e-43   
gb|KCW67608.1|  hypothetical protein EUGRSUZ_F01363                     158   4e-43   
ref|XP_004295667.1|  PREDICTED: protein trichome birefringence-li...    158   4e-43   
ref|XP_002515611.1|  conserved hypothetical protein                     155   4e-43   
gb|KFK38836.1|  hypothetical protein AALP_AA3G166600                    158   5e-43   
ref|XP_009603133.1|  PREDICTED: protein trichome birefringence-li...    158   5e-43   
ref|XP_002887755.1|  hypothetical protein ARALYDRAFT_316771             158   6e-43   
ref|XP_003634905.1|  PREDICTED: protein trichome birefringence-li...    158   6e-43   
ref|XP_011044589.1|  PREDICTED: protein trichome birefringence-li...    157   6e-43   
ref|XP_003599590.1|  hypothetical protein MTR_3g035830                  157   6e-43   
ref|XP_009146313.1|  PREDICTED: protein trichome birefringence-li...    157   7e-43   
ref|XP_010323651.1|  PREDICTED: protein trichome birefringence-li...    155   7e-43   
gb|KJB12978.1|  hypothetical protein B456_002G048200                    158   7e-43   
ref|XP_006348926.1|  PREDICTED: uncharacterized protein LOC102592...    157   7e-43   
emb|CDX97608.1|  BnaA05g24710D                                          157   7e-43   
ref|XP_008673993.1|  PREDICTED: protein trichome birefringence-li...    158   8e-43   
emb|CBI17734.3|  unnamed protein product                                158   9e-43   
ref|XP_010675285.1|  PREDICTED: protein trichome birefringence-li...    158   9e-43   
gb|AFK41428.1|  unknown                                                 157   9e-43   
ref|XP_010032987.1|  PREDICTED: protein trichome birefringence-li...    157   9e-43   
ref|XP_010323652.1|  PREDICTED: protein trichome birefringence-li...    155   1e-42   
ref|XP_009766231.1|  PREDICTED: protein PMR5-like                       158   1e-42   
ref|XP_010915622.1|  PREDICTED: protein trichome birefringence-li...    157   1e-42   
ref|XP_010035886.1|  PREDICTED: protein trichome birefringence-li...    157   1e-42   
ref|XP_008228905.1|  PREDICTED: protein trichome birefringence-li...    157   1e-42   
ref|XP_010032986.1|  PREDICTED: protein trichome birefringence-li...    157   1e-42   
ref|XP_010675287.1|  PREDICTED: protein trichome birefringence-li...    157   1e-42   
ref|XP_002317443.1|  hypothetical protein POPTR_0011s10740g             157   1e-42   
gb|KEH38565.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    157   1e-42   
gb|KCW52497.1|  hypothetical protein EUGRSUZ_J01893                     157   2e-42   
ref|XP_006477835.1|  PREDICTED: protein YLS7-like                       157   2e-42   
dbj|BAD73018.1|  unknown protein                                        157   2e-42   
ref|XP_007216516.1|  hypothetical protein PRUPE_ppa024241mg             156   2e-42   
ref|XP_009610283.1|  PREDICTED: protein trichome birefringence-li...    157   2e-42   
ref|XP_009409696.1|  PREDICTED: protein trichome birefringence-li...    156   2e-42   
gb|KCW52496.1|  hypothetical protein EUGRSUZ_J01893                     157   2e-42   
ref|XP_006365454.1|  PREDICTED: uncharacterized protein LOC102604606    158   2e-42   
ref|XP_006477834.1|  PREDICTED: protein YLS7-like                       157   2e-42   
ref|XP_006442367.1|  hypothetical protein CICLE_v10020789mg             156   2e-42   
ref|XP_009146318.1|  PREDICTED: protein trichome birefringence-li...    156   2e-42   
ref|XP_006359475.1|  PREDICTED: uncharacterized protein LOC102598428    156   3e-42   
ref|NP_001042402.1|  Os01g0217000                                       157   3e-42   
ref|XP_006480514.1|  PREDICTED: protein YLS7-like                       156   3e-42   
gb|KDP40076.1|  hypothetical protein JCGZ_02074                         156   3e-42   
ref|NP_001154476.1|  trichome birefringence-like 42                     155   3e-42   
gb|EEE54114.1|  hypothetical protein OsJ_00883                          159   3e-42   
ref|XP_004229160.1|  PREDICTED: protein trichome birefringence-li...    156   3e-42   
ref|XP_011098189.1|  PREDICTED: protein trichome birefringence-li...    157   3e-42   
ref|XP_009380696.1|  PREDICTED: protein PMR5 isoform X3                 157   3e-42   
ref|XP_011010610.1|  PREDICTED: protein trichome birefringence-li...    155   4e-42   
gb|KDO66928.1|  hypothetical protein CISIN_1g016108mg                   154   4e-42   
ref|XP_009380694.1|  PREDICTED: protein PMR5 isoform X1                 157   4e-42   
ref|XP_003613275.1|  hypothetical protein MTR_5g034810                  155   4e-42   
ref|XP_004243780.1|  PREDICTED: protein trichome birefringence-li...    155   4e-42   
ref|XP_009380695.1|  PREDICTED: protein PMR5 isoform X2                 156   4e-42   
gb|KDO66929.1|  hypothetical protein CISIN_1g016108mg                   154   4e-42   
ref|XP_009626454.1|  PREDICTED: protein trichome birefringence-li...    155   5e-42   
ref|XP_011024935.1|  PREDICTED: protein PMR5-like                       156   6e-42   
gb|KDO58612.1|  hypothetical protein CISIN_1g018724mg                   155   6e-42   
ref|XP_002278078.2|  PREDICTED: protein trichome birefringence-li...    155   6e-42   
ref|XP_006360069.1|  PREDICTED: uncharacterized protein LOC102593192    155   6e-42   
gb|KDP45792.1|  hypothetical protein JCGZ_17399                         155   6e-42   
ref|XP_003634906.1|  PREDICTED: protein trichome birefringence-li...    155   7e-42   
ref|XP_009380697.1|  PREDICTED: protein PMR5 isoform X4                 155   9e-42   
ref|XP_008354275.1|  PREDICTED: protein PMR5-like                       155   1e-41   
ref|XP_009622720.1|  PREDICTED: protein PMR5-like                       155   1e-41   
ref|XP_006448025.1|  hypothetical protein CICLE_v10018196mg             154   1e-41   
gb|EPS67963.1|  hypothetical protein M569_06809                         154   1e-41   
gb|AES69051.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    155   1e-41   
gb|KDP40499.1|  hypothetical protein JCGZ_24498                         154   1e-41   
ref|XP_002298483.2|  hypothetical protein POPTR_0001s28490g             155   1e-41   
emb|CDX98504.1|  BnaC05g38710D                                          154   1e-41   
ref|XP_009804651.1|  PREDICTED: protein trichome birefringence-li...    154   1e-41   
gb|KCW69906.1|  hypothetical protein EUGRSUZ_F03235                     154   1e-41   
ref|NP_177992.1|  trichome birefringence-like 42                        154   1e-41   
ref|XP_010093461.1|  hypothetical protein L484_017522                   155   1e-41   
ref|XP_009778320.1|  PREDICTED: protein trichome birefringence-li...    154   1e-41   
ref|XP_008343824.1|  PREDICTED: protein PMR5-like                       155   2e-41   
gb|KJB33739.1|  hypothetical protein B456_006G028300                    154   2e-41   
gb|KDO42403.1|  hypothetical protein CISIN_1g017556mg                   154   2e-41   
ref|XP_008349565.1|  PREDICTED: protein PMR5-like                       153   2e-41   
ref|XP_010483461.1|  PREDICTED: protein PMR5-like                       155   2e-41   
ref|XP_010035884.1|  PREDICTED: protein trichome birefringence-li...    154   2e-41   
ref|XP_004497100.1|  PREDICTED: uncharacterized protein LOC101501368    154   2e-41   
emb|CDY20089.1|  BnaA01g29130D                                          154   2e-41   
emb|CDP06045.1|  unnamed protein product                                154   2e-41   
gb|KJB35225.1|  hypothetical protein B456_006G105300                    154   2e-41   
ref|XP_010253781.1|  PREDICTED: protein PMR5-like                       154   2e-41   
ref|XP_010453963.1|  PREDICTED: protein PMR5-like                       154   3e-41   
ref|XP_006852462.1|  hypothetical protein AMTR_s00021p00120690          153   3e-41   
ref|XP_009353878.1|  PREDICTED: protein PMR5-like                       154   3e-41   
ref|XP_010443601.1|  PREDICTED: protein PMR5                            154   3e-41   
ref|XP_010535369.1|  PREDICTED: protein PMR5                            154   3e-41   
ref|XP_010062787.1|  PREDICTED: protein trichome birefringence-li...    154   4e-41   
ref|XP_007048773.1|  Trichome birefringence-like 43, putative iso...    153   4e-41   
ref|XP_006346586.1|  PREDICTED: uncharacterized protein LOC102604720    153   4e-41   
ref|XP_006280567.1|  hypothetical protein CARUB_v10026519mg             154   4e-41   
ref|XP_004488994.1|  PREDICTED: uncharacterized protein LOC101512890    153   5e-41   
gb|KDO54062.1|  hypothetical protein CISIN_1g036968mg                   152   5e-41   
ref|XP_006488549.1|  PREDICTED: protein YLS7-like                       153   6e-41   
ref|XP_008221187.1|  PREDICTED: protein PMR5                            153   6e-41   
ref|XP_004491381.1|  PREDICTED: uncharacterized protein LOC101498345    152   6e-41   



>ref|XP_006362437.1| PREDICTED: uncharacterized protein LOC102599991 [Solanum tuberosum]
Length=370

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 145/183 (79%), Gaps = 10/183 (5%)
 Frame = +3

Query  51   VMWSGVVIIAVLLLVQ-----GHGGRA---AQNNVSHLLSWGGKEIVSSGGCNLFRGRWV  206
            V+WS +VI +VLL+        H GRA    QN   H  SW  K +VS+  CNLF+GRW 
Sbjct  2    VLWSQLVIKSVLLVCSITSLFLHTGRAELIVQNLSGH--SWENKGVVSNSKCNLFQGRWA  59

Query  207  VDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKK  386
            +D S+PLY  S CPFIDPEFDC+KYGRPDKQYLKYAWKPDSC++PRF+G + L+RW GKK
Sbjct  60   IDPSFPLYDSSTCPFIDPEFDCLKYGRPDKQYLKYAWKPDSCNMPRFNGKDFLQRWSGKK  119

Query  387  VMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDI  566
            +MF+GDSLSLNMWNSLACM+HASVP +K T SRQETLS VTF++YGVTL+LY TTYLVDI
Sbjct  120  IMFIGDSLSLNMWNSLACMLHASVPNAKTTISRQETLSSVTFQDYGVTLFLYRTTYLVDI  179

Query  567  VKE  575
            V+E
Sbjct  180  VRE  182



>ref|XP_009599976.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
tomentosiformis]
Length=373

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 9/184 (5%)
 Frame = +3

Query  51   VMWSGVVIIAVLLL-------VQGHGGRAAQNNVSHL--LSWGGKEIVSSGGCNLFRGRW  203
            V+WS +VI + LLL       V  H    A+  V ++  LSW  K +VSS  CNLF+GRW
Sbjct  2    VLWSQLVISSTLLLHLVSIISVFLHTTARAELVVQNVSGLSWKSKGVVSSSRCNLFQGRW  61

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D S+PLY  S CPFIDPEFDC KYGRPDKQY+KYAWKPDSC+LPRF+G + LKRW GK
Sbjct  62   VIDPSFPLYDSSTCPFIDPEFDCQKYGRPDKQYMKYAWKPDSCNLPRFNGKDFLKRWTGK  121

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            K+MF+GDSLSLNMW SLACM+HASVP +K +++R+ETLS VTF++YGVTL+LY TTYLVD
Sbjct  122  KIMFIGDSLSLNMWESLACMLHASVPNAKTSFARRETLSSVTFQDYGVTLFLYRTTYLVD  181

Query  564  IVKE  575
            IV+E
Sbjct  182  IVRE  185



>ref|XP_009781572.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
sylvestris]
 ref|XP_009781580.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
sylvestris]
Length=373

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 145/184 (79%), Gaps = 9/184 (5%)
 Frame = +3

Query  51   VMWSGVVIIAVLLL-------VQGHGGRAAQNNVSHL--LSWGGKEIVSSGGCNLFRGRW  203
            V+WS +VI + LLL       +  H    A+  V ++  LSW  K +VSS  CNLF+GRW
Sbjct  2    VLWSQLVISSTLLLQLVSVISLLLHTAARAELVVQNVSGLSWKSKGVVSSSRCNLFQGRW  61

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D S+PLY  S CPFIDPEFDC KYGRPDKQY+KY+WKPDSC+LPRF+G + LKRW GK
Sbjct  62   VIDPSFPLYDSSTCPFIDPEFDCQKYGRPDKQYMKYSWKPDSCNLPRFNGKDFLKRWTGK  121

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            K+MF+GDSLSLNMW SLACM+HASVP +K +++R+ETLS VTF++YGVTL+LY TTYLVD
Sbjct  122  KIMFIGDSLSLNMWESLACMLHASVPNAKTSFARRETLSSVTFQDYGVTLFLYRTTYLVD  181

Query  564  IVKE  575
            IV+E
Sbjct  182  IVRE  185



>ref|XP_004232960.1| PREDICTED: protein trichome birefringence-like 38 [Solanum lycopersicum]
Length=405

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 143/180 (79%), Gaps = 7/180 (4%)
 Frame = +3

Query  51   VMWSGVVIIAVLLLVQ-----GHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDS  215
            V+WS +VI +VLL+        + GRA     +  L    K +VS+  CNLF+GRW +D 
Sbjct  3    VLWSQLVIKSVLLVCSIISLCLYSGRAEVKVENFSLE--NKGVVSNSKCNLFQGRWAIDP  60

Query  216  SYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMF  395
            S+PLY  S CPFIDPEFDC+KYGRPDKQYLKYAWKPDSC+LPRF+G +LL+RW GKK+MF
Sbjct  61   SFPLYDSSKCPFIDPEFDCLKYGRPDKQYLKYAWKPDSCNLPRFNGKDLLQRWSGKKIMF  120

Query  396  VGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +GDSLSLNMWNSLACM+HASVP +K T SR+ETLS VTF++YGVTL+LY TTYLVDIV+E
Sbjct  121  IGDSLSLNMWNSLACMLHASVPNAKTTISRKETLSSVTFQDYGVTLFLYRTTYLVDIVRE  180



>ref|XP_011096427.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=409

 Score =   243 bits (620),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = +3

Query  57   WSGVVIIAV-LLLVQGHGGRAAQNNVSHLLSWG-GKEIVSSGGCNLFRGRWVVDSSYPLY  230
            + G++  A+ L+LV+    +  +NN +   S    +E++++GGCNLF+GRWVVD SYPLY
Sbjct  47   YKGLIFQALYLVLVEYAASQLVRNNFTTSSSITRSREVLAAGGCNLFQGRWVVDPSYPLY  106

Query  231  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  410
            + S+CPFIDPEFDCIKYGRPDKQYLK++WKPDSCDLPRF+G + LKRW GKK+MFVGDSL
Sbjct  107  ESSSCPFIDPEFDCIKYGRPDKQYLKFSWKPDSCDLPRFNGVDFLKRWSGKKIMFVGDSL  166

Query  411  SLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SLN W SLACMIHASVP SK +Y RQE+LS VTF++YGVTL LY + YLVDI +E
Sbjct  167  SLNQWESLACMIHASVPNSKTSYVRQESLSSVTFQDYGVTLLLYRSPYLVDITRE  221



>ref|XP_009599983.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
tomentosiformis]
Length=363

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 139/177 (79%), Gaps = 8/177 (5%)
 Frame = +3

Query  51   VMWSGVVIIAVLLLVQGHGGRA--AQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYP  224
            ++ S  ++I++ L +Q    +A     NVS       +  +SS  CNLF+G+WV+D+S+P
Sbjct  5    LLQSIALVISISLFLQAETAKAELVLKNVS------SRGKMSSSNCNLFQGKWVIDTSFP  58

Query  225  LYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGD  404
            LYQ SNCPFIDPEFDC KYGRPDK+YLKYAWKPDSC+LPRFDG + LKRW GKK+MFVGD
Sbjct  59   LYQSSNCPFIDPEFDCQKYGRPDKEYLKYAWKPDSCNLPRFDGKDFLKRWLGKKIMFVGD  118

Query  405  SLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SLSLNMW SLACM+H+SVP +  +++R+E +S VTF+EYGVTL+LY T YLVDIV+E
Sbjct  119  SLSLNMWESLACMLHSSVPNTTTSFTRKEAISSVTFQEYGVTLFLYRTPYLVDIVRE  175



>gb|ACU21157.1| unknown [Glycine max]
Length=232

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 127/159 (80%), Gaps = 4/159 (3%)
 Frame = +3

Query  102  HGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIK  278
            H  RAA+ +NVS L    GK+ V + GCNLF G WVVD+SYPLY  S CPFIDPEFDC K
Sbjct  21   HQARAAKFHNVSGLR---GKKPVVANGCNLFLGSWVVDTSYPLYDSSTCPFIDPEFDCQK  77

Query  279  YGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASV  458
            YGRPDKQYLKYAWKPDSC +PRFDG   L  WRGKK+MFVGDSLSLNMW SL+CMIHASV
Sbjct  78   YGRPDKQYLKYAWKPDSCAIPRFDGAAFLNSWRGKKIMFVGDSLSLNMWESLSCMIHASV  137

Query  459  PTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            P +K  + R+E+LS VTF++YGVT+ LY T YLVDI++E
Sbjct  138  PNAKTGFLRKESLSTVTFQDYGVTIQLYRTPYLVDIIRE  176



>gb|KDO77824.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
 gb|KDO77825.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=217

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 144/184 (78%), Gaps = 9/184 (5%)
 Frame = +3

Query  33   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  203
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++ R+ETLS V+F+EYGVTL LY T YLVD
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTLLLYRTPYLVD  174

Query  564  IVKE  575
            IVK+
Sbjct  175  IVKQ  178



>ref|XP_007148060.1| hypothetical protein PHAVU_006G177100g [Phaseolus vulgaris]
 gb|ESW20054.1| hypothetical protein PHAVU_006G177100g [Phaseolus vulgaris]
Length=364

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 4/157 (3%)
 Frame = +3

Query  108  GRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYG  284
             RAA+ +NVS L   GGK+ V   GCNLF G WVVD SYPLY  S CPFIDPEFDC KYG
Sbjct  23   ARAAKFHNVSGL---GGKKAVIVNGCNLFMGSWVVDPSYPLYDSSACPFIDPEFDCQKYG  79

Query  285  RPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPT  464
            RPDKQYLKYAWKPDSC LPRFDG + L RW+GKK+MFVGDSLSLNMW SL+CMIHASVP 
Sbjct  80   RPDKQYLKYAWKPDSCALPRFDGADFLNRWKGKKIMFVGDSLSLNMWESLSCMIHASVPN  139

Query  465  SKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +K ++ R+E+LS VTF++YGVT+ LY T YLVDI++E
Sbjct  140  TKSSFLRKESLSTVTFQDYGVTIQLYRTPYLVDIIRE  176



>ref|XP_010057074.1| PREDICTED: protein trichome birefringence-like 38 [Eucalyptus 
grandis]
 gb|KCW74075.1| hypothetical protein EUGRSUZ_E02713 [Eucalyptus grandis]
Length=373

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  66   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  245
            + I  +  LV+     + Q   +   +  G++   +GGCNLF+G WVVD+SYP Y+ S+C
Sbjct  18   LTIFFLFFLVRPQRASSEQQLWNTTAALRGRK--QTGGCNLFQGNWVVDASYPFYESSSC  75

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFIDPEFDC KYGRPD QYLKYAW+PDSC +PRF+GGELL+RWRGKK+MFVGDSLSLNMW
Sbjct  76   PFIDPEFDCQKYGRPDTQYLKYAWRPDSCAIPRFNGGELLRRWRGKKIMFVGDSLSLNMW  135

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SL+CMIHASVP +K +++R+E+LS VTF +YGV+++LY T YLVDIV+E
Sbjct  136  ESLSCMIHASVPGAKTSFARKESLSAVTFPDYGVSIFLYRTPYLVDIVRE  185



>gb|KDO77823.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=270

 Score =   228 bits (582),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 144/184 (78%), Gaps = 9/184 (5%)
 Frame = +3

Query  33   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  203
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++ R+ETLS V+F+EYGVTL LY T YLVD
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTLLLYRTPYLVD  174

Query  564  IVKE  575
            IVK+
Sbjct  175  IVKQ  178



>ref|XP_006449479.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
 gb|ESR62719.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
Length=366

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 145/184 (79%), Gaps = 9/184 (5%)
 Frame = +3

Query  33   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  203
            MG G  V+  W   VV+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQVVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC LPRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCALPRFDGGDFLRRYRGK  114

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++ R+ETLS V+F+EYGVTL LY T YLVD
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTLLLYRTPYLVD  174

Query  564  IVKE  575
            IVK+
Sbjct  175  IVKQ  178



>ref|XP_006597476.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN18917.1| hypothetical protein glysoja_036096 [Glycine soja]
Length=364

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 127/159 (80%), Gaps = 4/159 (3%)
 Frame = +3

Query  102  HGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIK  278
            H  RAA+ +NVS L    GK+ V + GCNLF G WVVD+SYPLY  S CPFIDPEFDC K
Sbjct  21   HQARAAKFHNVSGLR---GKKPVVANGCNLFLGSWVVDTSYPLYDSSTCPFIDPEFDCQK  77

Query  279  YGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASV  458
            YGRPDKQYLKYAWKPDSC +PRFDG   L  WRGKK+MFVGDSLSLNMW SL+CMIHASV
Sbjct  78   YGRPDKQYLKYAWKPDSCAIPRFDGAAFLNSWRGKKIMFVGDSLSLNMWESLSCMIHASV  137

Query  459  PTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            P +K  + R+E+LS VTF++YGVT+ LY T YLVDI++E
Sbjct  138  PNAKTGFLRKESLSTVTFQDYGVTIQLYRTPYLVDIIRE  176



>gb|KDO77821.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=374

 Score =   228 bits (582),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 144/184 (78%), Gaps = 9/184 (5%)
 Frame = +3

Query  33   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  203
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++ R+ETLS V+F+EYGVTL LY T YLVD
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTLLLYRTPYLVD  174

Query  564  IVKE  575
            IVK+
Sbjct  175  IVKQ  178



>gb|KDO77820.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=366

 Score =   228 bits (581),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 144/184 (78%), Gaps = 9/184 (5%)
 Frame = +3

Query  33   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  203
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++ R+ETLS V+F+EYGVTL LY T YLVD
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTLLLYRTPYLVD  174

Query  564  IVKE  575
            IVK+
Sbjct  175  IVKQ  178



>gb|KDO77822.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=368

 Score =   228 bits (581),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 144/184 (78%), Gaps = 9/184 (5%)
 Frame = +3

Query  33   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  203
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++ R+ETLS V+F+EYGVTL LY T YLVD
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTLLLYRTPYLVD  174

Query  564  IVKE  575
            IVK+
Sbjct  175  IVKQ  178



>ref|XP_009790075.1| PREDICTED: protein trichome birefringence-like 38 [Nicotiana 
sylvestris]
 ref|XP_009790076.1| PREDICTED: protein trichome birefringence-like 38 [Nicotiana 
sylvestris]
Length=360

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 132/170 (78%), Gaps = 9/170 (5%)
 Frame = +3

Query  66   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  245
            V++I++ L  +         NVS      GK       CNLF+G+WV+D+S+PLYQ S+C
Sbjct  12   VIVISLFLQTETVKAEFVVKNVSS----RGKM-----SCNLFQGKWVIDTSFPLYQSSSC  62

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFIDPEFDC KYGRPDK+YLKYAWKPDSC+LPRFDG + LKRW GKK+MFVGDSLSLNMW
Sbjct  63   PFIDPEFDCQKYGRPDKEYLKYAWKPDSCNLPRFDGKDFLKRWLGKKIMFVGDSLSLNMW  122

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SLACM+H+SVP +  +++R+E +S VTF++YGVTL+LY T YLVDIV+E
Sbjct  123  ESLACMLHSSVPNATTSFTRKEAISSVTFQDYGVTLFLYRTPYLVDIVRE  172



>gb|KDO77819.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=372

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 144/184 (78%), Gaps = 9/184 (5%)
 Frame = +3

Query  33   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  203
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++ R+ETLS V+F+EYGVTL LY T YLVD
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTLLLYRTPYLVD  174

Query  564  IVKE  575
            IVK+
Sbjct  175  IVKQ  178



>ref|XP_007025417.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 ref|XP_007025418.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28039.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28040.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
Length=363

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  177  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  356
            GCNLF+G+WV D SYP Y  S CPFIDPEFDC+KYGRPDKQYLKY+WKPD+CDLPRFDG 
Sbjct  43   GCNLFQGKWVFDPSYPFYDSSGCPFIDPEFDCLKYGRPDKQYLKYSWKPDACDLPRFDGA  102

Query  357  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLY  536
              L +WRGKK+MFVGDSLSLNMW SLACMIHASVP SK TY R++ LS+V F++Y VTLY
Sbjct  103  SFLAKWRGKKIMFVGDSLSLNMWESLACMIHASVPNSKTTYVRKDPLSFVIFEDYAVTLY  162

Query  537  LYHTTYLVDIVKE  575
            LY T YLVDIV+E
Sbjct  163  LYRTPYLVDIVRE  175



>gb|AHN91976.1| TBL1 [Citrus sinensis]
Length=366

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 143/184 (78%), Gaps = 9/184 (5%)
 Frame = +3

Query  33   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  203
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWRPASCAVPRFDGGDFLRRYRGK  114

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++ R+ETLS V+F+EYGVT  LY T YLVD
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTFLLYRTPYLVD  174

Query  564  IVKE  575
            IVK+
Sbjct  175  IVKQ  178



>ref|XP_006467669.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=366

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 143/184 (78%), Gaps = 9/184 (5%)
 Frame = +3

Query  33   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  203
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  204  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  383
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  384  KVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVD  563
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++ R+ETLS V+F+EYGVT  LY T YLVD
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTFLLYRTPYLVD  174

Query  564  IVKE  575
            IVK+
Sbjct  175  IVKQ  178



>gb|KHG20284.1| Enolase [Gossypium arboreum]
Length=365

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 135/183 (74%), Gaps = 8/183 (4%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGRWV  206
            MG G K +   +    V++L+Q    R  Q   NVS L +   ++ VS  GCNLF+G+WV
Sbjct  1    MGFGCKTLLC-LFFTVVVVLLQEASARQQQYYYNVSGLRN---RKQVS--GCNLFQGQWV  54

Query  207  VDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKK  386
             D SYP Y  S CPFID EFDC+KYGRPDKQYLKY+WKPD C+LPRFDG   L +WRGKK
Sbjct  55   FDPSYPYYDSSGCPFIDAEFDCLKYGRPDKQYLKYSWKPDGCNLPRFDGASFLAKWRGKK  114

Query  387  VMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDI  566
            +MFVGDSLSLNMW S+ACMIHASVP SK T+ R+  LS+V F++YGVTLYLY T YLVDI
Sbjct  115  IMFVGDSLSLNMWESMACMIHASVPNSKTTFVRKSPLSFVIFEDYGVTLYLYRTPYLVDI  174

Query  567  VKE  575
            VKE
Sbjct  175  VKE  177



>ref|XP_004234094.1| PREDICTED: protein trichome birefringence-like 38 [Solanum lycopersicum]
Length=357

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  332
               I S   CNLF+G+WV+D S+PLYQ SNCPFIDPEFDC KYGRPDK+YLKYAWKP+SC
Sbjct  29   NNNIESLSNCNLFQGQWVIDPSFPLYQSSNCPFIDPEFDCQKYGRPDKEYLKYAWKPNSC  88

Query  333  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTF  512
            +LPRFDG + LKRW GKK+MFVGDSLSLNMW SLACM+H+S+P +  +++R+E++S VTF
Sbjct  89   NLPRFDGIDFLKRWNGKKIMFVGDSLSLNMWESLACMLHSSMPNATTSFTRKESISAVTF  148

Query  513  KEYGVTLYLYHTTYLVDIVKE  575
            ++YGVTL+LY T YLVDIV+E
Sbjct  149  QDYGVTLFLYRTPYLVDIVRE  169



>gb|KHN08449.1| hypothetical protein glysoja_014214 [Glycine soja]
Length=364

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 130/169 (77%), Gaps = 4/169 (2%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCP  248
            ++ +   +  H  RAA+ +NVS L    G  +V + GCNLF G WVVD+SYPLY  S CP
Sbjct  11   LLCLFWFLSLHQARAAKFHNVSGLR---GNNLVVANGCNLFLGSWVVDTSYPLYNSSTCP  67

Query  249  FIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWN  428
            FIDP+FDC KYGRPDKQYLKYAWKP+SC LPRFDG + L RWRGKK+MFVGDSLSLNMW 
Sbjct  68   FIDPQFDCQKYGRPDKQYLKYAWKPESCALPRFDGVDFLNRWRGKKIMFVGDSLSLNMWR  127

Query  429  SLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SL C+IHASVP +K  + R E+LS VTF++YG+T+ LY T YLVDI++E
Sbjct  128  SLTCVIHASVPNAKTGFLRNESLSTVTFQDYGLTIQLYRTPYLVDIIRE  176



>ref|XP_003542986.1| PREDICTED: protein YLS7-like isoform X1 [Glycine max]
Length=375

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 130/169 (77%), Gaps = 4/169 (2%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCP  248
            ++ +   +  H  RAA+ +NVS L    G  +V + GCNLF G WVVD+SYPLY  S CP
Sbjct  22   LLCLFWFLSLHQARAAKFHNVSGLR---GNNLVVANGCNLFLGSWVVDTSYPLYNSSTCP  78

Query  249  FIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWN  428
            FIDP+FDC KYGRPDKQYLKYAWKP+SC LPRFDG + L RWRGKK+MFVGDSLSLNMW 
Sbjct  79   FIDPQFDCQKYGRPDKQYLKYAWKPESCALPRFDGVDFLNRWRGKKIMFVGDSLSLNMWR  138

Query  429  SLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SL C+IHASVP +K  + R E+LS VTF++YG+T+ LY T YLVDI++E
Sbjct  139  SLTCVIHASVPNAKTGFLRNESLSTVTFQDYGLTIQLYRTPYLVDIIRE  187



>ref|XP_006594557.1| PREDICTED: protein YLS7-like isoform X2 [Glycine max]
Length=390

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 130/169 (77%), Gaps = 4/169 (2%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCP  248
            ++ +   +  H  RAA+ +NVS L    G  +V + GCNLF G WVVD+SYPLY  S CP
Sbjct  37   LLCLFWFLSLHQARAAKFHNVSGL---RGNNLVVANGCNLFLGSWVVDTSYPLYNSSTCP  93

Query  249  FIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWN  428
            FIDP+FDC KYGRPDKQYLKYAWKP+SC LPRFDG + L RWRGKK+MFVGDSLSLNMW 
Sbjct  94   FIDPQFDCQKYGRPDKQYLKYAWKPESCALPRFDGVDFLNRWRGKKIMFVGDSLSLNMWR  153

Query  429  SLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SL C+IHASVP +K  + R E+LS VTF++YG+T+ LY T YLVDI++E
Sbjct  154  SLTCVIHASVPNAKTGFLRNESLSTVTFQDYGLTIQLYRTPYLVDIIRE  202



>gb|EYU28072.1| hypothetical protein MIMGU_mgv1a008400mg [Erythranthe guttata]
Length=375

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  114  AAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPD  293
            A  NN +       ++I+SSG CNLF+G+WVVDS+YP Y+ S CPFIDPEFDCIK+GRPD
Sbjct  33   AVPNNFNSSNIIRSRDIISSG-CNLFQGKWVVDSTYPFYESSTCPFIDPEFDCIKFGRPD  91

Query  294  KQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKI  473
            KQYLK++WKPDSC+LPRF+G + LKRW GKK+MFVGDSLSLN W SLACMIHASVP SK 
Sbjct  92   KQYLKFSWKPDSCNLPRFNGVDFLKRWSGKKIMFVGDSLSLNQWQSLACMIHASVPNSKT  151

Query  474  TYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +Y R E+LS VTF++YGV+L LY + YLVDI +E
Sbjct  152  SYVRLESLSSVTFQDYGVSLLLYRSPYLVDITRE  185



>ref|XP_007211863.1| hypothetical protein PRUPE_ppa010079mg [Prunus persica]
 gb|EMJ13062.1| hypothetical protein PRUPE_ppa010079mg [Prunus persica]
Length=265

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 7/172 (4%)
 Frame = +3

Query  60   SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  239
            S +V + VL+L       A   + + +     ++   + GCNLF+G W  D+SYPLY  S
Sbjct  9    SCLVALQVLVLFSDEASSAGHGHGARI----SRQRKQATGCNLFQGNWAFDASYPLYDSS  64

Query  240  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  419
            +CPFIDPEFDCIKYGRPDKQ+LKYAWKPDSCDLPRFDG + L+RW+GKK+MFVGDSLSLN
Sbjct  65   SCPFIDPEFDCIKYGRPDKQFLKYAWKPDSCDLPRFDGLDFLRRWKGKKIMFVGDSLSLN  124

Query  420  MWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MW SL+CMIHASVP +K T+ +  +   V F++YGVTL+++ T YLVDIV+E
Sbjct  125  MWESLSCMIHASVPNAKTTFKKGYS---VNFQDYGVTLFMFRTPYLVDIVRE  173



>gb|KJB69610.1| hypothetical protein B456_011G033800 [Gossypium raimondii]
Length=365

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +3

Query  177  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  356
            GCNLF+G+WV D SYP Y  S CPFID EFDC+KYGRPDKQYLKY+WKPD C+LPRFDG 
Sbjct  45   GCNLFQGQWVFDPSYPYYDSSGCPFIDAEFDCLKYGRPDKQYLKYSWKPDGCNLPRFDGA  104

Query  357  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLY  536
              L +WRGKK+MFVGDSLSLNMW S+ACMIHASVP SK T+ R+  LS+V F++YGVTLY
Sbjct  105  SFLAKWRGKKIMFVGDSLSLNMWESMACMIHASVPNSKTTFVRKSPLSFVIFEDYGVTLY  164

Query  537  LYHTTYLVDIVKE  575
            LY T YLVDIVKE
Sbjct  165  LYRTPYLVDIVKE  177



>gb|KDP21076.1| hypothetical protein JCGZ_21547 [Jatropha curcas]
Length=367

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 136/183 (74%), Gaps = 6/183 (3%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGRWV  206
            MG   KV+ S +  + ++L       R  Q   NV+ LL   G++ VS  GCNLF+G+WV
Sbjct  1    MGYRCKVLSSVLFQVILVLAAFFKEARTEQQVYNVTRLLR--GRKQVS--GCNLFQGKWV  56

Query  207  VDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKK  386
            VDSSYP Y  S CPFID EFDC KYGRPD QYLKY+W+PDSC+LPRFDG + L+RW GK+
Sbjct  57   VDSSYPFYDSSACPFIDAEFDCQKYGRPDTQYLKYSWQPDSCNLPRFDGVDFLRRWSGKQ  116

Query  387  VMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDI  566
            +MFVGDSLSLNMW SL+CMIHASVP +K +   Q++L  VTF++YGVTL++Y T YLVDI
Sbjct  117  IMFVGDSLSLNMWESLSCMIHASVPNAKTSRVNQDSLHSVTFEDYGVTLFMYRTPYLVDI  176

Query  567  VKE  575
            VKE
Sbjct  177  VKE  179



>gb|KJB68384.1| hypothetical protein B456_010G242200 [Gossypium raimondii]
Length=373

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 128/183 (70%), Gaps = 11/183 (6%)
 Frame = +3

Query  27   PKMGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWV  206
            PKMG   ++ +       +  L       A++ N S LL           GCNLF+G+WV
Sbjct  14   PKMGFNSQISFYFFFFFFIASLDFIQETNASEYNESRLLM---------KGCNLFQGKWV  64

Query  207  VDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKK  386
             D SYP Y PS CPF+DPEFDC  +GRPDKQYLKYAWKPD+C LPRF+G   L +WRGKK
Sbjct  65   FDPSYPFYLPSKCPFVDPEFDC--HGRPDKQYLKYAWKPDACSLPRFNGASFLGKWRGKK  122

Query  387  VMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDI  566
            +MFVGDSLSLNMW SL CMIHASVP SK TY R++ LS+V F+EYGVTLY+Y T YLVDI
Sbjct  123  IMFVGDSLSLNMWESLVCMIHASVPNSKTTYVRRDPLSFVNFEEYGVTLYVYRTPYLVDI  182

Query  567  VKE  575
            V+E
Sbjct  183  VRE  185



>ref|XP_006305057.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
 gb|EOA37955.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
Length=384

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  81   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  260
             +LLV GH   A   +   + S  GK+   + GCNLF+GRWV D+SYP Y  S CPFID 
Sbjct  33   TVLLVNGHNSTAGSGD-GGMSSLRGKKQRGASGCNLFQGRWVFDASYPFYDSSTCPFIDG  91

Query  261  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  440
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+++RGK+VMFVGDSLSLNMW SL C
Sbjct  92   EFDCLKFGRPDKQFLKYSWQPESCTIPRFDGAAFLRKYRGKRVMFVGDSLSLNMWESLGC  151

Query  441  MIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MIHASVP +K T++++  LS +TF++YGVTLYLY T Y+VDI KE
Sbjct  152  MIHASVPNAKTTFTKRTPLSTLTFQDYGVTLYLYRTPYIVDIAKE  196



>ref|XP_007153710.1| hypothetical protein PHAVU_003G058400g [Phaseolus vulgaris]
 gb|ESW25704.1| hypothetical protein PHAVU_003G058400g [Phaseolus vulgaris]
Length=364

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 126/161 (78%), Gaps = 7/161 (4%)
 Frame = +3

Query  102  HGGRAAQN---NVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDC  272
            H  RAA++   NV+ L   G KEI+S   CNLF G WV+D S+PLY  S+CPFIDPEFDC
Sbjct  20   HQARAAKSGNYNVTRLK--GRKEIISR--CNLFLGSWVIDPSHPLYDSSSCPFIDPEFDC  75

Query  273  IKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHA  452
             KYGRPDKQYLKY+WKPDSC LPRFDG   L +WRGK++MFVGDSLSLNMW SL+CM+HA
Sbjct  76   QKYGRPDKQYLKYSWKPDSCALPRFDGVNFLNKWRGKRIMFVGDSLSLNMWESLSCMLHA  135

Query  453  SVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SVP +  T+ R+E LS VTF+EY VT+ LY T YLVDIV+E
Sbjct  136  SVPNATTTFVRREALSTVTFQEYEVTIELYRTPYLVDIVRE  176



>emb|CAJ40777.1| alpha galactosidase precursor [Coffea arabica]
Length=365

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 128/167 (77%), Gaps = 3/167 (2%)
 Frame = +3

Query  78   AVLLLVQGHGGRAAQNNVSH-LLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFI  254
            A++L    H   ++   V + +  + G+ +   GGCNLF+G+WVVDSS+P Y+ S CPFI
Sbjct  14   AIVLFAVQHANSSSVETVHYNVTGYRGRHL--GGGCNLFQGKWVVDSSFPPYESSGCPFI  71

Query  255  DPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSL  434
            D EFDC KYGRPDKQYLKYAWKPDSC+LPRFDG + LKRW+GKK+MFVGDSLSLN W S 
Sbjct  72   DYEFDCQKYGRPDKQYLKYAWKPDSCNLPRFDGLDFLKRWKGKKIMFVGDSLSLNQWQSF  131

Query  435  ACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             C+IHASVP++     R+E LSY TF++Y VT+YLYH+TYLVDI +E
Sbjct  132  LCLIHASVPSANTNLVRKEILSYATFQDYDVTIYLYHSTYLVDIAQE  178



>emb|CDO96761.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 128/167 (77%), Gaps = 3/167 (2%)
 Frame = +3

Query  78   AVLLLVQGHGGRAAQNNVSH-LLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFI  254
            A++L    H   ++   V + +  + G+ +   GGCNLF+G+WVVDSS+P Y+ S CPFI
Sbjct  14   AIVLFAVQHANSSSVETVHYNVTGYRGRHL--GGGCNLFQGKWVVDSSFPPYESSGCPFI  71

Query  255  DPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSL  434
            D EFDC KYGRPDKQYLKYAWKPDSC+LPRFDG + LKRW+GKK+MFVGDSLSLN W S 
Sbjct  72   DYEFDCQKYGRPDKQYLKYAWKPDSCNLPRFDGLDFLKRWKGKKIMFVGDSLSLNQWQSF  131

Query  435  ACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             C+IHASVP++     R+E LSY TF++Y VT+YLYH+TYLVDI +E
Sbjct  132  LCLIHASVPSANTNLVRKEILSYATFQDYDVTIYLYHSTYLVDIAQE  178



>ref|XP_004485883.1| PREDICTED: uncharacterized protein LOC101498973 [Cicer arietinum]
Length=366

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 131/169 (78%), Gaps = 4/169 (2%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCP  248
            +   +L V  H   A++ +NVS++    GK+ V+S GCNLF G WVV+ SYPLY  S CP
Sbjct  13   LFCQVLFVSLHQATASKFHNVSNI---KGKKSVASSGCNLFIGSWVVNPSYPLYDYSTCP  69

Query  249  FIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWN  428
            FID EF+C KYGRPDKQYLKY+WKPDSC LPRFDG + L +W+GKK+MFVGDSLSLNMW 
Sbjct  70   FIDAEFNCQKYGRPDKQYLKYSWKPDSCALPRFDGVDFLNKWKGKKIMFVGDSLSLNMWE  129

Query  429  SLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SL+CMIHASVP +K ++ R+E  S VTF+EYGV++ LY T YLVDI++E
Sbjct  130  SLSCMIHASVPNAKTSFLRKEAQSAVTFQEYGVSIQLYRTPYLVDIIRE  178



>gb|KJB34893.1| hypothetical protein B456_006G088800 [Gossypium raimondii]
Length=380

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 135/182 (74%), Gaps = 5/182 (3%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  212
            MG   K + S   ++ V+L+ +  G R   N  +++   G K+  +  GCNLF+G WV+D
Sbjct  1    MGFSFKTLLSLFPLVWVMLMQETSGSRHYYNVSNNIK--GRKQ--AKNGCNLFQGNWVLD  56

Query  213  -SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  389
             SSYP Y  S CPFID EFDC+KYGRPDKQ+L Y+WKPDSC+LPRFDG   L +W+GKK+
Sbjct  57   LSSYPFYNSSQCPFIDSEFDCLKYGRPDKQFLHYSWKPDSCNLPRFDGVNFLGKWKGKKI  116

Query  390  MFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIV  569
            MFVGDSLSLNMW SLACM+ ASVP SK TY R++ LS+V F++YGVTLY+Y T YLVDIV
Sbjct  117  MFVGDSLSLNMWESLACMVQASVPNSKTTYVRKDPLSFVIFEDYGVTLYMYRTPYLVDIV  176

Query  570  KE  575
            +E
Sbjct  177  RE  178



>ref|XP_011045911.1| PREDICTED: protein trichome birefringence-like 38 [Populus euphratica]
Length=362

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 6/181 (3%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  212
            MG   +V+     ++ +L L +   G    +N S L    G++ VS  GCNLF+GRWVVD
Sbjct  1    MGFKCQVLVCTFCLVMLLFLQETRAG-IHSSNASRL---NGRKKVS--GCNLFQGRWVVD  54

Query  213  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  392
            +SYPLY  S+CPFID +F+C KYGR D QYLKY+W+PDSC +PRF+G + L+RWRGKK+M
Sbjct  55   TSYPLYDSSSCPFIDDQFNCQKYGRRDNQYLKYSWQPDSCKIPRFNGADFLRRWRGKKIM  114

Query  393  FVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVK  572
            FVGDSLSLNMW SL+CMIHA+VP +K T+ R+++LS VTF  YGVTLY+Y T YLVDIV+
Sbjct  115  FVGDSLSLNMWESLSCMIHAAVPKAKTTFYRRDSLSSVTFDGYGVTLYMYRTPYLVDIVR  174

Query  573  E  575
            E
Sbjct  175  E  175



>ref|XP_009410826.1| PREDICTED: protein trichome birefringence-like 38 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 137/185 (74%), Gaps = 6/185 (3%)
 Frame = +3

Query  39   VGQKVMWSGVVIIAVL-LLVQGHGGRAAQN--NVSHL---LSWGGKEIVSSGGCNLFRGR  200
            +G +  WS V++ A+L +L+    G A ++  +  HL    S G +E  S   CN+FRG 
Sbjct  1    MGSRAQWSFVLLCALLSVLIASLNGTATESFGHTHHLGNGTSPGRREGASGISCNMFRGS  60

Query  201  WVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRG  380
            WV D SYPLY  S CP +DPEFDC +YGRPDK YLKY WKPD+C+LPRF+G +LL+RW+G
Sbjct  61   WVYDQSYPLYDSSTCPILDPEFDCQRYGRPDKSYLKYRWKPDACELPRFNGLDLLRRWKG  120

Query  381  KKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLV  560
            KK+MFVGDS+S+N W SL CM+HA+VP +K TY + +TLS +TF +YGV++ LYH+TYLV
Sbjct  121  KKIMFVGDSISINQWQSLVCMLHAAVPDAKTTYKKNDTLSTITFTDYGVSVMLYHSTYLV  180

Query  561  DIVKE  575
            DIV+E
Sbjct  181  DIVEE  185



>ref|XP_010460674.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=384

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  81   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  260
             +LLV GH   A   +   + S  GK+   + GCNLF+GRWV D+SYP Y  S CPFID 
Sbjct  33   TVLLVNGHNSTAGSGD-GGMSSLRGKKQRRASGCNLFQGRWVFDASYPFYDSSTCPFIDG  91

Query  261  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  440
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+++RGK++MFVGDSLSLNMW SL C
Sbjct  92   EFDCLKFGRPDKQFLKYSWQPESCAIPRFDGAAFLRKYRGKRIMFVGDSLSLNMWESLGC  151

Query  441  MIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MIHASVP +K T++++  LS +TF+EYGVTL LY T Y+VDI KE
Sbjct  152  MIHASVPNAKTTFTKRTPLSSLTFQEYGVTLNLYRTPYIVDIAKE  196



>ref|XP_010480710.1| PREDICTED: protein trichome birefringence-like 38, partial [Camelina 
sativa]
Length=406

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  81   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  260
             +LLV GH   A   +   + S  GK+   + GCNLF+GRWV D+SYP Y  S CPFID 
Sbjct  55   TVLLVNGHNSTAGSGD-GGMSSLRGKKQRRASGCNLFQGRWVFDASYPFYDSSTCPFIDG  113

Query  261  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  440
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+++RGK++MFVGDSLSLNMW SL C
Sbjct  114  EFDCLKFGRPDKQFLKYSWQPESCAIPRFDGAAFLRKYRGKRIMFVGDSLSLNMWESLGC  173

Query  441  MIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MIHASVP +K T++++  LS +TF+EYGVTL LY T Y+VDI KE
Sbjct  174  MIHASVPNAKTTFTKRTPLSSLTFQEYGVTLNLYRTPYIVDIAKE  218



>ref|XP_008225213.1| PREDICTED: protein trichome birefringence-like 37 [Prunus mume]
Length=361

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 7/172 (4%)
 Frame = +3

Query  60   SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  239
            S +V + VL+L       A   + + +     ++   + GCNLF+G W  D+SYPLY  S
Sbjct  9    SCLVALQVLVLFSDEASSAGHGHGTRI----SRQRKQATGCNLFQGNWAFDASYPLYDSS  64

Query  240  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  419
            +CPFIDPEFDCIKYGRPDKQ+LKYAWKPDSCDLPRFDG + L+RW+GKK+MFVGDSLSLN
Sbjct  65   SCPFIDPEFDCIKYGRPDKQFLKYAWKPDSCDLPRFDGLDFLRRWKGKKIMFVGDSLSLN  124

Query  420  MWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MW SL+CMIHASVP +K T+ +  +   V F++YGVTL+++ T YLVDIV+E
Sbjct  125  MWESLSCMIHASVPNAKTTFKKGYS---VNFQDYGVTLFMFRTPYLVDIVRE  173



>ref|XP_010499424.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=383

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = +3

Query  81   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  260
             +LLV GH   +  +N   + S  GK+   + GCNLF+GRWV D+SYP Y  S CPFID 
Sbjct  33   TVLLVNGH--NSTGSNDGGMSSLRGKKQRRASGCNLFQGRWVFDASYPFYDSSTCPFIDG  90

Query  261  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  440
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+++RGK++MFVGDSLSLNMW SL C
Sbjct  91   EFDCLKFGRPDKQFLKYSWQPESCAIPRFDGAAFLRKYRGKRIMFVGDSLSLNMWESLGC  150

Query  441  MIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MIHASVP +K T++++  LS +TF+EYGVTL LY T Y+VDI KE
Sbjct  151  MIHASVPNAKTTFTKRTPLSSLTFQEYGVTLNLYRTPYIVDIAKE  195



>ref|XP_003593750.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
 gb|AES64001.1| trichome birefringence-like protein [Medicago truncatula]
Length=360

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 130/175 (74%), Gaps = 8/175 (5%)
 Frame = +3

Query  63   GVVIIAVLLLV----QGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  230
            G   I +LLL     Q   G A  +NVS L    GK+ V + GCNLF G WVVD SYPLY
Sbjct  2    GFRAITLLLLFSLFHQLLLGEAKFHNVSSL---RGKKPVVTNGCNLFIGSWVVDPSYPLY  58

Query  231  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  410
              S+CPFIDPEF+C KYGRPDKQYLKY+WKPDSC LP FDG + L +WRGKK+MFVGDSL
Sbjct  59   D-SSCPFIDPEFNCQKYGRPDKQYLKYSWKPDSCALPSFDGKDFLNKWRGKKIMFVGDSL  117

Query  411  SLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SLNMW SL+CMIHASVP  K ++ R+E  S VTF++YGVT+ LY T YLVDI++E
Sbjct  118  SLNMWESLSCMIHASVPNVKTSFLRREAQSTVTFQDYGVTIQLYRTPYLVDIIRE  172



>ref|XP_011005473.1| PREDICTED: protein trichome birefringence-like 37 [Populus euphratica]
Length=359

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 136/181 (75%), Gaps = 9/181 (5%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  212
            MG   +V++S      +LLL +   G+    NVS L    G++ VS  GC+LF+GRWVVD
Sbjct  1    MGFKCRVLFSIFCQCMLLLLQEAIAGQH-HYNVSRL---KGRKQVS--GCDLFQGRWVVD  54

Query  213  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  392
            +SYPLY  S CPFID EFDC  YGRPD QYLKY+W+PDSC++PRF G + L RWRGKK+M
Sbjct  55   TSYPLYDSSGCPFIDAEFDCQGYGRPDTQYLKYSWQPDSCNIPRFSGADFLARWRGKKIM  114

Query  393  FVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVK  572
            FVGDSLSLNMW SLACMIHA+VPT+K T+S++ +   VTF +YG+TLY+Y T YLVDIV+
Sbjct  115  FVGDSLSLNMWESLACMIHAAVPTAKTTFSKRNS---VTFVDYGLTLYMYRTPYLVDIVR  171

Query  573  E  575
            E
Sbjct  172  E  172



>ref|NP_564318.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
 sp|Q8VY22.1|TBL38_ARATH RecName: Full=Protein trichome birefringence-like 38 [Arabidopsis 
thaliana]
 gb|AAL66969.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20296.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99289.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31037.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
Length=380

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  332
            GK+   + GCNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W+P+SC
Sbjct  52   GKKQRRASGCNLFQGRWVFDASYPFYDSSKCPFIDGEFDCLKFGRPDKQFLKYSWQPESC  111

Query  333  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTF  512
             +PRFDGG  L+++RGK+VMFVGDSLSLNMW SLACMIHASVP +K T+ ++  LS +TF
Sbjct  112  TIPRFDGGAFLRKYRGKRVMFVGDSLSLNMWESLACMIHASVPNAKTTFLKRTPLSTLTF  171

Query  513  KEYGVTLYLYHTTYLVDIVKE  575
            +EYGVTLYLY T Y+VDI KE
Sbjct  172  QEYGVTLYLYRTPYIVDISKE  192



>ref|NP_565779.1| trichome birefringence-like 37 protein [Arabidopsis thaliana]
 sp|O22960.2|TBL37_ARATH RecName: Full=Protein trichome birefringence-like 37 [Arabidopsis 
thaliana]
 gb|AAB67625.2| expressed protein [Arabidopsis thaliana]
 gb|AAM63505.1| unknown [Arabidopsis thaliana]
 gb|AEC08913.1| trichome birefringence-like 37 protein [Arabidopsis thaliana]
Length=385

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 119/146 (82%), Gaps = 4/146 (3%)
 Frame = +3

Query  150  GGKEIV----SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAW  317
            GGKE++     + GCNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W
Sbjct  51   GGKEMLKGRKQTSGCNLFQGRWVFDASYPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSW  110

Query  318  KPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETL  497
            +PDSC +PRFDG   LK+WRGK+VMFVGDSLSLNMW SLACMIH+SVP +K T+ ++  L
Sbjct  111  QPDSCTVPRFDGEAFLKKWRGKRVMFVGDSLSLNMWESLACMIHSSVPNTKTTFLKRTPL  170

Query  498  SYVTFKEYGVTLYLYHTTYLVDIVKE  575
            S +TF+EY VTL+LY T YLVDI KE
Sbjct  171  SSLTFQEYDVTLFLYRTPYLVDISKE  196



>ref|XP_004149051.1| PREDICTED: uncharacterized protein LOC101203509 [Cucumis sativus]
 ref|XP_004163473.1| PREDICTED: uncharacterized LOC101203509 [Cucumis sativus]
 gb|KGN65647.1| hypothetical protein Csa_1G478060 [Cucumis sativus]
Length=373

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 134/182 (74%), Gaps = 15/182 (8%)
 Frame = +3

Query  63   GVVIIAVLLLVQG-----------HGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVV  209
            G VI+++ LL+Q                 AQ N   +L  G K+   + GCNLF+GRWV+
Sbjct  7    GRVILSLFLLLQASSSWLPFLQQAEAAVTAQPNKRSMLK-GRKQ---ANGCNLFQGRWVI  62

Query  210  DSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  389
            D S+PLY  S+CPFID EFDC KYGRPD  YLKY+W+PDSC+LPRFDG ++LKRW GKK+
Sbjct  63   DPSFPLYNSSSCPFIDSEFDCQKYGRPDSLYLKYSWRPDSCNLPRFDGVDVLKRWSGKKI  122

Query  390  MFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIV  569
            MFVGDSLSLNMW SL+CM+HASVP +K ++ R++++S V F++YGVTL LY T YLVDIV
Sbjct  123  MFVGDSLSLNMWESLSCMLHASVPDAKTSFLRRDSISSVVFQDYGVTLLLYRTPYLVDIV  182

Query  570  KE  575
            +E
Sbjct  183  RE  184



>ref|XP_008371453.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=361

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 116/133 (87%), Gaps = 3/133 (2%)
 Frame = +3

Query  177  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  356
            GCNLF+G WV D+SYPLY  ++CPFIDPEFDCIKYGRPDKQ+LKYAWKPDSC+LPRFDG 
Sbjct  44   GCNLFQGNWVFDASYPLYDSASCPFIDPEFDCIKYGRPDKQFLKYAWKPDSCNLPRFDGV  103

Query  357  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLY  536
            + L+RWRGKK+MFVGDSLSLNMW SL+CMIHASVP +K T+ +  +   V+F++YGVTL+
Sbjct  104  DFLRRWRGKKIMFVGDSLSLNMWESLSCMIHASVPNAKTTFKKAYS---VSFEDYGVTLF  160

Query  537  LYHTTYLVDIVKE  575
            ++ T YLVDIV+E
Sbjct  161  MFRTPYLVDIVRE  173



>ref|XP_002893546.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69805.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  332
            GK+   + GCNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W+P+SC
Sbjct  52   GKKQGRASGCNLFQGRWVFDASYPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSWQPESC  111

Query  333  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTF  512
             +PRFDGG  L+++RGK+VMFVGDSLSLNMW SLACMIHASVP +K T+ ++  LS +TF
Sbjct  112  TIPRFDGGAFLRKYRGKRVMFVGDSLSLNMWESLACMIHASVPNAKTTFLKRTPLSTLTF  171

Query  513  KEYGVTLYLYHTTYLVDIVKE  575
            +EYGVTL+LY T Y+VDI KE
Sbjct  172  QEYGVTLHLYRTPYIVDISKE  192



>ref|XP_006415616.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
 gb|ESQ33969.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
Length=386

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = +3

Query  78   AVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFID  257
             +L+    H    A +    + S  GK+   S  CNLF+GRWV D+SYP Y  S CPFID
Sbjct  33   TLLVNSHHHHNSTAVSGNGGMSSLRGKKQRRSSSCNLFQGRWVFDASYPFYGSSTCPFID  92

Query  258  PEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLA  437
             EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L++WRGK+VMFVGDSLSLNMW SL 
Sbjct  93   GEFDCLKFGRPDKQFLKYSWQPESCSIPRFDGAAFLRKWRGKRVMFVGDSLSLNMWESLG  152

Query  438  CMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            CMIHASVP +K T+ ++  LS +TF+EYGVTLYLY T Y+VDI KE
Sbjct  153  CMIHASVPNAKTTFLKRTPLSTLTFQEYGVTLYLYRTPYIVDISKE  198



>ref|XP_010549391.1| PREDICTED: protein trichome birefringence-like 37 [Tarenaya hassleriana]
Length=387

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            + GCNLF+GRW +D SYPLY  S+CPFID +F+C+K+GRPDKQ+LKY+W+PDSCD+PRF+
Sbjct  64   TSGCNLFQGRWSIDISYPLYDSSSCPFIDDKFNCLKFGRPDKQFLKYSWQPDSCDIPRFN  123

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G E L+RWRGK+V+FVGDSLSLNMW SL CMIHASVP +K T+S+   LS ++F+EYGVT
Sbjct  124  GTEFLRRWRGKRVLFVGDSLSLNMWESLGCMIHASVPNAKTTFSKHGPLSSISFEEYGVT  183

Query  531  LYLYHTTYLVDIVKE  575
            LYLY T YLVDI KE
Sbjct  184  LYLYRTPYLVDISKE  198



>ref|XP_009348409.1| PREDICTED: protein trichome birefringence-like 38 [Pyrus x bretschneideri]
Length=361

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 130/170 (76%), Gaps = 7/170 (4%)
 Frame = +3

Query  66   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  245
            +V + VL+        A Q++ S L     ++ VS  GCNLF+G WV D+SY LY  ++C
Sbjct  11   LVALQVLVFFSEEAEAAEQSHGSSLRV--HRKQVS--GCNLFQGNWVFDASYTLYDSASC  66

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFIDPEFDCIKYGRPDKQ+LKYAWKPDSC+LPRFDG + L RWRGKK+MFVGDSLSLNMW
Sbjct  67   PFIDPEFDCIKYGRPDKQFLKYAWKPDSCNLPRFDGVDFLTRWRGKKIMFVGDSLSLNMW  126

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SL+CMIHASVP +K T+ +  +   V+F++YGVTL+++ T YLVDIV+E
Sbjct  127  ESLSCMIHASVPNAKTTFKKAYS---VSFEDYGVTLFMFRTPYLVDIVRE  173



>ref|XP_003529365.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN31006.1| hypothetical protein glysoja_020304 [Glycine soja]
Length=368

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 128/170 (75%), Gaps = 5/170 (3%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQNNVSHLLSW--GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  245
            +  + L    H  RAA+++ +H ++   G KE+     CNLF G WV+D S+PLY  S+C
Sbjct  13   LFCLALFESLHQARAAKSHNNHNVTRLKGRKEL---NRCNLFIGSWVIDPSHPLYDSSSC  69

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFID EFDC KYGRPDKQYLKY+WKPDSC LPRFDG   L +W+GKK+MFVGDSLSLNMW
Sbjct  70   PFIDAEFDCQKYGRPDKQYLKYSWKPDSCALPRFDGVNFLNKWKGKKIMFVGDSLSLNMW  129

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SL+CM+HASVP +  ++ R++ LS VTF++YGVT+ LY T YLVDI++E
Sbjct  130  ESLSCMLHASVPNATTSFVRRQALSTVTFQDYGVTIQLYRTPYLVDIIQE  179



>ref|XP_008443074.1| PREDICTED: protein trichome birefringence-like 37 [Cucumis melo]
Length=442

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 139/194 (72%), Gaps = 20/194 (10%)
 Frame = +3

Query  30   KMGVGQKVMWSGVVIIAVLLLVQGHG------------GRAAQNNVSHLLSWGGKEIVSS  173
            +MG G    W G VI+A+ LL+Q                  A+ N   +L  G K+   +
Sbjct  68   EMGFG---FW-GRVILALFLLLQASSLWLPFLQQAEAAAATAKPNKRSMLK-GRKQ---A  119

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
             GCNLF+GRWV+D S+PLY  S+CPFID EFDC KYGRPD  YLKY+W+PDSC+LPRFDG
Sbjct  120  NGCNLFQGRWVIDPSFPLYNSSSCPFIDSEFDCQKYGRPDSLYLKYSWRPDSCNLPRFDG  179

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
             ++LKRW GKK+MFVGDSLSLNMW SL+CM+HASVP +K ++ R++++S V F++YGVTL
Sbjct  180  VDVLKRWSGKKIMFVGDSLSLNMWESLSCMLHASVPDAKTSFLRRDSISSVVFQDYGVTL  239

Query  534  YLYHTTYLVDIVKE  575
             LY T YLVDIVKE
Sbjct  240  LLYRTPYLVDIVKE  253



>ref|XP_002522557.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39857.1| conserved hypothetical protein [Ricinus communis]
Length=370

 Score =   213 bits (543),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 129/168 (77%), Gaps = 3/168 (2%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  251
            ++ +   +Q    +    NV+ LL  G K++ S+  CNLF+G+WVVD +YPLY  S CPF
Sbjct  19   LVLLFTFLQETTAQQHYYNVTRLLK-GRKQVSST--CNLFQGKWVVDPAYPLYDASGCPF  75

Query  252  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  431
            IDPEF+C K+GRPD QYLKY+W+PDSC++PRF+G + L+RWRGKK+MFVGDSLSLNMW S
Sbjct  76   IDPEFNCQKFGRPDTQYLKYSWQPDSCNVPRFNGVDFLRRWRGKKIMFVGDSLSLNMWES  135

Query  432  LACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            L+CMIHASVP +K +   +++L  VTF EY VTLY++ T YLVDIV+E
Sbjct  136  LSCMIHASVPNAKTSSVDRDSLHSVTFDEYDVTLYMFRTPYLVDIVRE  183



>ref|XP_011460601.1| PREDICTED: protein trichome birefringence-like 38 [Fragaria vesca 
subsp. vesca]
Length=370

 Score =   213 bits (542),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 127/160 (79%), Gaps = 5/160 (3%)
 Frame = +3

Query  99   GHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSY-PLYQPSNCPFIDPEFDCI  275
            GH G +  ++   +L  G K++ S   CNLF+G WV D S+ P+Y  S+C FID EFDCI
Sbjct  27   GHHGSSVGHH-GRVLKRGRKQVTS---CNLFQGNWVFDPSWNPMYDSSSCHFIDAEFDCI  82

Query  276  KYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHAS  455
            KYGRPDKQ+LKYAWKPDSC+LPRFDG + L RWRGKK+MFVGDSLSLNMW SL+CMIHAS
Sbjct  83   KYGRPDKQFLKYAWKPDSCNLPRFDGADFLNRWRGKKIMFVGDSLSLNMWESLSCMIHAS  142

Query  456  VPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            VP++K T+ +++ +S V F++YGVTLYL+ T YLVDIV+E
Sbjct  143  VPSAKNTFVKKDPISTVNFQDYGVTLYLFRTPYLVDIVRE  182



>emb|CAN60202.1| hypothetical protein VITISV_036403 [Vitis vinifera]
Length=367

 Score =   213 bits (542),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 129/181 (71%), Gaps = 15/181 (8%)
 Frame = +3

Query  63   GVVIIAVLLLVQG--------HGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGRWVVD  212
            GV  +   L+VQG           RA     NVS L S   ++ VSS  CNLF+G+WV D
Sbjct  2    GVSTVRCHLVVQGLLFLILLLQQARADHQVYNVSGLRS---RKQVSS--CNLFQGKWVFD  56

Query  213  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  392
            +SYP Y  SNCPFIDPEFDC KYGRPDKQYLKY+WKPDSCDLPRFDG + L+RWRGK++M
Sbjct  57   ASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSWKPDSCDLPRFDGLDFLRRWRGKRIM  116

Query  393  FVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVK  572
            FVGDSLSLN W SL CMIH S P +K ++ +++ L+ VTF  Y V++ LY T YLVDIV+
Sbjct  117  FVGDSLSLNQWESLVCMIHQSAPNAKASFVKKDGLATVTFDGYAVSVSLYRTPYLVDIVR  176

Query  573  E  575
            E
Sbjct  177  E  177



>ref|XP_006410551.1| hypothetical protein EUTSA_v10016785mg [Eutrema salsugineum]
 gb|ESQ52004.1| hypothetical protein EUTSA_v10016785mg [Eutrema salsugineum]
Length=385

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +3

Query  177  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  356
            GCNLF+G+WV D+S P Y  S CPFID EFDC+K+GRPDKQ+LKY+W+PD+C +PRFDG 
Sbjct  64   GCNLFQGKWVFDASKPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSWQPDACTIPRFDGE  123

Query  357  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLY  536
              LK+WRGK+VMFVGDSLSLNMW SL CMIHASVP +KIT+ ++  LS +TF+EYGVTLY
Sbjct  124  AFLKKWRGKRVMFVGDSLSLNMWESLGCMIHASVPDTKITFLKRTPLSSLTFQEYGVTLY  183

Query  537  LYHTTYLVDIVKE  575
            LY T YLVDI KE
Sbjct  184  LYRTPYLVDISKE  196



>emb|CBI30668.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   213 bits (542),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 131/185 (71%), Gaps = 15/185 (8%)
 Frame = +3

Query  51   VMWSGVVIIAVLLLVQG--------HGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGR  200
             ++ GV  +   L+VQG           RA     NVS L S   ++ VSS  CNLF+G+
Sbjct  8    TIYMGVSTVRCHLVVQGLLFLILLLQQARADHQVYNVSGLRS---RKQVSS--CNLFQGK  62

Query  201  WVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRG  380
            WV D+SYP Y  SNCPFIDPEFDC KYGRPDKQYLKY+WKPDSCDLPRFDG + L+RWRG
Sbjct  63   WVFDASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSWKPDSCDLPRFDGLDFLRRWRG  122

Query  381  KKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLV  560
            K++MFVGDSLSLN W SL CMIH S P +K ++ +++ L+ VTF  Y V++ LY T YLV
Sbjct  123  KRIMFVGDSLSLNQWESLVCMIHQSAPNAKASFVKKDGLATVTFDGYAVSVSLYRTPYLV  182

Query  561  DIVKE  575
            DIV+E
Sbjct  183  DIVRE  187



>ref|XP_004134666.1| PREDICTED: uncharacterized protein LOC101216213 [Cucumis sativus]
 ref|XP_004155544.1| PREDICTED: uncharacterized protein LOC101228403 [Cucumis sativus]
 gb|KGN49297.1| hypothetical protein Csa_6G519500 [Cucumis sativus]
Length=362

 Score =   212 bits (540),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 128/170 (75%), Gaps = 6/170 (4%)
 Frame = +3

Query  69   VIIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  245
            +++ VL  +     +A    N+S++ S  GK++ +   CNLF G+WV D S PLY+ S+C
Sbjct  11   LLLQVLFFISLESAKAEDFYNISNVGS--GKQVRT---CNLFEGKWVFDPSLPLYESSSC  65

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFIDPEF+C KYGRPD+ YLKY WKPD CDLPRFDG ELL+RWRGKK+MFVGDSLSLNMW
Sbjct  66   PFIDPEFNCQKYGRPDRSYLKYTWKPDFCDLPRFDGLELLRRWRGKKIMFVGDSLSLNMW  125

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SL CMI AS P +K +  R+E++S V F++YGV+L LY T YLVD+VKE
Sbjct  126  QSLTCMIRASAPKTKTSVVRRESISTVIFQDYGVSLLLYRTPYLVDVVKE  175



>ref|XP_006294394.1| hypothetical protein CARUB_v10023411mg [Capsella rubella]
 gb|EOA27292.1| hypothetical protein CARUB_v10023411mg [Capsella rubella]
Length=385

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = +3

Query  150  GGKEIV----SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAW  317
            GGKE++     + GCNLF+G+WV D SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W
Sbjct  51   GGKEVLKGRKQTSGCNLFQGKWVFDPSYPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSW  110

Query  318  KPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETL  497
             PDSC +PRFDG   LKRWRGK+VMFVGDSLSLNMW SL CMI++SVP +K T+ ++  L
Sbjct  111  LPDSCTVPRFDGAAFLKRWRGKRVMFVGDSLSLNMWESLGCMIYSSVPNTKTTFLKRTPL  170

Query  498  SYVTFKEYGVTLYLYHTTYLVDIVKE  575
            S +TF+EY VT+YLY T YLVDI KE
Sbjct  171  SSLTFQEYDVTIYLYRTPYLVDISKE  196



>ref|XP_010509796.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 4/146 (3%)
 Frame = +3

Query  150  GGKEIV----SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAW  317
            GGKE++     + GCNLF+G+WV D SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W
Sbjct  51   GGKEVMKGRKQTSGCNLFQGKWVFDPSYPFYNYSTCPFIDGEFDCLKFGRPDKQFLKYSW  110

Query  318  KPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETL  497
            +PDSC +PRFDG   L+RWRGK+VMFVGDSLSLNMW SLACMI++SVP +K T+ ++  L
Sbjct  111  QPDSCTVPRFDGAAFLRRWRGKRVMFVGDSLSLNMWESLACMIYSSVPDTKTTFLKRTPL  170

Query  498  SYVTFKEYGVTLYLYHTTYLVDIVKE  575
            S +TF+EY  TLYLY T YLVDI KE
Sbjct  171  SSLTFQEYDFTLYLYRTPYLVDISKE  196



>ref|XP_002274664.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
Length=409

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 129/181 (71%), Gaps = 15/181 (8%)
 Frame = +3

Query  63   GVVIIAVLLLVQG--------HGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGRWVVD  212
            GV  +   L+VQG           RA     NVS L S   ++ VSS  CNLF+G+WV D
Sbjct  44   GVSTVRCHLVVQGLLFLILLLQQARADHQVYNVSGLRS---RKQVSS--CNLFQGKWVFD  98

Query  213  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  392
            +SYP Y  SNCPFIDPEFDC KYGRPDKQYLKY+WKPDSCDLPRFDG + L+RWRGK++M
Sbjct  99   ASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSWKPDSCDLPRFDGLDFLRRWRGKRIM  158

Query  393  FVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVK  572
            FVGDSLSLN W SL CMIH S P +K ++ +++ L+ VTF  Y V++ LY T YLVDIV+
Sbjct  159  FVGDSLSLNQWESLVCMIHQSAPNAKASFVKKDGLATVTFDGYAVSVSLYRTPYLVDIVR  218

Query  573  E  575
            E
Sbjct  219  E  219



>gb|AFK45250.1| unknown [Lotus japonicus]
Length=361

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  RAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRP  290
            +A+  N  ++    GK+ V +GGCN F G WVVD S  LY  S+ PFID EF+C KYGRP
Sbjct  18   QASAQNFHNVTGLRGKKPVVNGGCNFFIGTWVVDPSNHLYDSSSYPFIDSEFNCQKYGRP  77

Query  291  DKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  470
            D Q LKYAWKPDSC LPRFDG + L RW+GKK+MFVGDSLSLNMW SLACMIHASVP +K
Sbjct  78   DTQCLKYAWKPDSCALPRFDGKDFLNRWKGKKIMFVGDSLSLNMWESLACMIHASVPNAK  137

Query  471  ITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             ++ R+E+LS VTF++YGVT+ LY T YLVDI++E
Sbjct  138  TSFLRKESLSTVTFQDYGVTIQLYRTPYLVDIIRE  172



>ref|XP_010277748.1| PREDICTED: protein trichome birefringence-like 39 [Nelumbo nucifera]
Length=361

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  251
            +I  LLL           N S L       I  +GGCNLF+G WV D+SYPLY  S+CPF
Sbjct  11   VICFLLLFLKQARTEQFYNESSL-----SNIKLAGGCNLFQGSWVYDASYPLYDSSSCPF  65

Query  252  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  431
            IDPEFDC KYGRPD+ YLKY WKP+SC++PRF+G + L+RW+GKK+MFVGDSLS+N W S
Sbjct  66   IDPEFDCEKYGRPDRLYLKYRWKPNSCEVPRFNGLDFLRRWKGKKIMFVGDSLSVNQWQS  125

Query  432  LACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            L C++H+SVP +K T +R E LS VTF +YGVT+ LYHTTYLVDIV E
Sbjct  126  LTCLLHSSVPNAKYTLTRNEPLSSVTFVDYGVTVLLYHTTYLVDIVPE  173



>ref|XP_009102887.1| PREDICTED: protein trichome birefringence-like 38 [Brassica rapa]
 emb|CDY57453.1| BnaA07g36480D [Brassica napus]
Length=378

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = +3

Query  81   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  260
             LL    H    A   +S L    GK+  S  GCNLF+GRWV D+SYP Y   +CPFID 
Sbjct  31   TLLKNTNHRNSTADGGMSSLR---GKKQRS--GCNLFQGRWVFDASYPFYDSFSCPFIDG  85

Query  261  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  440
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+R RGK+VMFVGDSLSLNMW SL C
Sbjct  86   EFDCLKFGRPDKQFLKYSWQPESCTIPRFDGAAFLRRLRGKRVMFVGDSLSLNMWESLGC  145

Query  441  MIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MIHASVP +K T+ +   LS +TF+EYGVTL+LY TTY+VDI KE
Sbjct  146  MIHASVPKTKTTFVKGTPLSTITFQEYGVTLHLYRTTYIVDISKE  190



>emb|CDX94643.1| BnaC07g10150D [Brassica napus]
Length=378

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = +3

Query  81   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  260
             LL    H    A   +S L    GK+  S  GCNLF+GRWV D+SYP Y   +CPFID 
Sbjct  31   TLLENTNHRNSTADGGMSSLR---GKKQRS--GCNLFQGRWVFDASYPFYDSLSCPFIDG  85

Query  261  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  440
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+R RGK+VMFVGDSLSLNMW SL C
Sbjct  86   EFDCLKFGRPDKQFLKYSWQPESCTIPRFDGAAFLRRLRGKRVMFVGDSLSLNMWESLGC  145

Query  441  MIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MIHASVP +K T+ +   LS +TF+EYGVTL+LY TTY+VDI KE
Sbjct  146  MIHASVPKTKTTFVKGTPLSTITFQEYGVTLHLYRTTYIVDISKE  190



>ref|XP_008383643.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=361

 Score =   210 bits (534),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 109/132 (83%), Gaps = 3/132 (2%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CNLF G WV D+SYPLY  + CPFIDPEFDCIKYGRPD Q+LKYAWKPDSCDLPRFDG +
Sbjct  45   CNLFEGNWVFDASYPLYDSATCPFIDPEFDCIKYGRPDTQFLKYAWKPDSCDLPRFDGVD  104

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYL  539
             L+RWRGKK+MFVGDSLSLNMW SL+CMIHASVP +K T+    +   V F++YGVTL++
Sbjct  105  FLRRWRGKKIMFVGDSLSLNMWESLSCMIHASVPDAKTTFRNGHS---VNFEDYGVTLFM  161

Query  540  YHTTYLVDIVKE  575
            + T YLVDI +E
Sbjct  162  FRTPYLVDIXRE  173



>ref|XP_010540499.1| PREDICTED: protein trichome birefringence-like 38 [Tarenaya hassleriana]
Length=380

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  332
            GK    + GCNLF+GRW VD S PLY  S CPFID EF+C+K+GRPDKQ+LKY+W+PDSC
Sbjct  51   GKIQRQTSGCNLFQGRWTVDVSNPLYDSSTCPFIDAEFNCLKFGRPDKQFLKYSWQPDSC  110

Query  333  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTF  512
             +PRF+G E L+RWRGK+VMFVGDSLSLNMW SL CMIHAS P  K T+ ++  LS +TF
Sbjct  111  AVPRFNGIEFLRRWRGKRVMFVGDSLSLNMWESLGCMIHASAPNVKFTFVKRTPLSSITF  170

Query  513  KEYGVTLYLYHTTYLVDIVKE  575
            + YGVTLYLY T YLVDI +E
Sbjct  171  EGYGVTLYLYRTPYLVDISRE  191



>gb|KFK44758.1| hypothetical protein AALP_AA1G299000 [Arabis alpina]
Length=380

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 14/161 (9%)
 Frame = +3

Query  93   VQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDC  272
            V GHGG ++           GK+   + GCNLF+GRWV D+SYP Y  S CPFID EFDC
Sbjct  46   VSGHGGTSSLR---------GKK--QTRGCNLFQGRWVFDASYPFYDSSTCPFIDGEFDC  94

Query  273  IKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHA  452
            +K+GRPDKQ+LKY+W+P++C +PRFDG   L++WRGK+VMFVGDSLSLNMW SLACMIHA
Sbjct  95   LKFGRPDKQFLKYSWQPEACTIPRFDGAAFLRKWRGKQVMFVGDSLSLNMWESLACMIHA  154

Query  453  SVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SVP +K T+ +  T   +TF+EYGVTL++Y T Y+VDI KE
Sbjct  155  SVPNAKTTFRKGST---ITFQEYGVTLHMYRTPYIVDISKE  192



>ref|XP_010469399.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            + GCNLF+G+WV D SYP Y  S CPFID EFDC+K+ RPDKQ+LKY+W+PDSC +PRFD
Sbjct  62   TSGCNLFQGKWVFDPSYPFYNSSTCPFIDGEFDCLKFDRPDKQFLKYSWQPDSCTVPRFD  121

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L+RWRGK+VMFVGDSLSLNMW SLACMIH+SVP +K T+ ++  LS +TF+EY VT
Sbjct  122  GTAFLRRWRGKRVMFVGDSLSLNMWESLACMIHSSVPDTKSTFLKRAPLSSLTFQEYDVT  181

Query  531  LYLYHTTYLVDIVKE  575
            LYLY T YLVDI KE
Sbjct  182  LYLYRTPYLVDISKE  196



>ref|XP_008439751.1| PREDICTED: protein trichome birefringence-like 38 [Cucumis melo]
Length=362

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 126/170 (74%), Gaps = 6/170 (4%)
 Frame = +3

Query  69   VIIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  245
            +++ VL  +     +A    N+S++ S  GK+      CNLF G+WV D S PLY+ S+C
Sbjct  11   LLLQVLFFISLESAKAEDFYNISNVGS--GKQ---ERTCNLFEGKWVFDPSLPLYESSSC  65

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFIDPEF+C KYGRPD+ YLKY WKPD CDLPRFDG ELL+RWRGKK+MFVGDSLSLNMW
Sbjct  66   PFIDPEFNCQKYGRPDRSYLKYTWKPDFCDLPRFDGLELLRRWRGKKIMFVGDSLSLNMW  125

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SL CMI AS P +K +  R+E++S V F++YGV+L LY T +LVD+VKE
Sbjct  126  QSLTCMIRASAPKTKTSIVRRESVSTVIFQDYGVSLLLYRTPFLVDVVKE  175



>ref|XP_009411213.1| PREDICTED: protein trichome birefringence-like 38 [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            KE  S   CN+FRG WV D SYPLY  S CPF+DPEFDC +YGRPDK YLKY WKPD+C+
Sbjct  29   KEGASGISCNMFRGSWVYDQSYPLYDSSTCPFLDPEFDCQRYGRPDKSYLKYRWKPDACE  88

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            LPRF+G +LL+RW+GKK+MFVGDS+S+N W SL CM+HA+VP +K TY + +TLS +TF 
Sbjct  89   LPRFNGLDLLRRWKGKKIMFVGDSISVNQWQSLVCMLHAAVPDAKTTYKKNDTLSTITFT  148

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            +YGV++  Y +TYLVDIV+E
Sbjct  149  DYGVSVIRYQSTYLVDIVEE  168



>ref|XP_011086013.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=354

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 124/168 (74%), Gaps = 11/168 (7%)
 Frame = +3

Query  75   IAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSS-YPLYQPSNCPF  251
            I ++ LV   G     +NVS +          +GGCNLFRG+W+ DSS +PLY  S+CPF
Sbjct  11   IFIVFLVCAVGNAELFDNVSDV----------AGGCNLFRGQWLYDSSSHPLYDSSSCPF  60

Query  252  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  431
            I+ EFDC+KYGRPDK YL Y WKPDSC LPRFDG + L+RW+GKK+MFVGDSLSLN WNS
Sbjct  61   INSEFDCLKYGRPDKLYLNYTWKPDSCTLPRFDGADFLRRWKGKKIMFVGDSLSLNQWNS  120

Query  432  LACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            L CM+HA+ P +  ++ R   +SY+TF++YGVT++LY T YLVD+V+E
Sbjct  121  LVCMLHAAAPKANTSFVRGNPISYITFQDYGVTVFLYTTHYLVDVVQE  168



>ref|XP_009123178.1| PREDICTED: protein trichome birefringence-like 38 [Brassica rapa]
 emb|CDY34081.1| BnaA09g27070D [Brassica napus]
Length=376

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 122/165 (74%), Gaps = 7/165 (4%)
 Frame = +3

Query  81   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  260
             LL+   H    AQ  +S L    GK+  S  GCNLF+GRWV D+SYP Y  S+CPFID 
Sbjct  31   TLLVNTDHRNSTAQGGLSSLR---GKKQRS--GCNLFQGRWVFDASYPFYDTSSCPFIDG  85

Query  261  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  440
            EF+C K  RPDKQ+LKY+W+P SC +PRFDG   L+RWRGK+VMFVGDSLSLNMW SL C
Sbjct  86   EFNCGK--RPDKQFLKYSWQPASCSIPRFDGAAFLRRWRGKRVMFVGDSLSLNMWESLGC  143

Query  441  MIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MIHASVP +K T+ ++  LS +TF+EYGVTLYLY T Y+VDI KE
Sbjct  144  MIHASVPNAKYTFLKRTPLSTITFQEYGVTLYLYRTPYIVDIAKE  188



>ref|XP_010413780.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            + GCNLF+G+WV D SYP Y  S CPFID E DC+K+GRPDKQ+LKY+W+PDSC +PRFD
Sbjct  62   TSGCNLFQGKWVFDPSYPFYNSSTCPFIDGELDCLKFGRPDKQFLKYSWQPDSCTVPRFD  121

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L+RWRGK+VMFVGDSLSLNMW SLACMI++SVP +K T+ ++  LS +TF+EY VT
Sbjct  122  GEAFLRRWRGKRVMFVGDSLSLNMWESLACMIYSSVPDTKTTFLKRAPLSSLTFQEYDVT  181

Query  531  LYLYHTTYLVDIVKE  575
            LYLY T YLVDI KE
Sbjct  182  LYLYRTPYLVDISKE  196



>ref|XP_009396650.1| PREDICTED: protein trichome birefringence-like 37 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 4/153 (3%)
 Frame = +3

Query  120  QNNVSHLLSWGGKEIVSSGGC-NLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDK  296
            +NN      W   E  S   C N+FRGRWV D +YPLY  S+CPF++PEFDC +YGR DK
Sbjct  36   RNNGGSARKW---ERASGVSCKNMFRGRWVYDETYPLYDSSSCPFLEPEFDCQRYGRTDK  92

Query  297  QYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  476
             YLKY WKPD C+LPRFDG +LLKRW+GKK+MFVGDS+SLN W SL CM+HA+VP ++ T
Sbjct  93   MYLKYRWKPDGCELPRFDGQDLLKRWKGKKIMFVGDSISLNQWQSLGCMLHAAVPNARTT  152

Query  477  YSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            Y+R+E LS + F++YGV++  YHTTYLVDIV E
Sbjct  153  YTRKEALSTIAFEDYGVSVVYYHTTYLVDIVNE  185



>emb|CDY64767.1| BnaCnng44810D [Brassica napus]
Length=381

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 119/160 (74%), Gaps = 5/160 (3%)
 Frame = +3

Query  111  RAAQNNVSHLLSWGGKEIVSSG-----GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCI  275
            + +  N++ L + GG +    G     GCNLF+G+WV D+SYPLY  S CPFI+ EFDC+
Sbjct  33   QVSHRNITALAATGGGKATLKGRKQTSGCNLFQGKWVFDASYPLYDSSTCPFINGEFDCL  92

Query  276  KYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHAS  455
            K+GRPDK++L Y+W+PDSC +PRFDG   L +WRGK+VMFVGDSLS NMW SL CMIHAS
Sbjct  93   KFGRPDKKFLNYSWQPDSCTIPRFDGEAFLNQWRGKRVMFVGDSLSENMWESLGCMIHAS  152

Query  456  VPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            VP    T+ R+  LS +TF+EYGVTLY+Y T YLVDI KE
Sbjct  153  VPGITTTFLRRTPLSSLTFQEYGVTLYIYRTPYLVDISKE  192



>ref|XP_003593751.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
Length=376

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 130/191 (68%), Gaps = 24/191 (13%)
 Frame = +3

Query  63   GVVIIAVLLLV----QGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  230
            G   I +LLL     Q   G A  +NVS L    GK+ V + GCNLF G WVVD SYPLY
Sbjct  2    GFRAITLLLLFSLFHQLLLGEAKFHNVSSL---RGKKPVVTNGCNLFIGSWVVDPSYPLY  58

Query  231  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  410
              S+CPFIDPEF+C KYGRPDKQYLKY+WKPDSC LP FDG + L +WRGKK+MFVGDSL
Sbjct  59   D-SSCPFIDPEFNCQKYGRPDKQYLKYSWKPDSCALPSFDGKDFLNKWRGKKIMFVGDSL  117

Query  411  SLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK----------------EYGVTLYLY  542
            SLNMW SL+CMIHASVP  K ++ R+E  S VTF+                +YGVT+ LY
Sbjct  118  SLNMWESLSCMIHASVPNVKTSFLRREAQSTVTFQVYFILFLLYLCLLSNLDYGVTIQLY  177

Query  543  HTTYLVDIVKE  575
             T YLVDI++E
Sbjct  178  RTPYLVDIIRE  188



>ref|XP_002279857.1| PREDICTED: protein trichome birefringence-like 39 [Vitis vinifera]
Length=364

 Score =   207 bits (527),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 121/160 (76%), Gaps = 4/160 (3%)
 Frame = +3

Query  96   QGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCI  275
            Q  G   +  N + L     +E+  +G CN FRG+WV DSSYPLY  S+CPFIDPEFDCI
Sbjct  20   QTEGENFSNANTTRLSR--AREL--AGRCNFFRGKWVYDSSYPLYDSSSCPFIDPEFDCI  75

Query  276  KYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHAS  455
            KYGRPDKQYLKY W+P SC+LPRF+G + L+RWRGK++MFVGDSLS N W SL+CMIH+S
Sbjct  76   KYGRPDKQYLKYRWQPLSCNLPRFNGLDFLERWRGKRIMFVGDSLSFNQWQSLSCMIHSS  135

Query  456  VPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            VP ++ +  +   LS +TF++YGV L LY TTYLVD+V+E
Sbjct  136  VPNARTSLMKSGPLSSLTFEDYGVKLMLYRTTYLVDLVRE  175



>ref|XP_009352799.1| PREDICTED: protein trichome birefringence-like 37 [Pyrus x bretschneideri]
Length=361

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 109/132 (83%), Gaps = 3/132 (2%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CNLF G WV D+SYPLY  + CPFIDPEFDCIKYGRPD Q+LKYAWKP SCDLPRFDG +
Sbjct  45   CNLFEGNWVFDASYPLYDSATCPFIDPEFDCIKYGRPDTQFLKYAWKPASCDLPRFDGVD  104

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYL  539
             L+RW GKK+MFVGDSLSLNMW SL+CMIHASVP +K T+ +  +   V F++YGVTL++
Sbjct  105  FLRRWSGKKIMFVGDSLSLNMWESLSCMIHASVPNAKTTFRKGYS---VNFEDYGVTLFM  161

Query  540  YHTTYLVDIVKE  575
            + T YLVDIV+E
Sbjct  162  FRTPYLVDIVRE  173



>emb|CDX79555.1| BnaC03g18910D [Brassica napus]
Length=380

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = +3

Query  102  HGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKY  281
            H  RAA +    +     K    + GCNLF+GRW+ D+SYP Y  S CPFID EF+C  +
Sbjct  36   HRNRAALDAAGGVGKVALKGRKQTSGCNLFQGRWIFDASYPFYDSSMCPFIDSEFNC--F  93

Query  282  GRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP  461
            GRPDKQ+LKY+W+PDSC +PRFDG   L +WRGK+VMFVGDSLSLNMW SLACMIH+SVP
Sbjct  94   GRPDKQFLKYSWQPDSCSIPRFDGQAFLNKWRGKRVMFVGDSLSLNMWESLACMIHSSVP  153

Query  462  TSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SK T+ ++  LS +TF+EYGV LYLY T YLVDI KE
Sbjct  154  DSKTTFIKRTPLSSLTFQEYGVALYLYRTPYLVDISKE  191



>ref|XP_010279090.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=361

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 122/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  251
            +I  L +    G      NVS L    G++   +G CNLF+G WV DSSYPLY  S+CPF
Sbjct  11   VICFLFVFLQQGKTEQFYNVSSLR---GRK--PAGSCNLFQGSWVDDSSYPLYDSSSCPF  65

Query  252  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  431
            IDPEFDC KYGRPDK YL+Y WKP +C+LPRF+G + L RWRGKK+MFVGDSLSLN W S
Sbjct  66   IDPEFDCQKYGRPDKLYLQYRWKPSNCELPRFNGVDFLTRWRGKKIMFVGDSLSLNQWQS  125

Query  432  LACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            L C++HASVP +K T +R   LS V F++Y V++ LYHTTYLVDIV+E
Sbjct  126  LTCLLHASVPNAKTTVTRSTPLSSVIFEDYEVSVLLYHTTYLVDIVRE  173



>gb|AES90337.2| trichome birefringence-like protein [Medicago truncatula]
Length=352

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 120/168 (71%), Gaps = 16/168 (10%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  251
            + ++ LLV  H   A ++N                 CNLF G WV+DSSYPLY  S+CPF
Sbjct  13   LFSIALLVSMHPATAQKSN----------------NCNLFFGSWVIDSSYPLYDSSSCPF  56

Query  252  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  431
            ++ +FDC ++GRPD QYLKY+WKPDSCDLPRF+G + L RW+ KK+MFVGDSLSLNMW S
Sbjct  57   VEAQFDCQQFGRPDNQYLKYSWKPDSCDLPRFNGEDFLNRWKDKKIMFVGDSLSLNMWES  116

Query  432  LACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            L+CMIHASVP    ++SR+E +S V F+ YGVT+ LY T YLVDI++E
Sbjct  117  LSCMIHASVPNVTTSFSRKEPMSTVFFRNYGVTIQLYRTPYLVDIIQE  164



>ref|XP_003518885.1| PREDICTED: protein YLS7-like [Glycine max]
Length=371

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 128/176 (73%), Gaps = 13/176 (7%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQ-------NNVSHLLSWGGKEIVSSGGCNLFRGRWVVD-SSYPL  227
            +  + L V  H  RAA+       +NV+ L   G KE+     CNLF G WV+D SS+PL
Sbjct  13   LFCLALFVSLHQARAAKSHNNDNNHNVARLK--GRKEL---NRCNLFIGSWVIDPSSHPL  67

Query  228  YQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDS  407
            Y  S+CPFID EFDC KYGRPD+QYLKY+WKPDSC LPRFDG   L +W+GKK+MFVGDS
Sbjct  68   YDSSSCPFIDAEFDCQKYGRPDRQYLKYSWKPDSCALPRFDGVSFLNKWKGKKIMFVGDS  127

Query  408  LSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            LSLNMW SL+CM+HASVP +  ++ R++ +S VTF++YGVT+ LY T YLVDI +E
Sbjct  128  LSLNMWESLSCMLHASVPNATTSFVRRQAISTVTFEDYGVTIQLYRTPYLVDIDRE  183



>emb|CDY30832.1| BnaC05g22080D [Brassica napus]
Length=376

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 121/165 (73%), Gaps = 7/165 (4%)
 Frame = +3

Query  81   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  260
             LL+   H    A   +S L    GK+  S  GCNLF+GRWV D+SYP Y  S+CPFID 
Sbjct  31   TLLVNTDHRNSTAHGGLSSLR---GKKQRS--GCNLFQGRWVFDASYPFYDTSSCPFIDG  85

Query  261  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  440
            EF+C K  RPDKQ+LKY+W+P SC +PRFDG   L+RWRGK+VMFVGDSLSLNMW SL C
Sbjct  86   EFNCGK--RPDKQFLKYSWQPASCSIPRFDGAAFLRRWRGKRVMFVGDSLSLNMWESLGC  143

Query  441  MIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MIHASVP +K T+ ++  LS +TF+EYGVTLYLY T Y+VDI +E
Sbjct  144  MIHASVPNAKYTFLKRTPLSTITFQEYGVTLYLYRTPYIVDIARE  188



>ref|XP_009141359.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=384

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPD+Q+LKY+W+PDSC +PRFDG  
Sbjct  64   CNLFQGRWVFDASYPFYDSSTCPFIDGEFDCLKFGRPDRQFLKYSWQPDSCTIPRFDGQA  123

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYL  539
             L +WRGK+VMFVGDSLS NMW SL CMIHASVP +K T+ ++  +S + F+EYGVT++L
Sbjct  124  FLNKWRGKRVMFVGDSLSQNMWESLGCMIHASVPDTKTTFIKRTPVSSLIFQEYGVTIFL  183

Query  540  YHTTYLVDIVKE  575
            Y T YLVDI KE
Sbjct  184  YRTPYLVDISKE  195



>emb|CDY17220.1| BnaA05g09680D [Brassica napus]
Length=381

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 120/172 (70%), Gaps = 5/172 (3%)
 Frame = +3

Query  75   IAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSG-----GCNLFRGRWVVDSSYPLYQPS  239
            +A   L      + +  N++ L   GG +    G     GCNLF+G+WV D+S PLY  S
Sbjct  21   VADKALTSDKKQQVSHRNITALAVAGGGKATLKGRKQTSGCNLFQGKWVFDASSPLYDSS  80

Query  240  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  419
             CPFI+ EFDC+K+GRPDK++L Y+W+PDSC +PRFDG   L +WRGK+VMFVGDSLS N
Sbjct  81   TCPFINGEFDCLKFGRPDKKFLNYSWQPDSCTIPRFDGEAFLNQWRGKRVMFVGDSLSEN  140

Query  420  MWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            MW SL CMIHASVP    T+ R+  LS +TF+EYGVTLY+Y T YLVDI KE
Sbjct  141  MWESLGCMIHASVPGITTTFLRRTPLSSLTFQEYGVTLYIYRTPYLVDISKE  192



>gb|KHN32337.1| hypothetical protein glysoja_032520 [Glycine soja]
Length=371

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 127/176 (72%), Gaps = 13/176 (7%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQ-------NNVSHLLSWGGKEIVSSGGCNLFRGRWVVD-SSYPL  227
            +  + L V  H  RAA+       +NV+ L   G KE+     CNLF G WV+D SS+PL
Sbjct  13   LFCLALFVSLHQARAAKSHNNDNNHNVARLK--GRKEL---NRCNLFIGSWVIDPSSHPL  67

Query  228  YQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDS  407
            Y  S+CPFID EFDC KYGRPD+QYLKY+WKPDSC LPRFDG   L +W+GKK+MFVGDS
Sbjct  68   YDSSSCPFIDAEFDCQKYGRPDRQYLKYSWKPDSCALPRFDGVSFLNKWKGKKIMFVGDS  127

Query  408  LSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            LSLNMW SL+CM+HASVP +  ++ R++ +S VTF++YGV + LY T YLVDI +E
Sbjct  128  LSLNMWESLSCMLHASVPNATTSFVRRQAISTVTFEDYGVIIQLYRTPYLVDIDRE  183



>ref|XP_006377552.1| hypothetical protein POPTR_0011s07540g [Populus trichocarpa]
 gb|ERP55349.1| hypothetical protein POPTR_0011s07540g [Populus trichocarpa]
Length=232

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 119/160 (74%), Gaps = 6/160 (4%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  212
            MG   +V+     ++ +L L +   G    +N S L    G++ VS  GCNLFRGRWVVD
Sbjct  1    MGFKCQVLVCTFCLVMLLFLQETRAG-IHSSNASRL---NGRKKVS--GCNLFRGRWVVD  54

Query  213  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  392
            +SYPLY  S CPFID EF+C KYGR D QYLKY+W+PDSC +PRF+G + L+RWRGKK+M
Sbjct  55   TSYPLYDSSGCPFIDDEFNCQKYGRRDNQYLKYSWQPDSCKIPRFNGADFLRRWRGKKIM  114

Query  393  FVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTF  512
            FVGDSLSLNMW SL+CMIHA+VP +K T+SR+++LS VTF
Sbjct  115  FVGDSLSLNMWESLSCMIHAAVPKAKTTFSRRDSLSSVTF  154



>emb|CDY17219.1| BnaA05g09690D [Brassica napus]
Length=382

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 109/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  177  GCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
            GCNLF+G+WV D SSYPLY  S CPFID +FDC+K+GRPDK++L Y+W+PDSC +PRFDG
Sbjct  60   GCNLFQGKWVFDASSYPLYDSSTCPFIDGQFDCLKFGRPDKKFLNYSWQPDSCTIPRFDG  119

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
               L +WRGK+VMFVGDSLS+NMW SL CMIHASVP     + R+  LS++TF+EYGVTL
Sbjct  120  AAFLNQWRGKRVMFVGDSLSVNMWESLGCMIHASVPGITTKFLRRTPLSFLTFQEYGVTL  179

Query  534  YLYHTTYLVDIVKE  575
            YLY T YLVDI KE
Sbjct  180  YLYRTPYLVDISKE  193



>ref|XP_009394133.1| PREDICTED: protein trichome birefringence-like 38 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 127/185 (69%), Gaps = 6/185 (3%)
 Frame = +3

Query  39   VGQKVMWSGVVIIAVL--LLVQGHGGRAAQNNVSHLLSWGG----KEIVSSGGCNLFRGR  200
            +G K  WS  +  A+L  L+   HG         H    G     +E  +   CN+F+G 
Sbjct  1    MGSKTQWSFGLRCALLSVLIASLHGMTTESFRHKHHRGNGTSARRRERANGISCNMFQGS  60

Query  201  WVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRG  380
            WV D SYPLY  S CPF++ EFDC +YGRPDK+YLKY WKPD+C+LPRF+G ++L R +G
Sbjct  61   WVYDDSYPLYDSSTCPFLEAEFDCQRYGRPDKEYLKYRWKPDACELPRFNGQDMLGRLKG  120

Query  381  KKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLV  560
            KK+MFVGDS+SLN W SL CM+ A+VP +K TY+R+  LS +TF++YGV++ LYHTTYLV
Sbjct  121  KKIMFVGDSISLNQWESLGCMLRAAVPNAKTTYTRKTPLSTITFEDYGVSVMLYHTTYLV  180

Query  561  DIVKE  575
            DIV E
Sbjct  181  DIVSE  185



>ref|XP_007149752.1| hypothetical protein PHAVU_005G096200g [Phaseolus vulgaris]
 gb|ESW21746.1| hypothetical protein PHAVU_005G096200g [Phaseolus vulgaris]
Length=367

 Score =   202 bits (514),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 129/176 (73%), Gaps = 5/176 (3%)
 Frame = +3

Query  51   VMWSGVVIIAVLLLVQGHGGRAAQN-NVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPL  227
            ++W  + ++ +    +        N NVS L S  G+++  +G CNLFRG+WV DSSYPL
Sbjct  9    LLWLCLFVVLIFFQTKAEEFDPYFNANVSSLSS--GRKL--AGRCNLFRGKWVYDSSYPL  64

Query  228  YQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDS  407
            Y PS CPFIDP+F+C KYGRPD QY KY W+P SC LPRF+  + L ++RGKK+MFVGDS
Sbjct  65   YDPSTCPFIDPQFNCQKYGRPDTQYQKYRWQPFSCPLPRFNAFDFLSKYRGKKIMFVGDS  124

Query  408  LSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            LSLN +NSLACMIH+ VP ++ T+++QE LS +TF++YG+ L+LY T YLVD+ +E
Sbjct  125  LSLNQFNSLACMIHSFVPNTRTTFTKQEALSKITFEDYGLELFLYRTAYLVDLDRE  180



>emb|CDX84658.1| BnaA03g15720D [Brassica napus]
Length=380

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            + GCNLF+GRW+ D+SY  Y  S CPFID EF+C  +GRPDKQ+L Y+W+PDSC +PRFD
Sbjct  59   TSGCNLFQGRWIFDASYHFYDSSMCPFIDSEFNC--FGRPDKQFLNYSWQPDSCSIPRFD  116

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L +WRGK+VMFVGDSLSLNMW SLACMIH+SVP SK T+ ++  LS +TF+EYGVT
Sbjct  117  GQAFLNKWRGKRVMFVGDSLSLNMWESLACMIHSSVPDSKTTFIKRTPLSSLTFQEYGVT  176

Query  531  LYLYHTTYLVDIVKE  575
            LYLY T YLVDI KE
Sbjct  177  LYLYRTPYLVDISKE  191



>ref|XP_009132974.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=381

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            + GCNLF+GRW+ D+SY  Y  S CPFID EF+C  +GRPDKQ+L Y+W+PDSC +PRFD
Sbjct  60   TSGCNLFQGRWIFDASYHFYDSSMCPFIDSEFNC--FGRPDKQFLNYSWQPDSCSIPRFD  117

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L +WRGK+VMFVGDSLSLNMW SLACMIH+SVP SK T+ ++  LS +TF+EYGVT
Sbjct  118  GQAFLNKWRGKRVMFVGDSLSLNMWESLACMIHSSVPDSKTTFIKRTPLSSLTFQEYGVT  177

Query  531  LYLYHTTYLVDIVKE  575
            LYLY T YLVDI KE
Sbjct  178  LYLYRTPYLVDISKE  192



>ref|XP_010091711.1| hypothetical protein L484_001474 [Morus notabilis]
 gb|EXB44995.1| hypothetical protein L484_001474 [Morus notabilis]
Length=166

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 112/139 (81%), Gaps = 6/139 (4%)
 Frame = +3

Query  123  NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQY  302
            +NVS L    G++ VS  GC+LF+G+WV D+SYPLY  S+CP IDPEFDC KYGRPDKQY
Sbjct  30   HNVSGLR---GRKQVS--GCDLFQGKWVFDASYPLYDSSSCPLIDPEFDCQKYGRPDKQY  84

Query  303  LKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYS  482
            LKYAWKPDSCDLPRF+G + L RWRGKK+MFVGDSLSLNMW SLACMIH SVP SK +  
Sbjct  85   LKYAWKPDSCDLPRFNGVDFLARWRGKKIMFVGDSLSLNMWQSLACMIHESVPNSKTSTV  144

Query  483  RQETLSYVTFKEYGVTLYL  539
            R+++LS VTF ++G   YL
Sbjct  145  RRDSLSSVTF-QFGKEAYL  162



>ref|XP_009143811.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=382

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  177  GCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
            GC LF+G+WV D SSYPLY  S CPFID +FDC+K+GRPDK++L Y+W+PDSC +PRFDG
Sbjct  60   GCKLFQGKWVFDASSYPLYDSSTCPFIDGQFDCLKFGRPDKKFLNYSWQPDSCTIPRFDG  119

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
               L +WRGK+VMFVGDSLS+NMW SL CMIHASVP     + R+  LS++TF+EYGVTL
Sbjct  120  AAFLNQWRGKRVMFVGDSLSVNMWESLGCMIHASVPGITTKFLRRTPLSFLTFQEYGVTL  179

Query  534  YLYHTTYLVDIVKE  575
            YLY T YLVDI KE
Sbjct  180  YLYRTPYLVDISKE  193



>ref|XP_004149371.1| PREDICTED: uncharacterized protein LOC101205461 [Cucumis sativus]
 ref|XP_004163488.1| PREDICTED: uncharacterized protein LOC101226154 [Cucumis sativus]
 gb|KGN47239.1| hypothetical protein Csa_6G227020 [Cucumis sativus]
Length=371

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            +++G CNL++G+WV DSSYPLY  S CPF+DP+F+C KYGRPDK YLKY W+P +C +PR
Sbjct  47   LAAGNCNLYQGKWVFDSSYPLYDSSTCPFVDPQFNCQKYGRPDKSYLKYRWQPFACGIPR  106

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYG  524
            F+G   L++WRGKK+MFVGDSLSLN W SLACMIHASVP S+ ++ R++ LS VTF+ YG
Sbjct  107  FNGLNFLEKWRGKKIMFVGDSLSLNQWESLACMIHASVPNSQSSFVRRDGLSSVTFQVYG  166

Query  525  VTLYLYHTTYLVDIVKE  575
            V L+LY T YLVD+V E
Sbjct  167  VELWLYRTPYLVDMVNE  183



>ref|XP_008783904.1| PREDICTED: protein trichome birefringence-like 38 [Phoenix dactylifera]
Length=373

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 119/169 (70%), Gaps = 4/169 (2%)
 Frame = +3

Query  81   VLLLVQGHG----GRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCP  248
             +L+   HG    G   +N   H  S  GKE  S   CNLF+G WV D+SYPLY  S CP
Sbjct  17   AILVASLHGAFPEGYHHENEQLHHNSTDGKEGTSDISCNLFQGSWVYDNSYPLYDSSRCP  76

Query  249  FIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWN  428
            FIDPEFDC  YGRPDK YLKY WKP+ C+LPRFD  + L RW+GK++MFVGDS+SLN W 
Sbjct  77   FIDPEFDCQNYGRPDKMYLKYRWKPNGCELPRFDAKDFLWRWKGKRIMFVGDSISLNQWV  136

Query  429  SLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SL CM+ A+VP ++ ++ R + LSYV F++YGV++  Y TTYLVD+V+E
Sbjct  137  SLNCMLLAAVPNARTSFIRSDPLSYVRFQDYGVSVMYYRTTYLVDVVRE  185



>ref|XP_002305083.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
 gb|EEE85594.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
Length=411

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 140/230 (61%), Gaps = 55/230 (24%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  212
            MG   +V++S      +LLL +   G+   N VS L    G++ VS  GC+LF+GRWVVD
Sbjct  1    MGFKCRVLFSIFCQCMLLLLQEAIAGQHYYN-VSRL---KGRKQVS--GCDLFQGRWVVD  54

Query  213  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  392
            SSYPLY  S CPFID EFDC  YGRPD QYLKY+W+PDSC++PRF G + L RWRGKK+M
Sbjct  55   SSYPLYDSSGCPFIDAEFDCQGYGRPDTQYLKYSWQPDSCNIPRFSGADFLARWRGKKIM  114

Query  393  FVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVT---------------------  509
            FVGDSLSLNMW SLACMIHA+VPT+K T+S++ ++++V+                     
Sbjct  115  FVGDSLSLNMWESLACMIHAAVPTAKTTFSKRNSVTFVSSVVAYLKNSKGSKFSDSVSFN  174

Query  510  -----FK-----------------------EYGVTLYLYHTTYLVDIVKE  575
                 FK                       +YG+TLY+Y T YLVDIV+E
Sbjct  175  NFVRPFKLHVNACLAASSSSEEPWMATVTLDYGLTLYMYRTPYLVDIVRE  224



>ref|XP_002458239.1| hypothetical protein SORBIDRAFT_03g029700 [Sorghum bicolor]
 gb|EES03359.1| hypothetical protein SORBIDRAFT_03g029700 [Sorghum bicolor]
Length=398

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CNLF+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SCDLPRFDG E
Sbjct  80   CNLFQGSWVYDDTLPMYDTAGCPFVEPEFDCQKYGRPDKLYLKYRWRPTSCDLPRFDGQE  139

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYL  539
             L+RW+GKK++FVGDS+SLN W SLACM+HA+ P SK+ Y+R   +S VTF++YGV++  
Sbjct  140  FLRRWKGKKILFVGDSISLNQWESLACMLHAAAPASKVAYARGNPVSSVTFQDYGVSVAY  199

Query  540  YHTTYLVDIVKE  575
            Y +TYLVDIV+E
Sbjct  200  YRSTYLVDIVEE  211



>ref|XP_010915618.1| PREDICTED: protein trichome birefringence-like 39 [Elaeis guineensis]
Length=373

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +3

Query  108  GRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGR  287
            G   +N   H  S  GKE  S   CN F+G WV D+SYPLY    CPFIDPEFDC KYGR
Sbjct  30   GYHHENEQLHHNSTDGKEGTSDIRCNWFQGSWVYDNSYPLYDSWRCPFIDPEFDCQKYGR  89

Query  288  PDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS  467
            PDK YLKY WKP+ C+LPRFDG + L RWRGKK+MFVGDS+SLN W SL CM+ A+VP +
Sbjct  90   PDKVYLKYRWKPNGCELPRFDGKDFLWRWRGKKIMFVGDSISLNQWVSLNCMLLAAVPDT  149

Query  468  KITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            + ++ R + LSYV F++YGV++  Y TTYLVDIV+E
Sbjct  150  RSSFIRSDPLSYVRFEDYGVSVMYYRTTYLVDIVRE  185



>ref|XP_007132901.1| hypothetical protein PHAVU_011G1346001g, partial [Phaseolus vulgaris]
 gb|ESW04895.1| hypothetical protein PHAVU_011G1346001g, partial [Phaseolus vulgaris]
Length=216

 Score =   193 bits (490),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 123/172 (72%), Gaps = 9/172 (5%)
 Frame = +3

Query  60   SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  239
            S V  + + L +  H  +A ++  + +L+           CNLFRG+WV D+SYPLY PS
Sbjct  4    SLVHALFLTLFLLCHQTKAEESGATRMLA---------AECNLFRGKWVYDASYPLYDPS  54

Query  240  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  419
            +CPFIDP+F+C K+GR DK Y  Y W P SC LPRF+G E L+R+RGKK+MFVGDSLSLN
Sbjct  55   SCPFIDPQFNCQKHGRSDKLYQNYRWTPFSCPLPRFNGLEFLERYRGKKIMFVGDSLSLN  114

Query  420  MWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             +NSLACM+HA VP S+ T+S+++ LS V F++YG+ +YLY T YLVD+ +E
Sbjct  115  QFNSLACMVHAWVPKSRSTFSQRDALSKVAFEDYGLEIYLYRTAYLVDLDRE  166



>ref|XP_003608110.1| hypothetical protein MTR_4g087730 [Medicago truncatula]
 gb|AES90307.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=364

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 122/168 (73%), Gaps = 4/168 (2%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  251
              ++ LLV  H   A +   SH +S   K       CNLF G WV+ SSY LY  S+CPF
Sbjct  13   FFSLALLVSMHLVGATK---SHKVS-PSKRRKELNNCNLFSGSWVIGSSYTLYDSSSCPF  68

Query  252  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  431
            ++ +FDC K+GR D QYLKY+WKPDSC LPRF+G + L RW+GKK+MFVGDSLSLNMW S
Sbjct  69   LEAQFDCQKFGRLDNQYLKYSWKPDSCALPRFNGEDFLNRWKGKKIMFVGDSLSLNMWES  128

Query  432  LACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            L+CMIHASVP +  ++SR+E++S V F++YGVT+ LY T YLVDI+++
Sbjct  129  LSCMIHASVPNATTSFSRKESVSTVIFQDYGVTIQLYRTPYLVDIIQQ  176



>ref|XP_010099368.1| hypothetical protein L484_004794 [Morus notabilis]
 gb|EXB78093.1| hypothetical protein L484_004794 [Morus notabilis]
Length=370

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CN FRG W  D+SYPLY  S CPF+DPEF+C KYGRPDK YLKY W+P SC LPRF+
Sbjct  48   AGKCNWFRGTWKYDASYPLYDSSTCPFVDPEFNCQKYGRPDKSYLKYRWQPLSCSLPRFN  107

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   LK+WRGKK+MFVGDSLSLN W SL CMIHA VP SK T  R E+LS VTF++YGV 
Sbjct  108  GLYFLKKWRGKKIMFVGDSLSLNQWQSLTCMIHAWVPKSKTTVMRTESLSSVTFEDYGVK  167

Query  531  LYLYHTTYLVDIVKE  575
            + LY T YLVD+V E
Sbjct  168  ILLYRTPYLVDLVHE  182



>ref|XP_003540392.1| PREDICTED: protein YLS7 isoform 1 [Glycine max]
 gb|KHN27931.1| hypothetical protein glysoja_007663 [Glycine soja]
Length=375

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  126  NVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYL  305
            N  ++ S+     + +G CNLFRG+WV D SYPLY PS CPFIDP+F+C KYGRPDKQY 
Sbjct  39   NGKNVSSFSSGRKLGAGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYGRPDKQYQ  98

Query  306  KYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSR  485
            KY W+P SC LPRF+  + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++ +
Sbjct  99   KYRWQPFSCPLPRFNAFDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPNTRTSFIK  158

Query  486  QETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            Q+ LS +TF++YG+ L+LY T YLVD+ +E
Sbjct  159  QDALSKITFEDYGLQLFLYRTAYLVDLDRE  188



>ref|XP_009143809.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=381

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            + GCNLF+G+WV D+S P+Y  S CPFI+ E DC+K+GRPD ++L Y+W+PDSC +PRFD
Sbjct  58   TSGCNLFQGKWVFDASSPVYDSSTCPFINGEVDCLKFGRPDTKFLNYSWQPDSCTIPRFD  117

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L +WRGK+VMFVGDSLS NMW SL CMIHASVP    T+ R+  LS +TF+EYGVT
Sbjct  118  GEAFLNQWRGKRVMFVGDSLSENMWESLGCMIHASVPGITTTFLRRTPLSSLTFQEYGVT  177

Query  531  LYLYHTTYLVDIVKE  575
            LY+Y T YLVDI KE
Sbjct  178  LYIYRTPYLVDISKE  192



>ref|XP_004487169.1| PREDICTED: uncharacterized protein LOC101503983 [Cicer arietinum]
Length=363

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = +3

Query  66   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  245
             +   + L+   H  +A +   +   S   +++  +G CN FRG+WV D SYPLY PS+C
Sbjct  7    TLFFTLFLVFSSHQTKAEEFKFNKTTSSNERKV--AGRCNWFRGKWVYDPSYPLYDPSSC  64

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFIDP+F+C KYGRPD QY KY W+P SC LPRF   + L ++RGKK+MFVGDSLSLN +
Sbjct  65   PFIDPQFNCQKYGRPDTQYQKYRWQPLSCSLPRFSALDFLAKYRGKKIMFVGDSLSLNQF  124

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            NSLACMIH+ VP ++ ++S+Q  +S +TF++YG+ L+LY T YLVD+ +E
Sbjct  125  NSLACMIHSWVPKTRTSFSKQNAISTITFQDYGLQLFLYRTPYLVDLDRE  174



>ref|XP_003543309.1| PREDICTED: protein YLS7 [Glycine max]
Length=369

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLFRG+WV D SYPLY PS CPFIDP+F+C KYGRPDKQY KY W+P SC LPRF+
Sbjct  48   AGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYGRPDKQYQKYRWQPFSCPLPRFN  107

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++ +Q+ LS +TF++YG+ 
Sbjct  108  AFDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPNTRTSFIKQDALSKITFEDYGLQ  167

Query  531  LYLYHTTYLVDIVKE  575
            L+LY T YLVD+ +E
Sbjct  168  LFLYRTAYLVDLDRE  182



>gb|KHN36688.1| hypothetical protein glysoja_001419 [Glycine soja]
Length=369

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLFRG+WV D SYPLY PS CPFIDP+F+C KYGRPDKQY KY W+P SC LPRF+
Sbjct  48   AGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYGRPDKQYQKYRWQPFSCPLPRFN  107

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++ +Q+ LS +TF++YG+ 
Sbjct  108  AFDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPNTRTSFIKQDALSKITFEDYGLQ  167

Query  531  LYLYHTTYLVDIVKE  575
            L+LY T YLVD+ +E
Sbjct  168  LFLYRTAYLVDLDRE  182



>gb|ACJ84951.1| unknown [Medicago truncatula]
Length=225

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLFRG+WV D+SYPLY PS CPFIDP+F+C K+GR DK Y KY W P SC++PRF+
Sbjct  44   AGTCNLFRGKWVYDASYPLYDPSTCPFIDPQFNCQKHGRKDKLYQKYRWMPFSCNMPRFN  103

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   LK  +GKK+MFVGDSLSLN +NSLACMIHA+VP S+ T+ +++ +S VTF+EYG+ 
Sbjct  104  GLNFLKGNKGKKIMFVGDSLSLNQFNSLACMIHAAVPNSRSTFRQRDAISSVTFEEYGLE  163

Query  531  LYLYHTTYLVDI  566
            L+LY T YLVD+
Sbjct  164  LFLYRTAYLVDL  175



>gb|ABA29158.1| unknown [Pisum sativum]
Length=371

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLFRG+WV D+SYPLY PS+CPFIDP+F+C KYGRPD QY KY W+P +C LPRF+
Sbjct  50   AGTCNLFRGKWVYDASYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPLTCSLPRFN  109

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++S+Q  +S +TF++YG+ 
Sbjct  110  ALDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPKTRTSFSKQSAISTITFQDYGLQ  169

Query  531  LYLYHTTYLVDIVKE  575
            L+LY T YLVD+ +E
Sbjct  170  LFLYRTPYLVDLDRE  184



>emb|CDM83556.1| unnamed protein product [Triticum aestivum]
Length=388

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CN+F+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRFDG +
Sbjct  70   CNMFQGSWVYDDALPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFDGRD  129

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYL  539
            LL RW+GKKV+FVGDS+SLN W SL CM+HA+ P+S+ +YSR   +S VTF++YG+++  
Sbjct  130  LLSRWKGKKVLFVGDSISLNQWESLVCMLHAAAPSSRTSYSRGNPVSTVTFQDYGLSVAY  189

Query  540  YHTTYLVDIVKE  575
            Y +TYLVDIV+E
Sbjct  190  YRSTYLVDIVEE  201



>ref|XP_003607566.1| hypothetical protein MTR_4g079700 [Medicago truncatula]
Length=270

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLFRG+WV D+SYPLY PS CPFIDP+F+C K+GR DK Y KY W P SC++PRF+
Sbjct  44   AGTCNLFRGKWVYDASYPLYDPSTCPFIDPQFNCQKHGRKDKLYQKYRWMPFSCNMPRFN  103

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   LK  +GKK+MFVGDSLSLN +NSLACMIHA+VP S+ T+ +++ +S VTF+EYG+ 
Sbjct  104  GLNFLKGNKGKKIMFVGDSLSLNQFNSLACMIHAAVPNSRSTFRQRDAISSVTFEEYGLE  163

Query  531  LYLYHTTYLVDI  566
            L+LY T YLVD+
Sbjct  164  LFLYRTAYLVDL  175



>ref|XP_010686317.1| PREDICTED: protein trichome birefringence-like 37 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score =   192 bits (488),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 109/136 (80%), Gaps = 1/136 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  347
            +G CNLF+G+WV D S  PLY  + CPFI+PEFDC+KYGRPDK +L+Y+W PD+C +PRF
Sbjct  45   TGTCNLFQGKWVFDISGTPLYDFTTCPFINPEFDCLKYGRPDKLFLQYSWVPDTCSIPRF  104

Query  348  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGV  527
            DG E L R+RGK +MFVGDSLSLN WNSL CM+HAS P ++ +  ++  + YV F++YGV
Sbjct  105  DGMEFLMRFRGKTIMFVGDSLSLNQWNSLTCMVHASAPQARYSTGKRGAVYYVNFEDYGV  164

Query  528  TLYLYHTTYLVDIVKE  575
            ++ LYHTTYLVDI+KE
Sbjct  165  SVQLYHTTYLVDIIKE  180



>ref|XP_004969334.1| PREDICTED: uncharacterized protein LOC101766252 [Setaria italica]
Length=392

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
              CNLF+G WV D S P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRF+G
Sbjct  72   AACNLFQGSWVYDDSLPMYDTAGCPFVEPEFDCQKYGRPDKMYLKYRWRPASCELPRFNG  131

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
             + L RW+GKK++FVGDSLSLN W SLACM+HA+ P SK+ YSR   +S +TF++YG+++
Sbjct  132  QDFLSRWKGKKILFVGDSLSLNQWESLACMLHAAAPASKVAYSRGNPVSTITFQDYGLSV  191

Query  534  YLYHTTYLVDIVKE  575
                +TYLVDIV+E
Sbjct  192  AYCRSTYLVDIVEE  205



>dbj|BAJ89025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=384

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CN+F+G W  D + P+Y  ++CPF++PEFDC KYGRPDK YLKY W+P SC+LPRFDG +
Sbjct  66   CNMFQGSWTYDDALPVYDAASCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFDGRD  125

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYL  539
            LL RW+GKK++FVGDS+SLN W SL CM+HA+ P S+ +YSR   +S VTF++YGV++  
Sbjct  126  LLSRWKGKKILFVGDSISLNQWESLVCMLHAAAPASRTSYSRGNPVSTVTFQDYGVSVAY  185

Query  540  YHTTYLVDIVKE  575
            Y +TYLVDIV+E
Sbjct  186  YRSTYLVDIVEE  197



>gb|ABA29157.1| unknown [Pisum sativum]
Length=371

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLFRG+WV D+SYPLY PS+CPFIDP+F+C KYGRPD QY KY W+P +C LPRF+
Sbjct  50   AGTCNLFRGKWVYDASYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPLTCSLPRFN  109

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++S+Q  +S +TF++Y + 
Sbjct  110  ALDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPKTRTSFSKQSAISTITFQDYDLQ  169

Query  531  LYLYHTTYLVDIVKE  575
            L+LY T YLVD+ +E
Sbjct  170  LFLYRTPYLVDLDRE  184



>ref|XP_009591836.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
tomentosiformis]
Length=360

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            S GCN+F+G+WV DSSYPLY  S+CPFID EF+C KY RPDK YLKY W+P SC+LPRF+
Sbjct  38   SSGCNIFKGKWVFDSSYPLYDFSSCPFIDNEFNCQKYNRPDKSYLKYRWQPFSCNLPRFN  97

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L+++RGK +MFVGDSLSLNMW SLACMIH+SVP +K    R+  +S + F +YGV 
Sbjct  98   GLVFLEKYRGKNIMFVGDSLSLNMWESLACMIHSSVPNAKTAVIRKNGISEIAFLDYGVR  157

Query  531  LYLYHTTYLVDIVKE  575
            L +Y T YLVD+VKE
Sbjct  158  LLMYRTPYLVDMVKE  172



>ref|NP_001043736.1| Os01g0652100 [Oryza sativa Japonica Group]
 dbj|BAB86568.1| lustrin A-like [Oryza sativa Japonica Group]
 dbj|BAF05650.1| Os01g0652100 [Oryza sativa Japonica Group]
 gb|EAY75199.1| hypothetical protein OsI_03091 [Oryza sativa Indica Group]
 dbj|BAG91361.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93258.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CN+F+G WV D S P+Y  + CPF++ EFDC KYGRPDK YLKY W+P SC+LPRF+G +
Sbjct  74   CNMFQGSWVYDDSLPMYDTAGCPFVEAEFDCQKYGRPDKLYLKYRWRPSSCELPRFNGLD  133

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYL  539
             L +WRGKK++FVGDS+SLN W SLACM+HA+ P+S+ TYSR    S VTF++YGV++  
Sbjct  134  FLSKWRGKKILFVGDSISLNQWESLACMLHAAAPSSRTTYSRGTPFSTVTFQDYGVSVAY  193

Query  540  YHTTYLVDIVKE  575
            Y +TYLVDIV E
Sbjct  194  YRSTYLVDIVDE  205



>ref|XP_006646157.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=423

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CN+F+G WV D S P+Y  + CPF++ EFDC KYGRPDK YLKY W+P SC+LPRF+G +
Sbjct  105  CNMFQGSWVYDDSLPMYDTAGCPFVEAEFDCQKYGRPDKLYLKYRWRPTSCELPRFNGLD  164

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYL  539
             L +WRGKK++FVGDS+SLN W SLACM+HA+ P+S+ TYSR   LS VTF++YGV++  
Sbjct  165  FLSKWRGKKILFVGDSISLNQWESLACMLHAAAPSSRTTYSRGTPLSTVTFQDYGVSVAY  224

Query  540  YHTTYLVDIVKE  575
            Y +TYLVDIV E
Sbjct  225  YRSTYLVDIVDE  236



>gb|KDO63327.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
 gb|KDO63328.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
Length=231

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            ++ +  G CN+F+G+WV D+SYPLY  S+CPF+DPEFDC KYGRPD  YLKY W+P SC 
Sbjct  55   RKSLGGGKCNIFQGKWVYDASYPLY--SHCPFVDPEFDCQKYGRPDDIYLKYRWQPFSCS  112

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            +PRF+G   L+++RGKK+MFVGDSLSLN W SLACMIH+  P +K +  R   LS +TF+
Sbjct  113  IPRFNGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWAPKTKYSVVRTAVLSSITFQ  172

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            E+G+ + LY TTYLVD+V+E
Sbjct  173  EFGLQILLYRTTYLVDLVRE  192



>ref|XP_003569466.1| PREDICTED: protein trichome birefringence-like 38 [Brachypodium 
distachyon]
Length=385

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
              CN+F+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRF+G
Sbjct  65   AACNMFQGSWVYDDTLPMYDTARCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFNG  124

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
             +LL +WRGKK++FVGDS+SLN W SL CM+HA+ P S  T+SR   +S VTF++YGV++
Sbjct  125  QDLLSKWRGKKILFVGDSISLNQWQSLVCMLHAAAPASGTTHSRGNPVSTVTFQDYGVSV  184

Query  534  YLYHTTYLVDIVKE  575
              Y +TYLVDIV+E
Sbjct  185  AYYRSTYLVDIVEE  198



>ref|XP_010506087.1| PREDICTED: protein trichome birefringence-like 39 isoform X1 
[Camelina sativa]
Length=368

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            +  ++SG CN FRG WV D  YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P SC 
Sbjct  40   RRELASGRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKYRWQPSSCS  99

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+IHA VP ++ T  RQ+ L+ +TF+
Sbjct  100  LPRFNGLYFLRRMRGKKIMFVGDSLSTNMWQSLACLIHAWVPNTRYTLLRQKGLASLTFE  159

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            EYGVTL LY T +LVD+  E
Sbjct  160  EYGVTLMLYRTQFLVDLNVE  179



>ref|XP_010517784.1| PREDICTED: protein trichome birefringence-like 39 isoform X1 
[Camelina sativa]
 ref|XP_010517785.1| PREDICTED: protein trichome birefringence-like 39 isoform X2 
[Camelina sativa]
Length=369

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 4/146 (3%)
 Frame = +3

Query  150  GGKEIV----SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAW  317
             G+E+V    +SG CN FRG WV D  YPLY P  CPFIDP+F+C KYGRPD  YLKY W
Sbjct  35   NGEEVVRRELASGRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKYRW  94

Query  318  KPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETL  497
            +P SC LPRF+G   L+R RGKK+MFVGDSLS NMW SL+C+IHA VP ++ T  RQ+ L
Sbjct  95   QPSSCSLPRFNGLYFLRRMRGKKIMFVGDSLSTNMWQSLSCLIHAWVPNTRYTLLRQKGL  154

Query  498  SYVTFKEYGVTLYLYHTTYLVDIVKE  575
            + +TF+EYGVTL LY T +LVD+  E
Sbjct  155  ASLTFEEYGVTLMLYRTQFLVDLNVE  180



>ref|XP_010912702.1| PREDICTED: protein trichome birefringence-like 38 [Elaeis guineensis]
Length=375

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +3

Query  150  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  329
            G +++     C+ F+G WV D +YP+Y   +CPF++PEFDC KYGRPDK YLKY W+P++
Sbjct  46   GRRDLTKRISCDFFQGSWVYDDTYPIYDSLSCPFVEPEFDCQKYGRPDKLYLKYRWRPNA  105

Query  330  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVT  509
            CDLPRF+G + L+RWRGKK+MFVGDS+S N W SLACM+HASVP ++ T++R +T   +T
Sbjct  106  CDLPRFNGLDFLERWRGKKIMFVGDSISQNQWESLACMLHASVPYARTTFTRSKTPWTLT  165

Query  510  FKEYGVTLYLYHTTYLVDIV  569
            F++YGV++  Y +TYLVDI+
Sbjct  166  FEDYGVSVMFYRSTYLVDII  185



>gb|AAF88130.1|AC021043_23 Unknown protein [Arabidopsis thaliana]
Length=368

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 107/141 (76%), Gaps = 12/141 (9%)
 Frame = +3

Query  153  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  332
            GK+   + GCNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPDKQ+LK        
Sbjct  52   GKKQRRASGCNLFQGRWVFDASYPFYDSSKCPFIDGEFDCLKFGRPDKQFLK--------  103

Query  333  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTF  512
                FDGG  L+++RGK+VMFVGDSLSLNMW SLACMIHASVP +K T+ ++  LS +TF
Sbjct  104  ----FDGGAFLRKYRGKRVMFVGDSLSLNMWESLACMIHASVPNAKTTFLKRTPLSTLTF  159

Query  513  KEYGVTLYLYHTTYLVDIVKE  575
            +EYGVTLYLY T Y+VDI KE
Sbjct  160  QEYGVTLYLYRTPYIVDISKE  180



>tpg|DAA58322.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=384

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = +3

Query  150  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  329
            GG        CNLF+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P S
Sbjct  54   GGAPGTGMASCNLFQGSWVYDDTLPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPAS  113

Query  330  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP-TSKITYSRQETLSYV  506
            C+LPRF+G +LL+RW+GKK++FVGDS+SLN W SLACM+ A+ P +S++ Y+R   +S V
Sbjct  114  CELPRFNGQDLLRRWKGKKILFVGDSISLNQWESLACMLRAAAPASSRVAYARGNPVSSV  173

Query  507  TFKEYGVTLYLYHTTYLVDIVKE  575
            TF++YGV++  Y +TYLVDIV+E
Sbjct  174  TFQDYGVSVAYYRSTYLVDIVEE  196



>gb|KEH39261.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=368

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CN FRG+WV D SYPLY PS+CPFIDP+F+C KYGRPD QY KY W+P +C +PRF+
Sbjct  47   AGRCNWFRGKWVYDPSYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPFTCSIPRFN  106

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ T+S+Q  +S +TF++YG+ 
Sbjct  107  ALDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPKTRYTFSKQSAISTITFQDYGLQ  166

Query  531  LYLYHTTYLVDIVKE  575
            L+L+ T YLVD+ +E
Sbjct  167  LFLFRTPYLVDLDRE  181



>ref|XP_003607565.1| hypothetical protein MTR_4g079700 [Medicago truncatula]
 gb|AES89762.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=365

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLFRG+WV D+SYPLY PS CPFIDP+F+C K+GR DK Y KY W P SC++PRF+
Sbjct  44   AGTCNLFRGKWVYDASYPLYDPSTCPFIDPQFNCQKHGRKDKLYQKYRWMPFSCNMPRFN  103

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   LK  +GKK+MFVGDSLSLN +NSLACMIHA+VP S+ T+ +++ +S VTF+EYG+ 
Sbjct  104  GLNFLKGNKGKKIMFVGDSLSLNQFNSLACMIHAAVPNSRSTFRQRDAISSVTFEEYGLE  163

Query  531  LYLYHTTYLVDI  566
            L+LY T YLVD+
Sbjct  164  LFLYRTAYLVDL  175



>gb|KFK31236.1| hypothetical protein AALP_AA6G086200 [Arabis alpina]
Length=361

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 119/181 (66%), Gaps = 8/181 (4%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  212
            MG+  +   + + +I    L Q       QNN + L             CN FRG+WV D
Sbjct  1    MGLCFQFNLASLFLILFSSLAQSQQHFLGQNNTTLL--------EEERSCNWFRGKWVYD  52

Query  213  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  392
            SSYPLY P +CPFID EF+C K GRPD  Y  + W+P SC LPRFDGG  +++ RGKK+M
Sbjct  53   SSYPLYSPYSCPFIDSEFNCQKAGRPDSNYQHFRWQPFSCSLPRFDGGNFMRKMRGKKIM  112

Query  393  FVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVK  572
             VGDSLSLNM+ SLAC+IHAS+P +K +  R + L+ +TF+EYGVT++LY T +LVD+V+
Sbjct  113  LVGDSLSLNMFESLACLIHASLPNAKYSLRRSQPLTSLTFQEYGVTIFLYRTQFLVDVVQ  172

Query  573  E  575
            E
Sbjct  173  E  173



>ref|XP_011002532.1| PREDICTED: protein trichome birefringence-like 39 [Populus euphratica]
Length=371

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CN FRG+WV D  YPLY  SNCPFIDP+F+C KYGRPD  YLKY W+P +CDLPRF+
Sbjct  50   AGKCNWFRGKWVFDPKYPLYD-SNCPFIDPQFNCQKYGRPDSYYLKYRWQPFACDLPRFN  108

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L++WRGKK+MFVGDSLSLN W SL C+IHA VP SK T  R + LS +TF++YGV 
Sbjct  109  GLYFLEKWRGKKIMFVGDSLSLNQWISLTCLIHAWVPNSKYTVFRTDVLSSLTFEDYGVK  168

Query  531  LYLYHTTYLVDIVKE  575
            + LY TTYLVD+V +
Sbjct  169  ILLYRTTYLVDLVND  183



>gb|KDO63326.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
Length=284

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            ++ +  G CN+F+G+WV D+SYPLY  S+CPF+DPEFDC KYGRPD  YLKY W+P SC 
Sbjct  55   RKSLGGGKCNIFQGKWVYDASYPLY--SHCPFVDPEFDCQKYGRPDDIYLKYRWQPFSCS  112

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            +PRF+G   L+++RGKK+MFVGDSLSLN W SLACMIH+  P +K +  R   LS +TF+
Sbjct  113  IPRFNGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWAPKTKYSVVRTAVLSSITFQ  172

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            E+G+ + LY TTYLVD+V+E
Sbjct  173  EFGLQILLYRTTYLVDLVRE  192



>ref|XP_002881861.1| hypothetical protein ARALYDRAFT_483351 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58120.1| hypothetical protein ARALYDRAFT_483351 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  332
             +  ++SG CN FRG WV D+ YPLY P  CPFIDP+F+C KYGRPD  YLK+ W+P SC
Sbjct  37   ARRELASGRCNWFRGNWVYDAKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKFRWQPSSC  96

Query  333  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTF  512
             LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+IH+ VP ++ T  RQ+ L+ +TF
Sbjct  97   SLPRFNGLYFLRRMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNTRYTLLRQKGLASLTF  156

Query  513  KEYGVTLYLYHTTYLVDIVKE  575
            +EYGVTL LY T +LVD+  E
Sbjct  157  EEYGVTLLLYRTQFLVDLNVE  177



>ref|XP_010557124.1| PREDICTED: protein trichome birefringence-like 40 [Tarenaya hassleriana]
Length=394

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
            G CN  RG+WV DSSYPLY P  CPFIDPEFDC K GRPD  YLKY W+P SCDLPRF+G
Sbjct  73   GRCNWSRGKWVYDSSYPLYSPYKCPFIDPEFDCQKSGRPDSLYLKYRWQPFSCDLPRFNG  132

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
               L+R RGK++MFVGDSLSLNM+ SLACMIHA VP +K +  R + L+ +TF EYGV +
Sbjct  133  MIFLRRMRGKRIMFVGDSLSLNMFESLACMIHAWVPNAKYSLRRSQPLTSLTFLEYGVEM  192

Query  534  YLYHTTYLVDIVKE  575
            YLY T +LVD+V+E
Sbjct  193  YLYRTQFLVDVVQE  206



>ref|XP_003608141.1| Alpha galactosidase [Medicago truncatula]
Length=176

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 16/148 (11%)
 Frame = +3

Query  72   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  251
            + ++ LLV  H   A ++N                 CNLF G WV+DSSYPLY  S+CPF
Sbjct  13   LFSIALLVSMHPATAQKSN----------------NCNLFFGSWVIDSSYPLYDSSSCPF  56

Query  252  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  431
            ++ +FDC ++GRPD QYLKY+WKPDSCDLPRF+G + L RW+ KK+MFVGDSLSLNMW S
Sbjct  57   VEAQFDCQQFGRPDNQYLKYSWKPDSCDLPRFNGEDFLNRWKDKKIMFVGDSLSLNMWES  116

Query  432  LACMIHASVPTSKITYSRQETLSYVTFK  515
            L+CMIHASVP    ++SR+E +S V F+
Sbjct  117  LSCMIHASVPNVTTSFSRKEPMSTVFFR  144



>ref|NP_565975.1| protein trichome birefringence-like 39 [Arabidopsis thaliana]
 sp|Q9SIN2.1|TBL39_ARATH RecName: Full=Protein trichome birefringence-like 39 [Arabidopsis 
thaliana]
 gb|AAD22996.1| expressed protein [Arabidopsis thaliana]
 gb|AAK59473.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34148.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10140.1| protein trichome birefringence-like 39 [Arabidopsis thaliana]
Length=367

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            +  ++SG CN FRG WV D  YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P SC 
Sbjct  39   RRELASGRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKYRWQPSSCS  98

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+IH+ VP ++ T  RQ+ L+ +TF+
Sbjct  99   LPRFNGLYFLRRMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNTRYTLIRQKGLASLTFE  158

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            EYGVTL LY T +LVD+  E
Sbjct  159  EYGVTLLLYRTQFLVDLNVE  178



>ref|XP_010414182.1| PREDICTED: protein trichome birefringence-like 40 [Camelina sativa]
Length=366

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 112/164 (68%), Gaps = 7/164 (4%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            +LL Q       QNN S         ++S G CNL RG+WV DSSYPLY    CPFID E
Sbjct  22   VLLAQSQQQFLGQNNTS-------SSLLSGGRCNLSRGKWVYDSSYPLYSAYTCPFIDSE  74

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLACM
Sbjct  75   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACM  134

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +HAS+P +K +  R + L+ +TF+EYGVT+ LY T +LVD+V+E
Sbjct  135  LHASLPNAKYSLRRNQPLTSLTFQEYGVTILLYRTQFLVDVVQE  178



>ref|XP_009784314.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
sylvestris]
Length=360

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            S GCN+F+G+WV DSSYPLY  S+CPFID EF+C KY RPDK YLKY W+P SC+LPRF+
Sbjct  38   SSGCNIFKGKWVFDSSYPLYDFSSCPFIDSEFNCQKYNRPDKSYLKYRWQPFSCNLPRFN  97

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L+++RGK +MFVGDSLSLNMW SLACMIH+SVP  K    ++  +S + F +YGV 
Sbjct  98   GLVFLEKYRGKNIMFVGDSLSLNMWESLACMIHSSVPNVKTAVIKKNGISEIAFLDYGVR  157

Query  531  LYLYHTTYLVDIVKE  575
            L +Y T YLVD+VKE
Sbjct  158  LLMYRTPYLVDMVKE  172



>emb|CDY55393.1| BnaA05g34290D [Brassica napus]
Length=367

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 114/164 (70%), Gaps = 5/164 (3%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            L  V  +   ++ N V      GG+  ++S  CN FRG WV D +YPLY P  CPFIDP+
Sbjct  21   LSTVSAYTNTSSNNGVE-----GGRRELASWRCNWFRGSWVYDVTYPLYDPYKCPFIDPQ  75

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C KYGRPD  YLKY W+P SC LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+
Sbjct  76   FNCKKYGRPDNLYLKYRWQPSSCSLPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACL  135

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            IHA VP ++ T  RQ+ L+ +TF++YGVTL LY T +LVD+  E
Sbjct  136  IHAWVPNARYTLLRQKGLASLTFEDYGVTLKLYRTQFLVDLDAE  179



>ref|XP_009142851.1| PREDICTED: protein trichome birefringence-like 39 [Brassica rapa]
Length=367

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 114/164 (70%), Gaps = 5/164 (3%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            L  V  +   ++ N V      GG+  ++S  CN FRG WV D +YPLY P  CPFIDP+
Sbjct  21   LSTVSANTNTSSNNGVE-----GGRRELASWRCNWFRGSWVYDVTYPLYDPYKCPFIDPQ  75

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C KYGRPD  YLKY W+P SC LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+
Sbjct  76   FNCKKYGRPDNLYLKYRWQPSSCSLPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACL  135

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            IHA VP ++ T  RQ+ L+ +TF++YGVTL LY T +LVD+  E
Sbjct  136  IHAWVPNARYTLLRQKGLASLTFEDYGVTLKLYRTQFLVDLDAE  179



>ref|XP_010052537.1| PREDICTED: protein trichome birefringence-like 39 [Eucalyptus 
grandis]
 gb|KCW89616.1| hypothetical protein EUGRSUZ_A01900 [Eucalyptus grandis]
 gb|KCW89617.1| hypothetical protein EUGRSUZ_A01900 [Eucalyptus grandis]
Length=365

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CN F G+WV D+SYPLY  S+CPFIDP+F+CIKYGR D+QYLKY W+P SC+LPRF 
Sbjct  42   AGRCNFFHGKWVYDASYPLYDSSSCPFIDPQFNCIKYGRRDRQYLKYRWQPFSCNLPRFS  101

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
                L +WRGKK+MFVGDSLSLN+W SL+CMIHA +P ++    ++E L+ +TF +Y V 
Sbjct  102  AWNFLNKWRGKKIMFVGDSLSLNIWQSLSCMIHAQMPNARTVLFKREGLASLTFVDYDVK  161

Query  531  LYLYHTTYLVDIVKE  575
            + LY T YLVD+V+E
Sbjct  162  IMLYRTQYLVDVVRE  176



>ref|XP_009132768.1| PREDICTED: protein trichome birefringence-like 40 [Brassica rapa]
 emb|CDX84800.1| BnaA03g14300D [Brassica napus]
Length=365

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 8/163 (5%)
 Frame = +3

Query  87   LLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEF  266
            LL Q       QNN S L    G+E      CN FRG+WV DSSYPLY P +CPFI+PEF
Sbjct  23   LLAQSQQHFLGQNNTSLL----GEE----RSCNWFRGKWVYDSSYPLYSPFSCPFINPEF  74

Query  267  DCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMI  446
            +C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+I
Sbjct  75   NCQKTGRPDTNYQHFRWQPFSCSLPRFDGVNFMRRMRGKKIMMVGDSLSLNMFESLACLI  134

Query  447  HASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            HAS+P +K + SR + L+ +TF++YGVT+ LY T +LVD+V+E
Sbjct  135  HASLPNAKYSLSRSQPLTSLTFQDYGVTILLYRTQFLVDVVQE  177



>ref|XP_006411518.1| hypothetical protein EUTSA_v10016832mg [Eutrema salsugineum]
 gb|ESQ52971.1| hypothetical protein EUTSA_v10016832mg [Eutrema salsugineum]
Length=366

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +3

Query  150  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  329
             G+  ++S  CN FRG WV D+ YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P S
Sbjct  37   AGRRELASRRCNWFRGNWVYDAKYPLYNPYKCPFIDPQFNCKKYGRPDNVYLKYRWQPSS  96

Query  330  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVT  509
            C LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IH+ VP ++ T  RQ+ L+ +T
Sbjct  97   CSLPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNTRYTLLRQKGLASLT  156

Query  510  FKEYGVTLYLYHTTYLVDIVKE  575
            F+EYGVTL LY T +LVD+  E
Sbjct  157  FEEYGVTLMLYRTQFLVDLDSE  178



>ref|XP_006294476.1| hypothetical protein CARUB_v10023492mg [Capsella rubella]
 gb|EOA27374.1| hypothetical protein CARUB_v10023492mg [Capsella rubella]
Length=364

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 120/183 (66%), Gaps = 9/183 (5%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRA--AQNNVSHLLSWGGKEIVSSGGCNLFRGRWV  206
            MG+  ++  + + +I        H  +    QNN        G  ++S G CNL RG+WV
Sbjct  1    MGLCFQLNLASLSLILFFSSFHAHSQQQFLGQNNT-------GSSLLSRGRCNLSRGKWV  53

Query  207  VDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKK  386
             DSSYPLY    CPFID EF+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK
Sbjct  54   YDSSYPLYSAYTCPFIDSEFNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKK  113

Query  387  VMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDI  566
            +M VGDSLSLNM+ SLAC++HAS+P +K +  R + L+ +TF+EYGVT+YLY T +LVD+
Sbjct  114  IMMVGDSLSLNMFESLACLLHASLPNAKYSLRRNQPLTSLTFQEYGVTIYLYRTQFLVDV  173

Query  567  VKE  575
            V+E
Sbjct  174  VQE  176



>ref|XP_007211024.1| hypothetical protein PRUPE_ppa019892mg, partial [Prunus persica]
 gb|EMJ12223.1| hypothetical protein PRUPE_ppa019892mg, partial [Prunus persica]
Length=137

 Score =   180 bits (457),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (74%), Gaps = 12/141 (9%)
 Frame = +3

Query  96   QGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCI  275
             GHG R +            ++   + GCNLF+G W  D+SYPLY  S+CPFIDP+F+CI
Sbjct  6    HGHGTRIS------------RQRKQATGCNLFQGNWAFDASYPLYDSSSCPFIDPKFNCI  53

Query  276  KYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHAS  455
            KYGRPDKQ+LKYAWKPDSCDLPRFDG + L+R +GKK+MFVGDSLSLNMW SL+CMIHAS
Sbjct  54   KYGRPDKQFLKYAWKPDSCDLPRFDGLDFLRRRKGKKIMFVGDSLSLNMWESLSCMIHAS  113

Query  456  VPTSKITYSRQETLSYVTFKE  518
            VP +K T+ +   ++++   E
Sbjct  114  VPNAKTTFKKGYYVNFLECDE  134



>emb|CDY23962.1| BnaC03g17290D [Brassica napus]
Length=365

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 8/163 (5%)
 Frame = +3

Query  87   LLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEF  266
            LL Q       QNN S L    G+E      CN FRG+WV DSSYPLY P +CPFI+PEF
Sbjct  23   LLAQSQQHFLGQNNTSLL----GEE----RSCNWFRGKWVYDSSYPLYSPFSCPFINPEF  74

Query  267  DCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMI  446
            +C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+I
Sbjct  75   NCQKTGRPDTNYQHFRWQPFSCSLPRFDGVNFMRRMRGKKIMMVGDSLSLNMFESLACLI  134

Query  447  HASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            HAS+P +K + SR + L+ +TF++YGVT+ LY T +LVD+V+E
Sbjct  135  HASLPNAKYSLSRSQPLTSLTFQDYGVTILLYRTQFLVDVVQE  177



>ref|XP_002325581.2| hypothetical protein POPTR_0019s11990g [Populus trichocarpa]
 gb|EEE99962.2| hypothetical protein POPTR_0019s11990g [Populus trichocarpa]
Length=371

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CN FRG+WV D  YPLY  SNCPFIDP+F+C KYGRPD  YLKY W+P +CDLPRF+
Sbjct  50   AGKCNWFRGKWVFDPKYPLYD-SNCPFIDPQFNCQKYGRPDSYYLKYRWQPFACDLPRFN  108

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L++WRGKK+MFVGDSLSLN W SL C+IH+ VP SK T  R + LS +TF+++GV 
Sbjct  109  GLYFLEKWRGKKIMFVGDSLSLNQWTSLTCLIHSWVPNSKYTLFRTDVLSSLTFEDFGVK  168

Query  531  LYLYHTTYLVDIVKE  575
            + LY TTYLVD+V +
Sbjct  169  ILLYRTTYLVDLVND  183



>ref|XP_010552824.1| PREDICTED: protein trichome birefringence-like 39 isoform X3 
[Tarenaya hassleriana]
Length=362

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = +3

Query  150  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  329
            GG+++  +G CN FRGRWV D+ YPLY P  CPF+DP+F+C KYGRPD QYLKY W+P S
Sbjct  48   GGRKL--AGKCNWFRGRWVYDAKYPLYDPYKCPFVDPQFNCKKYGRPDSQYLKYRWQPSS  105

Query  330  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVT  509
            C LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+I++ VP S  +  RQ+ L+ +T
Sbjct  106  CSLPRFNGLYFLRRMRGKKIMFVGDSLSSNMWQSLACLIYSWVPNSSYSLLRQKGLTSLT  165

Query  510  FKEYGVTLYLYHTTYLVDIVKE  575
            F++Y VTL LY T +LVD+  E
Sbjct  166  FQDYKVTLLLYRTQFLVDLDSE  187



>gb|KFK37109.1| hypothetical protein AALP_AA4G214000 [Arabis alpina]
Length=374

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 113/162 (70%), Gaps = 1/162 (1%)
 Frame = +3

Query  90   LVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFD  269
            +V  +    + +N    +  G +E+VS G CN FRG WV D  YPLY P  CPFIDP+F+
Sbjct  25   IVSAYTTNTSSSNNDVEVESGRRELVS-GRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFN  83

Query  270  CIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIH  449
            C KYGRPD  YLKY W+P SC LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IH
Sbjct  84   CKKYGRPDNLYLKYRWQPSSCSLPRFNGLFFLRKMRGKKIMFVGDSLSTNMWESLACLIH  143

Query  450  ASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
              VP ++ T  RQ+ L+ +TF+EYGVTL LY T +LVD+  E
Sbjct  144  DWVPNTRYTLVRQKGLASLTFEEYGVTLLLYRTQFLVDLDSE  185



>emb|CAN82331.1| hypothetical protein VITISV_007322 [Vitis vinifera]
Length=365

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
             GCNL++G WV+D ++PLYQ S CPFID EFDC K GRPDK YLKY W+P  C LPRF+G
Sbjct  41   AGCNLYQGSWVIDDTFPLYQSSICPFIDKEFDCQKNGRPDKLYLKYRWRPSGCILPRFNG  100

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
             E L R++GK++MFVGDSLSLN W SL CM+HA+VP S+ T  RQ  LS  T  E+G+++
Sbjct  101  VEFLARYKGKRIMFVGDSLSLNQWQSLTCMLHAAVPRSRYTVDRQNDLSTFTMPEFGISI  160

Query  534  YLYHTTYLVDIVKE  575
            YL H  +LVD+VKE
Sbjct  161  YLSHNDFLVDLVKE  174



>ref|XP_004303168.1| PREDICTED: protein trichome birefringence-like 39 [Fragaria vesca 
subsp. vesca]
Length=377

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            ++ G CN FRG WV D+SY  +  SNCPFIDPEF+C KYGRPDK YLKY W+P SC LPR
Sbjct  52   LAGGKCNWFRGSWVYDASYNPHYDSNCPFIDPEFNCQKYGRPDKSYLKYRWQPSSCSLPR  111

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSR-QETLSYVTFKEY  521
            F+G  LL++WRGKK+MFVGDSLSLN W SL+CMIH+ VP SK  +S  +  ++ VTF++Y
Sbjct  112  FNGLNLLQQWRGKKIMFVGDSLSLNQWQSLSCMIHSWVPNSKYIFSPFRNGIASVTFQDY  171

Query  522  GVTLYLYHTTYLVDIVKE  575
            GV + LYHTTYLVD+  E
Sbjct  172  GVQMLLYHTTYLVDLDSE  189



>ref|XP_010552884.1| PREDICTED: protein trichome birefringence-like 39 isoform X4 
[Tarenaya hassleriana]
Length=359

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = +3

Query  150  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  329
            GG+++  +G CN FRGRWV D+ YPLY P  CPF+DP+F+C KYGRPD QYLKY W+P S
Sbjct  48   GGRKL--AGKCNWFRGRWVYDAKYPLYDPYKCPFVDPQFNCKKYGRPDSQYLKYRWQPSS  105

Query  330  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVT  509
            C LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+I++ VP S  +  RQ+ L+ +T
Sbjct  106  CSLPRFNGLYFLRRMRGKKIMFVGDSLSSNMWQSLACLIYSWVPNSSYSLLRQKGLTSLT  165

Query  510  FKEYGVTLYLYHTTYLVDIVKE  575
            F++Y VTL LY T +LVD+  E
Sbjct  166  FQDYKVTLLLYRTQFLVDLDSE  187



>ref|NP_001144145.1| uncharacterized protein LOC100276997 precursor [Zea mays]
 gb|ACG38244.1| hypothetical protein [Zea mays]
Length=392

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CNLF+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRF+G +
Sbjct  72   CNLFQGSWVYDDTLPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFNGQD  131

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP-TSKITYSRQETLSYVTFKEYGVTLY  536
            LL+RW+GKK++FVGDS+SLN W SLACM+ A+ P +S++ Y+R   +S VTF++YGV++ 
Sbjct  132  LLRRWKGKKILFVGDSISLNQWESLACMLRAAAPASSRVAYARGNPVSSVTFQDYGVSVA  191

Query  537  LYHTTYLVDIVKE  575
             Y +TYLVDIV+E
Sbjct  192  YYRSTYLVDIVEE  204



>ref|XP_009142074.1| PREDICTED: protein trichome birefringence-like 39 [Brassica rapa]
Length=371

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            +  + SG CN FRG WV D  YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P SC 
Sbjct  44   RRELRSGRCNWFRGSWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNLYLKYRWQPSSCS  103

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IHA VP ++ T  RQ+ L+ +TF+
Sbjct  104  LPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHAWVPNARYTLLRQKGLASLTFE  163

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            EYGVTL LY T +LVD+  E
Sbjct  164  EYGVTLKLYRTQFLVDLDSE  183



>ref|XP_008675272.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
38 [Zea mays]
Length=392

 Score =   187 bits (475),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
              CNLF+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRF+G
Sbjct  70   ASCNLFQGSWVYDDTLPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFNG  129

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP-TSKITYSRQETLSYVTFKEYGVT  530
             +LL+RW+GKK++FVGDS+SLN W SLACM+ A+ P +S++ Y+R   +S VTF++YGV+
Sbjct  130  QDLLRRWKGKKILFVGDSISLNQWESLACMLRAAAPASSRVAYARGNPVSSVTFQDYGVS  189

Query  531  LYLYHTTYLVDIVKE  575
            +  Y +TYLVDIV+E
Sbjct  190  VAYYRSTYLVDIVEE  204



>ref|XP_010915621.1| PREDICTED: protein trichome birefringence-like 38 isoform X2 
[Elaeis guineensis]
Length=273

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  SWGGKEIVSSGG-----CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLK  308
            SWG    V++GG     C+LF GRW  D SYPLY  ++CPFI  EFDC++YGRPDK YLK
Sbjct  25   SWG----VTAGGLRPPACDLFDGRWAYDESYPLYDSASCPFIRREFDCLRYGRPDKMYLK  80

Query  309  YAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQ  488
            Y W P+ CDLPRFDG +LL+RWRGKK+MFVGDSLSLN ++S  C++HA+VP  + + +R 
Sbjct  81   YRWNPNGCDLPRFDGRDLLERWRGKKIMFVGDSLSLNQFDSFLCLLHAAVPDGRTSSNRT  140

Query  489  ETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            E  + V F++Y V++  Y T YLVD+V+E
Sbjct  141  EVFTTVRFEDYNVSVMYYLTHYLVDVVRE  169



>gb|AAO42294.1| unknown protein [Arabidopsis thaliana]
Length=357

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 114/164 (70%), Gaps = 1/164 (1%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  7    LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  65

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  66   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  125

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +HAS+P +K +  R + L+ +TF++YGVT+ LY T +LVD+V+E
Sbjct  126  LHASLPNAKYSLRRSQPLTSLTFQDYGVTINLYRTQFLVDVVQE  169



>ref|XP_010469762.1| PREDICTED: protein trichome birefringence-like 40 [Camelina sativa]
Length=366

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 111/164 (68%), Gaps = 7/164 (4%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            +LL Q       QNN S         ++S G CNL RG+WV DSSYPLY    CPFID E
Sbjct  22   VLLAQSQQQFLGQNNTS-------SSLLSGGRCNLSRGKWVYDSSYPLYSAYTCPFIDSE  74

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLACM
Sbjct  75   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACM  134

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +HAS+P +K +  R + L+ +TF+EY VT+ LY T +LVD+V+E
Sbjct  135  LHASLPNAKYSLRRNQPLTSLTFQEYAVTILLYRTQFLVDVVQE  178



>dbj|BAD44658.1| unnamed protein product [Arabidopsis thaliana]
Length=364

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 114/164 (70%), Gaps = 1/164 (1%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  14   LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  72

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  73   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  132

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +HAS+P +K +  R + L+ +TF++YGVT+ LY T +LVD+V+E
Sbjct  133  LHASLPNAKYSLRRSQPLTSLTFQDYGVTINLYRTQFLVDVVQE  176



>ref|NP_001077985.1| protein TRICHOME BIREFRINGENCE-LIKE 40 [Arabidopsis thaliana]
 sp|Q67XC4.2|TBL40_ARATH RecName: Full=Protein trichome birefringence-like 40 [Arabidopsis 
thaliana]
 gb|AEC08494.1| uncharacterized protein AT2G31110 [Arabidopsis thaliana]
Length=364

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 114/164 (70%), Gaps = 1/164 (1%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  14   LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  72

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  73   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  132

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +HAS+P +K +  R + L+ +TF++YGVT+ LY T +LVD+V+E
Sbjct  133  LHASLPNAKYSLRRSQPLTSLTFQDYGVTINLYRTQFLVDVVQE  176



>gb|AAM65091.1| unknown [Arabidopsis thaliana]
Length=364

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 114/164 (70%), Gaps = 1/164 (1%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  14   LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  72

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  73   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  132

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +HAS+P +K +  R + L+ +TF++YGVT+ LY T +LVD+V+E
Sbjct  133  LHASLPNAKYSLRRSQPLTSLTFQDYGVTINLYRTQFLVDVVQE  176



>emb|CDY51515.1| BnaC04g02360D [Brassica napus]
Length=367

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +3

Query  150  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  329
            GG+  ++S  CN FRG WV D +YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P S
Sbjct  38   GGRRELASWRCNWFRGSWVYDVTYPLYDPYKCPFIDPQFNCKKYGRPDNLYLKYRWQPSS  97

Query  330  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVT  509
            C LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IH+ VP ++ T  RQ+ L+ +T
Sbjct  98   CSLPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNARYTLLRQKGLASLT  157

Query  510  FKEYGVTLYLYHTTYLVDIVKE  575
            F++YGVTL LY T +LVD+  E
Sbjct  158  FEDYGVTLKLYRTQFLVDLDAE  179



>ref|XP_006410237.1| hypothetical protein EUTSA_v10016834mg [Eutrema salsugineum]
 gb|ESQ51690.1| hypothetical protein EUTSA_v10016834mg [Eutrema salsugineum]
Length=365

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 117/170 (69%), Gaps = 1/170 (1%)
 Frame = +3

Query  69   VIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSG-GCNLFRGRWVVDSSYPLYQPSNC  245
            ++ ++ L++     +    +  H L    K ++S    CN FRG+WV DSSYPLY P +C
Sbjct  8    ILASLFLILFSSFSKILAQSQEHFLGQNNKTLLSEERSCNWFRGKWVYDSSYPLYSPFSC  67

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFID EF+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+
Sbjct  68   PFIDSEFNCQKAGRPDTNYQHFRWQPFSCSLPRFDGANFMRRMRGKKIMMVGDSLSLNMF  127

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SLAC++HAS+P +K +  R + L+ +TF++YGVT+ LY T +LVD+V+E
Sbjct  128  ESLACLLHASLPNAKYSLRRSQPLTSLTFQDYGVTILLYRTQFLVDVVQE  177



>ref|XP_004505509.1| PREDICTED: uncharacterized protein LOC101514285 [Cicer arietinum]
Length=361

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLF G+WV DSSYPLY PS CPFIDP+F+C K+GR D+ Y K+ W P SC LPRF+
Sbjct  40   AGTCNLFHGKWVYDSSYPLYDPSTCPFIDPQFNCQKHGRKDELYQKFRWMPFSCPLPRFN  99

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G + LK  +GKK+MFVGDSLSLN +NSLACM+HASVP SK T+ +++ LS VTF++YG+ 
Sbjct  100  GLKFLKGHKGKKIMFVGDSLSLNQFNSLACMLHASVPNSKATFRQRDALSSVTFEDYGLE  159

Query  531  LYLYHTTYLVDI  566
            L+LY T YLVD+
Sbjct  160  LFLYRTAYLVDL  171



>emb|CDY14846.1| BnaC04g48430D [Brassica napus]
Length=369

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 110/154 (71%), Gaps = 4/154 (3%)
 Frame = +3

Query  114  AAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPD  293
            A+ NN S  +    +  + SG CN F+G WV D  YPLY P  CPFIDP+F+C KYGRPD
Sbjct  32   ASSNNSSEAV----RRELRSGRCNWFKGSWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPD  87

Query  294  KQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKI  473
              YLKY W+P SC LPRF+G   L++ +GKK+MFVGDSLS NMW SLAC+IHA VP ++ 
Sbjct  88   NLYLKYRWQPSSCSLPRFNGLYFLRKMKGKKIMFVGDSLSTNMWQSLACLIHAWVPNARY  147

Query  474  TYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            T  RQ+ L+ +TF+EYGVTL LY T +LVD+  E
Sbjct  148  TLLRQKGLASLTFEEYGVTLKLYRTQFLVDLDSE  181



>emb|CDY47981.1| BnaA04g24590D [Brassica napus]
Length=366

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            +  + SG CN FRG WV D  YPLY P  CPF+DP+F+C KYGRPD  YLKY W+P SC 
Sbjct  39   RRELRSGRCNWFRGSWVYDVKYPLYDPYKCPFVDPQFNCKKYGRPDNLYLKYRWQPSSCS  98

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IHA VP ++ T  RQ+ L+ +TF+
Sbjct  99   LPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHAWVPNARYTLLRQKGLASLTFE  158

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            EYGVTL LY T +LVD+  E
Sbjct  159  EYGVTLKLYRTQFLVDLDSE  178



>ref|XP_010070349.1| PREDICTED: protein trichome birefringence-like 40 [Eucalyptus 
grandis]
Length=365

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  132  SHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKY  311
            S + ++ G+++++ GGCN F+G+WV D+SYPLY  S+CP+I+P+ DCIKYGRPD++YLKY
Sbjct  29   SLIANFSGRKLLA-GGCNFFQGKWVYDASYPLYDSSSCPYINPQNDCIKYGRPDREYLKY  87

Query  312  AWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQE  491
             W+P SC+LPRF+   LL  WRGKK++FVGDSLS+N+W SL+C+IHA +P +K + + + 
Sbjct  88   RWQPSSCNLPRFNAVNLLNGWRGKKILFVGDSLSVNIWESLSCLIHAQLPNAKTSSTTRG  147

Query  492  TLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             LS +T+++YGV + LY + +LVD+V+E
Sbjct  148  NLSTITYQDYGVEISLYWSRFLVDVVQE  175



>ref|XP_009593637.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
tomentosiformis]
Length=363

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            S GCN+FRG+WV DSSYPLY  S CPFI+ EF+C KY RPD  YLKY W+P SC+LPRF+
Sbjct  42   SSGCNIFRGKWVYDSSYPLYDFSTCPFIENEFNCQKYKRPDNLYLKYRWQPFSCNLPRFN  101

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L+++RGK +MFVGDSLSLNMW SLACMIH+ VP ++I   R+E LS + F +YGV 
Sbjct  102  GLVFLEKYRGKNIMFVGDSLSLNMWQSLACMIHSWVPKARIAVIRKEGLSEIAFLDYGVR  161

Query  531  LYLYHTTYLVDIVKE  575
            L LY + YLVD+VKE
Sbjct  162  LLLYRSPYLVDMVKE  176



>ref|XP_006446762.1| hypothetical protein CICLE_v10015634mg [Citrus clementina]
 gb|ESR60002.1| hypothetical protein CICLE_v10015634mg [Citrus clementina]
Length=375

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 110/140 (79%), Gaps = 2/140 (1%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            ++ +  G CN+F+G+WV D+SYPLY  S+CPF+DPEFDC KYGRPD  YLKY W+P SC 
Sbjct  52   RKSLGGGKCNIFQGKWVYDASYPLY--SHCPFVDPEFDCQKYGRPDDIYLKYRWQPFSCS  109

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            +PRF+G   L+++RGKK+MFVGDSLSLN W SLACMIH+ VP +K +  R   LS +TF+
Sbjct  110  IPRFNGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWVPKTKYSVVRTAVLSSITFQ  169

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            E+G+ + LY TTYLVD+V+E
Sbjct  170  EFGLQILLYRTTYLVDLVRE  189



>gb|EYU43352.1| hypothetical protein MIMGU_mgv1a017695mg [Erythranthe guttata]
Length=357

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 125/182 (69%), Gaps = 13/182 (7%)
 Frame = +3

Query  33   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  212
            MG  Q+ + S    I +L  V  +     + NV       G  I +   CNLF+G+WV +
Sbjct  1    MGFKQQTLLS----IFLLFTVSANSDLIEEKNVE-----DGDLIANK--CNLFQGQWVYN  49

Query  213  SSY-PLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  389
            SS  PLY  S+CP+ID  +DC K+GR DKQYLKY WKP SC+LPRFDG +LL+RW+GK +
Sbjct  50   SSSNPLYDSSSCPYID-TYDCQKFGRTDKQYLKYTWKPMSCNLPRFDGVDLLRRWKGKNI  108

Query  390  MFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIV  569
            M+VGDS+SL+ W+S+ACM+HASVP +K TY R+  +SY+ F+EYGVT+Y Y + Y VDI 
Sbjct  109  MYVGDSISLDQWSSIACMLHASVPNAKTTYVREYPISYIKFEEYGVTIYFYQSHYFVDID  168

Query  570  KE  575
            KE
Sbjct  169  KE  170



>ref|XP_002285609.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
 emb|CBI20119.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
             GCNL++G WV+D ++PLYQ S CPFID EFDC K GRPDK YLKY W+P  C LPRF+G
Sbjct  41   AGCNLYQGSWVIDDTFPLYQSSICPFIDKEFDCQKNGRPDKLYLKYRWRPSGCILPRFNG  100

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
             E L R++GK++MFVGDSLSLN W SL CM+HA+VP S+ T  RQ  LS  T  E+G+++
Sbjct  101  VEFLARYKGKRIMFVGDSLSLNQWQSLTCMLHAAVPRSRYTVDRQNDLSTFTMPEFGISI  160

Query  534  YLYHTTYLVDIVK  572
            YL H  +LVD+VK
Sbjct  161  YLSHNDFLVDLVK  173



>ref|XP_010552766.1| PREDICTED: protein trichome birefringence-like 39 isoform X2 
[Tarenaya hassleriana]
Length=375

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = +3

Query  150  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  329
            GG+++  +G CN FRGRWV D+ YPLY P  CPF+DP+F+C KYGRPD QYLKY W+P S
Sbjct  48   GGRKL--AGKCNWFRGRWVYDAKYPLYDPYKCPFVDPQFNCKKYGRPDSQYLKYRWQPSS  105

Query  330  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVT  509
            C LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+I++ VP S  +  RQ+ L+ +T
Sbjct  106  CSLPRFNGLYFLRRMRGKKIMFVGDSLSSNMWQSLACLIYSWVPNSSYSLLRQKGLTSLT  165

Query  510  FKEYGVTLYLYHTTYLVDIVKE  575
            F++Y VTL LY T +LVD+  E
Sbjct  166  FQDYKVTLLLYRTQFLVDLDSE  187



>ref|XP_010552686.1| PREDICTED: protein trichome birefringence-like 39 isoform X1 
[Tarenaya hassleriana]
Length=378

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = +3

Query  150  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  329
            GG+++  +G CN FRGRWV D+ YPLY P  CPF+DP+F+C KYGRPD QYLKY W+P S
Sbjct  48   GGRKL--AGKCNWFRGRWVYDAKYPLYDPYKCPFVDPQFNCKKYGRPDSQYLKYRWQPSS  105

Query  330  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVT  509
            C LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+I++ VP S  +  RQ+ L+ +T
Sbjct  106  CSLPRFNGLYFLRRMRGKKIMFVGDSLSSNMWQSLACLIYSWVPNSSYSLLRQKGLTSLT  165

Query  510  FKEYGVTLYLYHTTYLVDIVKE  575
            F++Y VTL LY T +LVD+  E
Sbjct  166  FQDYKVTLLLYRTQFLVDLDSE  187



>ref|XP_004505135.1| PREDICTED: uncharacterized protein LOC101503421 [Cicer arietinum]
Length=367

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 110/143 (77%), Gaps = 4/143 (3%)
 Frame = +3

Query  150  GGKEIVSSGGCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPD  326
            G KE+     CNLF G W++D  SYP Y   +CPFID +FDC K+ RPD++YL++ WKPD
Sbjct  39   GRKEL---NKCNLFYGSWMLDYDSYPTYDSLSCPFIDAQFDCKKFRRPDQKYLQFYWKPD  95

Query  327  SCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYV  506
            SC LPRFDG + L +WRGKK+MFVGDSLS NMW SL+CMIHASVP +  ++S +E++S +
Sbjct  96   SCTLPRFDGLDFLNKWRGKKIMFVGDSLSRNMWESLSCMIHASVPNATTSFSTRESMSTI  155

Query  507  TFKEYGVTLYLYHTTYLVDIVKE  575
             F++YGVT+ LY T YLVDI++E
Sbjct  156  IFQDYGVTIQLYRTPYLVDIIEE  178



>ref|XP_010510241.1| PREDICTED: protein trichome birefringence-like 40 [Camelina sativa]
Length=366

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            +LL Q       QNN S         ++S G CN  RG+WV D SYPLY    CPFID E
Sbjct  22   VLLAQSQQQFLGQNNTS-------SSLLSGGRCNFSRGKWVYDPSYPLYSAYTCPFIDSE  74

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLACM
Sbjct  75   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMLVGDSLSLNMFESLACM  134

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +HAS+P +K +  R + L+ +TF+EYGVT+ LY T +LVD+V+E
Sbjct  135  LHASLPNTKYSLRRNQPLTSLTFQEYGVTILLYRTQFLVDVVQE  178



>ref|XP_006582288.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN07756.1| hypothetical protein glysoja_033842 [Glycine soja]
Length=353

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLF G+WV D+SYPLY PS CPF+DP+F+C K+GR DK Y KY W P SC LPRF+
Sbjct  32   AGTCNLFSGKWVYDASYPLYDPSTCPFVDPQFNCQKHGRSDKLYQKYRWMPFSCPLPRFN  91

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L+++RGKK+MFVGDSLSLN +NSLACM+HA VP S+  +S+++ LS V F+ YG+ 
Sbjct  92   GLNFLEKYRGKKIMFVGDSLSLNQFNSLACMLHAWVPKSRSIFSQRDALSKVAFENYGLE  151

Query  531  LYLYHTTYLVDIVKE  575
            LYLY T YLVD+ +E
Sbjct  152  LYLYRTAYLVDLDRE  166



>ref|XP_010272740.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=369

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 120/175 (69%), Gaps = 6/175 (3%)
 Frame = +3

Query  51   VMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  230
            +++S V  + +L+L       A + ++ ++      + + S GC+LF+G WV D SYPLY
Sbjct  6    LIYSSVFAVVLLILSYAEQTSAEREHIDNV------DRIRSAGCDLFQGSWVFDDSYPLY  59

Query  231  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  410
               +CPFID +FDC++ GR DKQ+LKY WKP++CDLPRF+G   L+R++GKK+MFVGDSL
Sbjct  60   NSLDCPFIDKQFDCLRNGRADKQFLKYRWKPNACDLPRFNGEYFLRRFKGKKIMFVGDSL  119

Query  411  SLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SLN W SL CM+HA+VP +K T  +  TLS  T   YGV++ L  T +LVD+V E
Sbjct  120  SLNQWQSLICMLHAAVPQAKYTLRKMGTLSNFTLPGYGVSVMLSRTAFLVDLVTE  174



>ref|XP_006294317.1| hypothetical protein CARUB_v10023325mg, partial [Capsella rubella]
 gb|EOA27215.1| hypothetical protein CARUB_v10023325mg, partial [Capsella rubella]
Length=408

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            ++SG CN FRG WV D+ YPLY P  CPFIDP+F+C KYGRPD  YLK+ W+P SC LPR
Sbjct  83   LASGRCNWFRGNWVYDAKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKFRWQPSSCSLPR  142

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYG  524
            F+G   L++ RGKK+MFVGDSLS NMW SLAC+IH+ VP ++ T  RQ+ L+ +TF++YG
Sbjct  143  FNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNARYTLLRQKGLASLTFEDYG  202

Query  525  VTLYLYHTTYLVDIVKE  575
            VTL LY T +LVD+  E
Sbjct  203  VTLMLYRTQFLVDLNVE  219



>gb|KDP31782.1| hypothetical protein JCGZ_12243 [Jatropha curcas]
Length=371

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +3

Query  162  IVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLP  341
            + +   CN F+G+WV D  YPLY PS CPF+D EF+C + GR DK YLKY W+P SC+LP
Sbjct  48   LAARSKCNWFQGKWVFDPKYPLYNPSTCPFLDAEFNCQRNGRSDKYYLKYRWQPFSCNLP  107

Query  342  RFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEY  521
            RF+G   L++WRGKK+MFVGDSLSLN W SL CM+HASVP SK T  R + L+ VTF+EY
Sbjct  108  RFNGRYFLEKWRGKKIMFVGDSLSLNQWQSLTCMLHASVPNSKATLIRTDGLASVTFEEY  167

Query  522  GVTLYLYHTTYLVDIV  569
            GV + LY T YLVD+V
Sbjct  168  GVKILLYRTPYLVDLV  183



>ref|XP_006469036.1| PREDICTED: protein YLS7-like [Citrus sinensis]
 gb|KDO63325.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
Length=378

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            ++ +  G CN+F+G+WV D+SYPLY  S+CPF+DPEFDC KYGRPD  YLKY W+P SC 
Sbjct  55   RKSLGGGKCNIFQGKWVYDASYPLY--SHCPFVDPEFDCQKYGRPDDIYLKYRWQPFSCS  112

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            +PRF+G   L+++RGKK+MFVGDSLSLN W SLACMIH+  P +K +  R   LS +TF+
Sbjct  113  IPRFNGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWAPKTKYSVVRTAVLSSITFQ  172

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            E+G+ + LY TTYLVD+V+E
Sbjct  173  EFGLQILLYRTTYLVDLVRE  192



>gb|KCW89619.1| hypothetical protein EUGRSUZ_A01902 [Eucalyptus grandis]
Length=365

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  132  SHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKY  311
            S + ++ G+++++ GGCN F+G+WV D+SYPLY  S+CP+I+P+ DCIKYGRPD++YLKY
Sbjct  29   SLIANFSGRKLLA-GGCNFFQGKWVYDASYPLYDSSSCPYINPQNDCIKYGRPDREYLKY  87

Query  312  AWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQE  491
             W+P SC+LPRF+   LL  WRGKK++FVGDSLS+N+W SL+C+IHA +P +K + + + 
Sbjct  88   RWQPSSCNLPRFNAVNLLNGWRGKKILFVGDSLSVNIWESLSCLIHAQLPNAKTSSTTRG  147

Query  492  TLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             LS +T+ +YGV + LY + +LVD+V+E
Sbjct  148  NLSTITYVDYGVEISLYWSRFLVDVVQE  175



>ref|NP_001241538.1| uncharacterized protein LOC100786668 precursor [Glycine max]
 gb|ACU21530.1| unknown [Glycine max]
Length=353

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CNLF G+WV D+S PLY PS CPFIDP+F+C K+GR DK Y KY W P SC LPRF+
Sbjct  32   AGTCNLFSGKWVYDASNPLYDPSTCPFIDPQFNCQKHGRSDKLYQKYRWMPFSCPLPRFN  91

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L+R+ GKK+MFVGDSLSLN +NSLACM+HA VP S+ T+S+++ LS V F++YG+ 
Sbjct  92   GLNFLQRYSGKKIMFVGDSLSLNQFNSLACMLHAWVPKSRSTFSQRDALSKVAFEDYGLE  151

Query  531  LYLYHTTYLVDIVKE  575
            LYLY T YLVD+ +E
Sbjct  152  LYLYRTAYLVDLDRE  166



>ref|XP_010915620.1| PREDICTED: protein trichome birefringence-like 37 isoform X1 
[Elaeis guineensis]
Length=358

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  SWGGKEIVSSGG-----CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLK  308
            SWG    V++GG     C+LF GRW  D SYPLY  ++CPFI  EFDC++YGRPDK YLK
Sbjct  25   SWG----VTAGGLRPPACDLFDGRWAYDESYPLYDSASCPFIRREFDCLRYGRPDKMYLK  80

Query  309  YAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQ  488
            Y W P+ CDLPRFDG +LL+RWRGKK+MFVGDSLSLN ++S  C++HA+VP  + + +R 
Sbjct  81   YRWNPNGCDLPRFDGRDLLERWRGKKIMFVGDSLSLNQFDSFLCLLHAAVPDGRTSSNRT  140

Query  489  ETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            E  + V F++Y V++  Y T YLVD+V+E
Sbjct  141  EVFTTVRFEDYNVSVMYYLTHYLVDVVRE  169



>gb|EPS71829.1| hypothetical protein M569_02929 [Genlisea aurea]
Length=257

 Score =   181 bits (459),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 114/171 (67%), Gaps = 14/171 (8%)
 Frame = +3

Query  69   VIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCP  248
            VI+ + LL+  H   A   N + +            GC++F G+WV DSSYPLY PS CP
Sbjct  7    VIVFIPLLLSIHVAAAELFNATAV------------GCDVFEGKWVYDSSYPLYDPSGCP  54

Query  249  FIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWN  428
            +ID  F+C+KY RPD+ YL+Y W+P SCDLPRFDG + L+R RGK++MFVGDSLSLNMW 
Sbjct  55   YIDEGFNCLKYNRPDRDYLRYRWQPSSCDLPRFDGLDFLERSRGKRIMFVGDSLSLNMWQ  114

Query  429  SLACMIHASVPTSKIT--YSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SL C+IH++ P    T    RQ+ LS +TF +YGV L LY T YLVD+  +
Sbjct  115  SLICLIHSTAPAPVRTSLIGRQQALSQITFLDYGVELLLYRTPYLVDMENQ  165



>gb|KJB71444.1| hypothetical protein B456_011G124000 [Gossypium raimondii]
Length=271

 Score =   181 bits (460),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  332
            G+    +  CN FRG+WV D SYPLY P  CPFI+ EFDC KYGRPD  YLKY W+P SC
Sbjct  39   GRTRSLASNCNWFRGKWVYDPSYPLYDPYKCPFIEGEFDCQKYGRPDNTYLKYRWQPFSC  98

Query  333  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTF  512
             LPRF+G   L++WRGKK+MFVGDSLSLN + SL CMI A VP S+I+Y +++ L+ VTF
Sbjct  99   SLPRFNGLYFLRKWRGKKIMFVGDSLSLNQFQSLTCMIQAWVPNSQISYIKRDGLTSVTF  158

Query  513  KEYGVTLYLYHTTYLVDIVKE  575
             +Y V + LY T YLVDIV +
Sbjct  159  LDYDVNIMLYRTPYLVDIVNQ  179



>ref|XP_002525125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37252.1| conserved hypothetical protein [Ricinus communis]
Length=350

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            +++ ++  CN FRG+WV DSSYPLY P +CPF+D +F+C + GRPD+ YLKY W+P SC 
Sbjct  24   RKLAANSKCNWFRGKWVFDSSYPLYDPYSCPFLDKQFNCQENGRPDRYYLKYRWQPFSCS  83

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            LPRF+G   L++WRGKK+MFVGDSLSLN W SL CM+H+ VP SK +  R   LS VTF+
Sbjct  84   LPRFNGLYFLEKWRGKKIMFVGDSLSLNQWQSLTCMLHSWVPNSKYSLIRNNGLSSVTFE  143

Query  516  EYGVTLYLYHTTYLVDIVK  572
            +YGVT+ LY T +LVD+V 
Sbjct  144  DYGVTILLYRTPFLVDVVN  162



>ref|XP_002881157.1| hypothetical protein ARALYDRAFT_482040 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57416.1| hypothetical protein ARALYDRAFT_482040 [Arabidopsis lyrata subsp. 
lyrata]
Length=364

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  135  HLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYA  314
            H L      ++S G CNL RG+WV DS+YPLY   NCPFID EF+C K GRPD  Y  + 
Sbjct  30   HFLGQNSTSLLSGGRCNLARGKWVYDSTYPLYSAFNCPFIDYEFNCQKAGRPDTNYQHFR  89

Query  315  WKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQET  494
            W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC++HAS+P +K +  R + 
Sbjct  90   WQPFSCPLPRFDGVNFMRRMRGKKIMMVGDSLSLNMFESLACLLHASLPNAKYSLRRSQP  149

Query  495  LSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            L+ +TF++YGVT++LY T +LVD+V+E
Sbjct  150  LTSLTFQDYGVTIHLYRTQFLVDVVQE  176



>ref|XP_011100405.1| PREDICTED: protein trichome birefringence-like 39 [Sesamum indicum]
Length=394

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 4/156 (3%)
 Frame = +3

Query  114  AAQNNVSHL--LSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGR  287
            AA+    HL   ++  +++  +G CN+FRG+WV D+SYPLY  S CPFID EF+C+KY R
Sbjct  54   AAEEAERHLNGTTYAARKL--AGSCNVFRGKWVYDASYPLYDFSTCPFIDDEFNCLKYKR  111

Query  288  PDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS  467
            PD+ YLKY W+P SC+LPRF+G   L+++RGK +MFVGDSLSLNMW SL+CMIH+SVP +
Sbjct  112  PDQMYLKYRWQPFSCNLPRFNGVAFLEKFRGKNIMFVGDSLSLNMWESLSCMIHSSVPNA  171

Query  468  KITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            + +  R++ L+ V F +YGV L LY T YLVD+  +
Sbjct  172  RTSLIRRDGLAEVAFLDYGVRLLLYRTPYLVDLENQ  207



>ref|XP_004967058.1| PREDICTED: uncharacterized protein LOC101773522 [Setaria italica]
Length=371

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            VSS GC+LF+GRWV D SYPLY  S CPF+   FDC + GRPD  YLK+ W P +C LPR
Sbjct  25   VSSSGCDLFQGRWVADKSYPLYDASTCPFVPDVFDCRRNGRPDDAYLKFRWNPANCRLPR  84

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS-KITYSRQETLSYVTFKEY  521
            FDG + L+RWRGK VMFVGDSLS+N W SLACM+HAS P   + T +  E +S + F++Y
Sbjct  85   FDGADFLRRWRGKTVMFVGDSLSMNQWVSLACMLHASAPAPVRATLTAGEPVSTLRFEDY  144

Query  522  GVTLYLYHTTYLVDIVKE  575
             + L LYHTT+LVD+V+E
Sbjct  145  DLLLVLYHTTFLVDVVRE  162



>ref|XP_009787170.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
sylvestris]
Length=367

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            S GCN+FRG+WV DSSYPLY  S CPFI+ EF+C KY RPD  YLKY W+P SC+LPRF+
Sbjct  46   SSGCNIFRGKWVYDSSYPLYDFSTCPFIENEFNCQKYKRPDNLYLKYRWQPFSCNLPRFN  105

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L+++RGK +MFVGDSLSLNMW SLACMIH+ VP ++    R+E LS + F +YGV 
Sbjct  106  GLIFLEKYRGKNIMFVGDSLSLNMWQSLACMIHSWVPKARTAVIRKEGLSEIAFVDYGVR  165

Query  531  LYLYHTTYLVDIVKE  575
            L LY + YLVD+VKE
Sbjct  166  LLLYRSPYLVDMVKE  180



>ref|XP_008456435.1| PREDICTED: protein trichome birefringence-like 37 [Cucumis melo]
Length=165

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            +++  CNL++G+WV DSSYPLY  S CPF+DP+F+C KYGRPDK YLKY W+P +C +PR
Sbjct  47   LAARKCNLYQGKWVFDSSYPLYDSSTCPFVDPQFNCQKYGRPDKSYLKYRWQPFACGIPR  106

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            F+G   L++WRGKK+MFVGDSLSLN W SLACMIHASVP SK ++ R+E LS VTF+
Sbjct  107  FNGLNFLEKWRGKKIMFVGDSLSLNQWESLACMIHASVPNSKTSFVRREGLSSVTFQ  163



>gb|EYU41140.1| hypothetical protein MIMGU_mgv1a008520mg [Erythranthe guttata]
Length=371

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  335
            +++ ++ GCN+F+G+WV DSSYPLY  S CPFID EF+C+KY RPD+ YLKY W+P SC+
Sbjct  45   RKLAAAAGCNIFQGKWVYDSSYPLYDYSTCPFIDDEFNCLKYKRPDRNYLKYRWQPFSCN  104

Query  336  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK  515
            LP F+G   L+++RGKK+MFVGDSLSLN+W SL+CMIH+ VP ++ +  +++ L+ +TF 
Sbjct  105  LPSFNGVSFLEKYRGKKIMFVGDSLSLNIWQSLSCMIHSWVPNARTSLIKRQGLAELTFL  164

Query  516  EYGVTLYLYHTTYLVDIVKE  575
            +YGV L LY T YLVDI  +
Sbjct  165  DYGVKLLLYRTPYLVDIENQ  184



>ref|XP_007050058.1| Trichome birefringence-like 39 [Theobroma cacao]
 gb|EOX94215.1| Trichome birefringence-like 39 [Theobroma cacao]
Length=360

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +  CN FRG+WV   +YPLY  S CPFID EFDC KYGRPD  YLKY W+P SC +PRF+
Sbjct  38   ASNCNWFRGKWVYYPTYPLYDASKCPFIDGEFDCKKYGRPDNMYLKYRWQPFSCSIPRFN  97

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L++WRGKK+MFVGDSLSLN + SL CMI A VP SKI+Y +++ L+ VTF++YGV 
Sbjct  98   GLYFLEKWRGKKIMFVGDSLSLNQFQSLTCMIQAWVPNSKISYIKRDGLTSVTFQDYGVK  157

Query  531  LYLYHTTYLVDIVKE  575
            + LY T YLVDIV E
Sbjct  158  ILLYRTPYLVDIVNE  172



>gb|AFK40281.1| unknown [Lotus japonicus]
Length=361

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CN F+G+WV D+SYPLY PS+CPFID +F+C K+GR DK Y KY W P SC LPRF+
Sbjct  40   AGTCNWFQGKWVYDASYPLYDPSSCPFIDQQFNCQKHGRKDKLYQKYRWTPFSCSLPRFN  99

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L R RGKK+MFVGDSLSLN +NSLACM+HA VP S+ T+++++ LS V F++YG+ 
Sbjct  100  GLSFLNRNRGKKIMFVGDSLSLNQFNSLACMLHAWVPKSRATFAQRDALSSVKFEDYGLE  159

Query  531  LYLYHTTYLVDI  566
            LYLY T YLVD+
Sbjct  160  LYLYRTAYLVDL  171



>ref|XP_006442366.1| hypothetical protein CICLE_v10024135mg [Citrus clementina]
 gb|ESR55606.1| hypothetical protein CICLE_v10024135mg [Citrus clementina]
Length=379

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 106/145 (73%), Gaps = 3/145 (2%)
 Frame = +3

Query  141  LSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWK  320
            LS G  ++   GGC+ F+G WV D +YPLY  S CPFI+ EFDC+K GRPDK YLKY WK
Sbjct  43   LSLGNSKV---GGCDFFQGSWVRDDTYPLYDTSICPFIEREFDCLKNGRPDKLYLKYKWK  99

Query  321  PDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLS  500
            P +C+LPRFDG + L+R++GKK++FVGDSLSLN W SLACM+HASVP +  T SR   +S
Sbjct  100  PTACELPRFDGRDFLRRYKGKKILFVGDSLSLNQWQSLACMLHASVPQTNFTISRTNGVS  159

Query  501  YVTFKEYGVTLYLYHTTYLVDIVKE  575
              T  EY +++ L    +LVDIVKE
Sbjct  160  TFTIPEYDISVKLDRNAFLVDIVKE  184



>ref|XP_009357163.1| PREDICTED: protein trichome birefringence-like 39 [Pyrus x bretschneideri]
Length=371

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  347
            +G CN FRG WV D SS P Y  S CPFIDP+FDC+KYGRPD  +LKY W+P SC LPRF
Sbjct  49   AGKCNWFRGTWVYDASSKPPYYSSTCPFIDPQFDCLKYGRPDTAFLKYRWQPFSCALPRF  108

Query  348  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGV  527
            +G   L++WRGKK+MFVGDSLS N W SL CM+HA VP S+ +Y +++ L+ VTF++YGV
Sbjct  109  NGLRFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTSYVKKDGLASVTFQDYGV  168

Query  528  TLYLYHTTYLVDIVKE  575
             + LY T YLVD+V E
Sbjct  169  QILLYRTPYLVDLVNE  184



>ref|XP_006477896.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=379

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
            GGC+ F+G WV D +YPLY  S CPFI+ EFDC+K GRPDK YLKY WKP +C+LPRFDG
Sbjct  51   GGCDFFQGSWVRDDAYPLYDTSICPFIEREFDCLKNGRPDKLYLKYKWKPTACELPRFDG  110

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
             + L+R++GKK++FVGDSLSLN W SLACM+HASVP +  T SR   +S  T  EY +++
Sbjct  111  RDFLRRYKGKKILFVGDSLSLNQWQSLACMLHASVPQTNFTISRTNGVSTFTIPEYDISV  170

Query  534  YLYHTTYLVDIVKE  575
             L    +LVDIVKE
Sbjct  171  KLDRNAFLVDIVKE  184



>ref|XP_008783903.1| PREDICTED: protein trichome birefringence-like 38 [Phoenix dactylifera]
Length=358

 Score =   181 bits (459),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 1/145 (1%)
 Frame = +3

Query  144  SWGGKEI-VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWK  320
            SWG     ++   C+LF G WV DSSYPLY  ++CPFI  EFDC+K+GRPD  YLKY W 
Sbjct  25   SWGATVARLNPPACDLFDGSWVYDSSYPLYDSASCPFIRREFDCLKFGRPDMMYLKYRWN  84

Query  321  PDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLS  500
            P+ C LPRFDG +LL+RWRGKK+MFVGDSLSLN ++SL C++HA+VP  +   +R + L+
Sbjct  85   PNGCYLPRFDGRDLLRRWRGKKIMFVGDSLSLNQFDSLLCLLHAAVPNGRTRSNRTDALT  144

Query  501  YVTFKEYGVTLYLYHTTYLVDIVKE  575
             VTF++Y VT+  Y T YLVD+V+E
Sbjct  145  TVTFEDYKVTVMYYITHYLVDVVRE  169



>ref|XP_006348847.1| PREDICTED: uncharacterized protein LOC102593679 [Solanum tuberosum]
Length=362

 Score =   181 bits (459),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
              CN++ G+WV DSSYPLY  SNCPFID EF+C KY RPD  YLKY W+P SC+LPRF+G
Sbjct  42   SSCNIYSGKWVYDSSYPLYDSSNCPFIDNEFNCQKYKRPDNLYLKYRWQPFSCNLPRFNG  101

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
               L+++RGK +MFVGDSLSLNMW SLACMIH+ VP +K    R E ++ + F +YGV L
Sbjct  102  LVFLEKYRGKNIMFVGDSLSLNMWESLACMIHSWVPNAKTAVIRNEGIAEIVFLDYGVRL  161

Query  534  YLYHTTYLVDIVKE  575
             LY T YLVD+V+E
Sbjct  162  LLYRTPYLVDMVRE  175



>ref|XP_004248190.1| PREDICTED: protein trichome birefringence-like 39 [Solanum lycopersicum]
Length=354

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +3

Query  159  EIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDL  338
            + +S+ GCN+F G+WV DSSYP+Y  S CPFID EF+C KY RPD  YLKY W+P SC+L
Sbjct  29   DAISNIGCNIFVGKWVFDSSYPMYDFSKCPFIDNEFNCQKYKRPDNLYLKYRWQPSSCNL  88

Query  339  PRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKE  518
            PRF+G   L++++GK +MFVGDSLSLNMW SL CMIH+S+P +K + +++  ++ + F +
Sbjct  89   PRFNGLVFLEKYKGKNIMFVGDSLSLNMWESLGCMIHSSLPNAKTSLTKKNGIAEIAFLD  148

Query  519  YGVTLYLYHTTYLVDIVKE  575
            YGV L +Y T YLVD+VKE
Sbjct  149  YGVRLSMYRTPYLVDMVKE  167



>gb|KJB71443.1| hypothetical protein B456_011G124000 [Gossypium raimondii]
Length=366

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  332
            G+    +  CN FRG+WV D SYPLY P  CPFI+ EFDC KYGRPD  YLKY W+P SC
Sbjct  39   GRTRSLASNCNWFRGKWVYDPSYPLYDPYKCPFIEGEFDCQKYGRPDNTYLKYRWQPFSC  98

Query  333  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTF  512
             LPRF+G   L++WRGKK+MFVGDSLSLN + SL CMI A VP S+I+Y +++ L+ VTF
Sbjct  99   SLPRFNGLYFLRKWRGKKIMFVGDSLSLNQFQSLTCMIQAWVPNSQISYIKRDGLTSVTF  158

Query  513  KEYGVTLYLYHTTYLVDIVKE  575
             +Y V + LY T YLVDIV +
Sbjct  159  LDYDVNIMLYRTPYLVDIVNQ  179



>ref|XP_003537664.1| PREDICTED: protein YLS7-like [Glycine max]
Length=364

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 114/171 (67%), Gaps = 3/171 (2%)
 Frame = +3

Query  63   GVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSN  242
            GV+ +  LL V   GG     +V     W   E      CN++ GRW +D SYPLY  S 
Sbjct  9    GVICLCQLLCVVTTGGGG---HVESNFKWQRSEEKHELSCNMYEGRWELDDSYPLYDSST  65

Query  243  CPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNM  422
            CP I  EFDC+KYGRPD+QYLKY W+P+ CDLPRFDG + L + +GK++MF+GDS+SLN 
Sbjct  66   CPHIRKEFDCLKYGRPDQQYLKYRWQPNECDLPRFDGKDFLTKLKGKQIMFIGDSVSLNQ  125

Query  423  WNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            W SL C++ +SVP ++I       +S  TF++YGV++ ++H+TYLVDI +E
Sbjct  126  WQSLICLLRSSVPQTEILEQGDVNVSNYTFQDYGVSVIIFHSTYLVDIEEE  176



>ref|XP_008381569.1| PREDICTED: protein trichome birefringence-like 39 [Malus domestica]
Length=371

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  347
            +G CN FRG WV D SS P Y  S CPF+DP+FDC+KYGRPD  +LKY W+P SC LPRF
Sbjct  49   AGKCNWFRGTWVYDASSKPPYYSSTCPFVDPQFDCLKYGRPDTAFLKYRWQPFSCALPRF  108

Query  348  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGV  527
            +G   L++WRGKK+MFVGDSLS N W SL CM+HA VP S+ +Y +++ L+ VTF++YGV
Sbjct  109  NGLYFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTSYVKKDGLASVTFQDYGV  168

Query  528  TLYLYHTTYLVDIVKE  575
             + LY T YLVD+V E
Sbjct  169  QILLYRTPYLVDLVNE  184



>ref|XP_010272738.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Nelumbo nucifera]
Length=357

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 116/172 (67%), Gaps = 8/172 (5%)
 Frame = +3

Query  63   GVVIIAVLLLVQGHGGRAAQNNVSHLLSWG-GKEIVSSGGCNLFRGRWVVDSSYPLYQPS  239
             ++++  L L+Q   G  + NNVS    WG GK+   S GC+LF GRWV D +YPLY PS
Sbjct  13   AILVLNFLFLLQRVHGEHS-NNVSR---WGQGKQ---SWGCDLFDGRWVYDEAYPLYNPS  65

Query  240  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  419
            +CP I+  FDC K GRPDK YLKY WKP+ CDLPRF+G + L R RGK++MFVGDSLSLN
Sbjct  66   SCPSIESIFDCQKNGRPDKLYLKYRWKPNGCDLPRFNGHDFLWRLRGKRIMFVGDSLSLN  125

Query  420  MWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             W SL CM+H S+P SK T  R   LS   F +YGV++      +LVD+V+E
Sbjct  126  QWQSLTCMLHTSLPKSKYTLVRDGGLSTFKFLDYGVSVMFSRNAFLVDLVQE  177



>ref|XP_008244484.1| PREDICTED: protein trichome birefringence-like 39 [Prunus mume]
Length=380

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  347
            +G CN FRG WV D SS P Y  S CPF+DP+FDC KYGR D  YLKY W+P SC LPRF
Sbjct  57   AGKCNWFRGTWVYDASSKPPYDSSTCPFLDPQFDCQKYGRRDSTYLKYRWQPFSCALPRF  116

Query  348  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGV  527
            +G + L++WRGKK+MFVGDSLS N W SL CM+HA VP S+ T+ R++ L+ VTF++YGV
Sbjct  117  NGLKFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTTHFRKDGLASVTFQDYGV  176

Query  528  TLYLYHTTYLVDIVKE  575
             + LY TTYLVD+V E
Sbjct  177  QILLYRTTYLVDLVNE  192



>emb|CDX97749.1| BnaC04g41900D [Brassica napus]
Length=368

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 112/165 (68%), Gaps = 9/165 (5%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            LLL Q       QNN + L             CN FRG+WV DSSYPLY P +CPF+DPE
Sbjct  23   LLLAQPKQHFLGQNNTTFL--------TGERPCNWFRGKWVYDSSYPLYSPFSCPFLDPE  74

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLP-RFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  440
            F+C K GRPD  Y  + W+P SC LP RFDG   L+R RGKK+M VGDSLSLNM+ SLAC
Sbjct  75   FNCQKAGRPDTYYQHFLWQPFSCSLPSRFDGVNFLRRMRGKKIMMVGDSLSLNMFESLAC  134

Query  441  MIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +IHAS+P +K +  R + L+ +TF++YGVT+ LY T +LVD+V+E
Sbjct  135  LIHASLPNAKYSLRRGQPLTSLTFQDYGVTILLYRTQFLVDVVQE  179



>ref|XP_006376352.1| hypothetical protein POPTR_0013s12290g [Populus trichocarpa]
 gb|ERP54149.1| hypothetical protein POPTR_0013s12290g [Populus trichocarpa]
Length=368

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 114/172 (66%), Gaps = 8/172 (5%)
 Frame = +3

Query  69   VIIAVLLLVQGHGGRAAQNNVSHLLSW-----GGKEIVSSGGCNLFRGRWVVDSSYPLYQ  233
            + +++ L +  H    A    +   S+       +E+  +G CN FRG+WV D  YPLY 
Sbjct  9    MFLSLFLFISYHTATEASKLSAQSFSFSNGTSNAREL--AGKCNWFRGKWVFDPKYPLYD  66

Query  234  PSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLS  413
             SNCPFIDP+F+C KYGR D  YLKY W+P +CDLPRF+G   L++WRGKK+MFVGDSLS
Sbjct  67   -SNCPFIDPQFNCQKYGRHDSSYLKYRWQPFACDLPRFNGLYFLEKWRGKKIMFVGDSLS  125

Query  414  LNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIV  569
            LN W SL C+IH+ VP SK    R + L  VTF+EYGV + LY T YLVD+V
Sbjct  126  LNQWISLTCLIHSWVPNSKYKVFRADGLYSVTFEEYGVKILLYRTPYLVDLV  177



>ref|XP_010272737.1| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Nelumbo nucifera]
Length=371

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 116/172 (67%), Gaps = 8/172 (5%)
 Frame = +3

Query  63   GVVIIAVLLLVQGHGGRAAQNNVSHLLSWG-GKEIVSSGGCNLFRGRWVVDSSYPLYQPS  239
             ++++  L L+Q   G  + NNVS    WG GK+   S GC+LF GRWV D +YPLY PS
Sbjct  13   AILVLNFLFLLQRVHGEHS-NNVSR---WGQGKQ---SWGCDLFDGRWVYDEAYPLYNPS  65

Query  240  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  419
            +CP I+  FDC K GRPDK YLKY WKP+ CDLPRF+G + L R RGK++MFVGDSLSLN
Sbjct  66   SCPSIESIFDCQKNGRPDKLYLKYRWKPNGCDLPRFNGHDFLWRLRGKRIMFVGDSLSLN  125

Query  420  MWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             W SL CM+H S+P SK T  R   LS   F +YGV++      +LVD+V+E
Sbjct  126  QWQSLTCMLHTSLPKSKYTLVRDGGLSTFKFLDYGVSVMFSRNAFLVDLVQE  177



>ref|XP_004243406.1| PREDICTED: protein trichome birefringence-like 39 [Solanum lycopersicum]
Length=363

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = +3

Query  159  EIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDL  338
            EI SS  CN++RG+WV DSSYPLY  SNCPFID EF+C KY RPD  YLKY W+P SC+L
Sbjct  40   EIKSS--CNIYRGKWVYDSSYPLYDFSNCPFIDNEFNCQKYKRPDNLYLKYRWQPFSCNL  97

Query  339  PRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKE  518
            PRF+G   L+++RGK +MFVGDSLSLNMW SLACMIH+ VP +K    R++ ++ + F +
Sbjct  98   PRFNGLFFLEKYRGKNIMFVGDSLSLNMWESLACMIHSWVPNAKTAVIRKQGIAEIVFLD  157

Query  519  YGVTLYLYHTTYLVDIVKE  575
            Y V L LY T YLVD+V+E
Sbjct  158  YEVRLLLYRTPYLVDMVRE  176



>ref|XP_008781517.1| PREDICTED: protein trichome birefringence-like 38 [Phoenix dactylifera]
Length=358

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            +S   C+LF G WV D SYPLY   +CPF   EFDC++YGRPDK YLKY W P+ CDLPR
Sbjct  33   LSPAACDLFNGSWVYDESYPLYDSESCPFNRREFDCLRYGRPDKLYLKYRWSPNGCDLPR  92

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYG  524
            FDG +LL+RW+GKK+MFVGDSLSLN ++SL C++HA+VP  K + +   TL  VTF++Y 
Sbjct  93   FDGRDLLRRWKGKKIMFVGDSLSLNQYDSLLCLLHAAVPNGKTSSTDTGTLKTVTFEDYN  152

Query  525  VTLYLYHTTYLVDIVKE  575
            V++  Y + YLVDIV+E
Sbjct  153  VSVMYYLSHYLVDIVRE  169



>ref|XP_010524990.1| PREDICTED: protein trichome birefringence-like 39 [Tarenaya hassleriana]
Length=370

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            +G CN FRGRWV D+ YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P SC LPRF+
Sbjct  48   AGKCNWFRGRWVYDAKYPLYDPYKCPFIDPQFNCKKYGRPDSLYLKYRWQPFSCSLPRFN  107

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVT  530
            G   L++ +GKK+MFVGDSLS NMW SLAC+I++  P S+ T  RQ+ LS +TF++Y VT
Sbjct  108  GLYFLRKMKGKKIMFVGDSLSSNMWQSLACLIYSWAPNSRFTLLRQKGLSSLTFEDYKVT  167

Query  531  LYLYHTTYLVDIVKE  575
            L LY T +LVD+  E
Sbjct  168  LLLYRTQFLVDLDSE  182



>gb|ACU19344.1| unknown [Glycine max]
 gb|KHN41859.1| hypothetical protein glysoja_003599 [Glycine soja]
Length=364

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 114/171 (67%), Gaps = 3/171 (2%)
 Frame = +3

Query  63   GVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSN  242
            GV+ +  LL V   GG     +V     W   E      CN++ GRW +D SYPLY  S 
Sbjct  9    GVICLCQLLCVVTTGGGG---HVESNFKWQRSEEKHELSCNMYEGRWELDDSYPLYDSST  65

Query  243  CPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNM  422
            CP I  EFDC+KYGRPD+QYLKY W+P+ CDLPRFDG + L + +GK++MF+GDS+SLN 
Sbjct  66   CPHIRKEFDCLKYGRPDQQYLKYRWQPNECDLPRFDGKDFLTKLKGKQIMFIGDSVSLNQ  125

Query  423  WNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            W SL C++ +SVP ++I       +S  TF++YGV++ ++H+TYLVDI ++
Sbjct  126  WQSLICLLRSSVPQTEILEQGDVNVSNYTFQDYGVSVIIFHSTYLVDIEED  176



>ref|XP_010068952.1| PREDICTED: protein trichome birefringence-like 38 [Eucalyptus 
grandis]
Length=376

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 120/193 (62%), Gaps = 26/193 (13%)
 Frame = +3

Query  45   QKVMWSGVVIIAVLL----------------LVQGHGGRAAQNNVSHLLSWGGKEIVSSG  176
            Q+++ + +V++A+L+                L+QG G    +          GK+     
Sbjct  6    QRIVLAILVVLAILVAISLALDSCVSSAGAGLLQGEGATGVK----------GKKQEPEE  55

Query  177  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  356
             CN++ G W  D SYPLY PS CPF+  EFDC KYGRPD+ YLKY W+P+ CDLPRFD  
Sbjct  56   NCNVYEGSWAYDPSYPLYDPSACPFVRKEFDCFKYGRPDRLYLKYRWQPNGCDLPRFDAQ  115

Query  357  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLY  536
              L R++GKK+M++GDSLSLN W SL C++HA  P S I+   + ++S VTF++YGV++ 
Sbjct  116  GFLSRFQGKKIMYIGDSLSLNNWQSLICLLHAGAPNSSISQETEGSISTVTFQDYGVSVM  175

Query  537  LYHTTYLVDIVKE  575
            L+H+ Y+VDI  E
Sbjct  176  LFHSLYMVDIEVE  188



>ref|XP_007211411.1| hypothetical protein PRUPE_ppa007013mg [Prunus persica]
 gb|EMJ12610.1| hypothetical protein PRUPE_ppa007013mg [Prunus persica]
Length=386

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  347
            +G CN FRG WV D SS P Y  S CPF+DP+FDC KYGR D  YLKY W+P SC LPRF
Sbjct  63   AGKCNWFRGMWVYDASSKPRYDSSTCPFLDPQFDCQKYGRRDSTYLKYRWQPFSCALPRF  122

Query  348  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGV  527
            +G + L++WRGKK+MFVGDSLS N W SL CM+HA VP S+ T+ +++ L+ VTF++YGV
Sbjct  123  NGLKFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTTHFKRDGLASVTFQDYGV  182

Query  528  TLYLYHTTYLVDIVKE  575
             + LY TTYLVD+V E
Sbjct  183  QILLYRTTYLVDLVNE  198



>gb|AFW76573.1| putative DUF231 domain containing family protein [Zea mays]
Length=380

 Score =   179 bits (454),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKP-DSCDLPRFD  350
              C+LFRGRWV D SYPLY  S CPF+   FDC + GRPD  YLK+ W P ++C LPRFD
Sbjct  32   AACDLFRGRWVADKSYPLYDASACPFVPDVFDCRRNGRPDDAYLKFRWSPANNCQLPRFD  91

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS-KITYSRQETLSYVTFKEYGV  527
            G + L+RWRGK VMFVGDSLS+N W SLACM+HA+ P   + T++  E +S V F++Y +
Sbjct  92   GADFLRRWRGKTVMFVGDSLSMNQWVSLACMLHAAAPAPVRATFTSGEPVSAVRFEDYDL  151

Query  528  TLYLYHTTYLVDIVKE  575
            +L LYHTT+LVD+V+E
Sbjct  152  SLVLYHTTFLVDVVRE  167



>gb|EPS72531.1| hypothetical protein M569_02228, partial [Genlisea aurea]
Length=105

 Score =   171 bits (432),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  350
            S GC++F+G+WV DSSYPLY  S CPFIDPEFDCIKYGRPD+ YL+Y+WKPD+CD+PRFD
Sbjct  1    SAGCDVFQGKWVPDSSYPLYPSSGCPFIDPEFDCIKYGRPDRDYLQYSWKPDACDVPRFD  60

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSR  485
            G +LL+RW GKKVMFVGDSLSLN W SL CMIH S P SK    R
Sbjct  61   GVDLLRRWSGKKVMFVGDSLSLNQWESLGCMIHESSPGSKFAVVR  105



>emb|CDP15911.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 107/150 (71%), Gaps = 2/150 (1%)
 Frame = +3

Query  126  NVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYL  305
            N+S   S G   + S  GCN+FRG+WV D+ YPLY  ++CPFID EF+C+ Y RPDK YL
Sbjct  34   NISTTSSVGATMLAS--GCNIFRGKWVYDAQYPLYDYASCPFIDTEFNCLLYKRPDKLYL  91

Query  306  KYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSR  485
            KY W+P SC+LPRF+G   L++WRGK +MFVGDSLS NMW SL CMIH+  P ++ +   
Sbjct  92   KYRWQPFSCNLPRFNGLYFLEKWRGKNIMFVGDSLSFNMWASLGCMIHSWAPKARYSLIT  151

Query  486  QETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            +E LS + F +Y + + LY T YLVD+VKE
Sbjct  152  KEVLSEIAFLDYNIRILLYRTPYLVDMVKE  181



>ref|XP_010273481.1| PREDICTED: protein trichome birefringence-like 41 [Nelumbo nucifera]
Length=366

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +3

Query  177  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  356
            GC+LF+G WV D SYPLY  S CPFI+ EFDC   GRPDK YLKY WKP +CD+PRFDG 
Sbjct  43   GCDLFQGSWVYDDSYPLYNSSGCPFIEKEFDCQGNGRPDKLYLKYRWKPTTCDVPRFDGQ  102

Query  357  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLY  536
            + L+R++GK +MFVGDSLSLN W SL CM+H SVP S  T  R E LS  TF EY V + 
Sbjct  103  DFLRRYQGKSIMFVGDSLSLNQWQSLTCMLHKSVPKSNYTLVRTEGLSTFTFLEYNVKVM  162

Query  537  LYHTTYLVDIVKE  575
            L+   +LVDIV E
Sbjct  163  LFRNAFLVDIVGE  175



>gb|AFK49604.1| unknown [Lotus japonicus]
Length=367

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 109/177 (62%), Gaps = 7/177 (4%)
 Frame = +3

Query  54   MWSGVVIIAVL---LLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYP  224
            M S   I AVL   LL+Q HG      N    L+ G        GC+LF GRWV D SYP
Sbjct  3    MRSLTTISAVLFLALLIQIHGKDDHDVNYQKQLTAG----FGKSGCDLFEGRWVYDESYP  58

Query  225  LYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGD  404
            LY  S CPF + +FDC K GRPDK +LKY W+P  C+LPRF+G + L+R+RGK +MFVGD
Sbjct  59   LYDSSRCPFFEQQFDCQKNGRPDKFHLKYRWQPTGCNLPRFNGEDFLRRYRGKSIMFVGD  118

Query  405  SLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SLSLN W SL CM+H +VP ++ T  R   LS  TF  YGV L      YLVDIV E
Sbjct  119  SLSLNQWQSLTCMLHTAVPQAQYTLVRTGGLSIFTFTTYGVKLMFSRNAYLVDIVGE  175



>ref|XP_008649169.1| PREDICTED: protein trichome birefringence-like 38 [Zea mays]
Length=410

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKP-DSCDLPRFD  350
              C+LFRGRWV D SYPLY  S CPF+   FDC + GRPD  YLK+ W P ++C LPRFD
Sbjct  32   AACDLFRGRWVADKSYPLYDASACPFVPDVFDCRRNGRPDDAYLKFRWSPANNCQLPRFD  91

Query  351  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS-KITYSRQETLSYVTFKEYGV  527
            G + L+RWRGK VMFVGDSLS+N W SLACM+HA+ P   + T++  E +S V F++Y +
Sbjct  92   GADFLRRWRGKTVMFVGDSLSMNQWVSLACMLHAAAPAPVRATFTSGEPVSAVRFEDYDL  151

Query  528  TLYLYHTTYLVDIVKE  575
            +L LYHTT+LVD+V+E
Sbjct  152  SLVLYHTTFLVDVVRE  167



>emb|CDP06046.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 118/182 (65%), Gaps = 3/182 (2%)
 Frame = +3

Query  33   MGVGQ-KVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVV  209
            MG GQ + + + ++II + ++       A    +SH      + I  S GC++F+G W  
Sbjct  1    MGSGQFRSVNTFLLIICLFVIFVQQSSNALLLELSHNFKRSSESI--SSGCDIFQGSWSY  58

Query  210  DSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  389
            D +YPLY  S+CPFI+  FDC + GRPD+ YLK+ WKP+ C+LP+F+    L+++RGKK+
Sbjct  59   DDTYPLYNASSCPFIEKPFDCQRNGRPDQLYLKFKWKPNRCELPQFNAPHFLRKFRGKKI  118

Query  390  MFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIV  569
            +FVGDSLSLN W SL CM+HA++P S     ++  LS  TF+EY V+L L    +LVD+V
Sbjct  119  LFVGDSLSLNQWQSLTCMLHAALPQSNYNLQKKGNLSTFTFREYDVSLMLSRNAFLVDLV  178

Query  570  KE  575
            +E
Sbjct  179  EE  180



>gb|KJB67475.1| hypothetical protein B456_010G192400 [Gossypium raimondii]
Length=365

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +3

Query  177  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  356
             CN+++G+WV D SYPLY  ++CPFI  EFDC+KYGRPD  YLKY W+P +C LPRF+G 
Sbjct  42   NCNMYQGKWVYDDSYPLYNSTDCPFIRKEFDCLKYGRPDHLYLKYRWQPTNCHLPRFNGE  101

Query  357  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYS--RQETLSYVTFKEYGVT  530
              LKR++GKK+MF+GDSLSLN+W SL CM+HA+VP S+I        T+S VTF++Y ++
Sbjct  102  YFLKRFKGKKIMFIGDSLSLNIWQSLICMLHAAVPNSRIIKQGLNNNTISAVTFQDYKIS  161

Query  531  LYLYHTTYLVDIVKE  575
            + L+H+ YLVD+ +E
Sbjct  162  VMLFHSLYLVDVDEE  176



>ref|XP_007022285.1| Trichome birefringence-like 38 [Theobroma cacao]
 gb|EOY13810.1| Trichome birefringence-like 38 [Theobroma cacao]
Length=367

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 10/174 (6%)
 Frame = +3

Query  60   SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  239
            +G VI + + L  G+G +  ++ V        ++  SS  CN+++GRWV D SYPLY  S
Sbjct  14   AGFVIFSCICLANGNGFQRQKSRVD------SRKQQSS--CNVYQGRWVYDESYPLYDSS  65

Query  240  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  419
             CPFI  EFDC KYGRPD  YLKY W+P +C LPRFDG +LL R+ GKK+MFVGDS+SLN
Sbjct  66   ACPFIRKEFDCHKYGRPDHLYLKYRWQPSNCQLPRFDGQDLLNRFMGKKIMFVGDSVSLN  125

Query  420  MWNSLACMIHASVPTSKITYSR--QETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             W SL C++HA+ P S I   +    ++S VTF++Y V++ L+H+ YLVD+ +E
Sbjct  126  HWQSLICLLHAAAPNSSIIRQQLNNNSISAVTFQDYEVSVMLFHSLYLVDVDEE  179



>gb|KHG02694.1| putative C7orf58 [Gossypium arboreum]
Length=365

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +3

Query  177  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  356
             CN+++G+WV D+SYPLY  ++CPFI  EFDC+KYGRPD  YLKY W+P +C LPRF+G 
Sbjct  42   NCNMYQGKWVYDNSYPLYNSTDCPFIRKEFDCLKYGRPDHLYLKYRWQPTNCHLPRFNGE  101

Query  357  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSR--QETLSYVTFKEYGVT  530
              LKR++GKK+MF+GDSLSLN+W SL CM+HA+VP S+I         +S VTF++Y ++
Sbjct  102  YFLKRFKGKKIMFIGDSLSLNIWQSLICMLHAAVPNSRIIKQELNNNNISAVTFQDYKIS  161

Query  531  LYLYHTTYLVDIVKE  575
            + L+H+ YLVD+ +E
Sbjct  162  VMLFHSLYLVDVDEE  176



>ref|XP_002437078.1| hypothetical protein SORBIDRAFT_10g020920 [Sorghum bicolor]
 gb|EER88445.1| hypothetical protein SORBIDRAFT_10g020920 [Sorghum bicolor]
Length=392

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
             GC+LFRGRWV D SYPLY  S CPF+   FDC + GRPD  YLK+ W P +C LPRFDG
Sbjct  46   AGCDLFRGRWVADKSYPLYDASTCPFVPDVFDCRRNGRPDDAYLKFRWSPANCRLPRFDG  105

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS-KITYSRQETLSYVTFKEYGVT  530
             + L+RWRGK VMFVGDSLS+N W SLACM+HA+     + T++  E +S V F++Y ++
Sbjct  106  ADFLRRWRGKTVMFVGDSLSMNQWVSLACMLHAAAAAPVRATFTSGEPVSSVRFEDYDLS  165

Query  531  LYLYHTTYLVDIVKE  575
            L LYHTT+LVD+V+E
Sbjct  166  LVLYHTTFLVDVVQE  180



>ref|XP_008437676.1| PREDICTED: protein trichome birefringence-like 38 [Cucumis melo]
Length=346

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            C+L+ G+W +DSSYP+Y  S CPFI  EFDCIKYGRPD+ YL + W+P  CDLPRFDG +
Sbjct  33   CDLYSGKWELDSSYPMYNSSECPFIRKEFDCIKYGRPDRLYLHFRWQPLHCDLPRFDGED  92

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYL  539
            LL+R+RGKK+MF+GDS+SLN W SL C++HA++P S I     +T   + FKEYG ++ L
Sbjct  93   LLERFRGKKIMFIGDSISLNQWQSLICLLHAALPNSTIVQQSNDTTRTIQFKEYGTSVML  152

Query  540  YHTTYLVDIVKE  575
            + + YLVDI +E
Sbjct  153  FLSHYLVDIEEE  164



>gb|KJB74418.1| hypothetical protein B456_011G293800 [Gossypium raimondii]
Length=354

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 105/139 (76%), Gaps = 3/139 (2%)
 Frame = +3

Query  168  SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  347
            ++G CN+++G+WV DSSYPLY  S CPFI  EF+C+KYGRPD  YLKY W+P  C+LPRF
Sbjct  28   ANGCCNVYKGKWVYDSSYPLYDTSACPFIHKEFNCLKYGRPDHLYLKYRWQPSKCNLPRF  87

Query  348  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSR---QETLSYVTFKE  518
            DG  LL+R +GKK+MF+GDS+S+N W SL CM+HA+VPT+    ++     T+S VTFK 
Sbjct  88   DGTHLLRRLKGKKIMFIGDSISINQWQSLLCMLHAAVPTTSGIITQDLHNHTVSTVTFKH  147

Query  519  YGVTLYLYHTTYLVDIVKE  575
            Y V++ L+ + YLVD+ KE
Sbjct  148  YKVSVMLFRSLYLVDVDKE  166



>ref|XP_009354272.1| PREDICTED: protein trichome birefringence-like 39 [Pyrus x bretschneideri]
Length=376

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +3

Query  171  SGGCNLFRGRWVVDSSY-PLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  347
            +G CN FRG WV D+S  P Y  S CPF+DP+FDC+KYGR D  +LKY W+P SC LPRF
Sbjct  53   AGKCNWFRGTWVYDASAKPSYYSSTCPFLDPQFDCLKYGRRDTAFLKYRWQPFSCALPRF  112

Query  348  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGV  527
            +G   L++WRGKK+MFVGDS+S N W SL CM+HA VP S+ +Y +  +LS VTF++YGV
Sbjct  113  NGLYFLEKWRGKKIMFVGDSMSFNQWVSLTCMLHAWVPNSRTSYVKTNSLSAVTFQDYGV  172

Query  528  TLYLYHTTYLVDIVKE  575
             + LY T YLVD+V E
Sbjct  173  QILLYRTPYLVDLVNE  188



>ref|XP_011080615.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=366

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            +   GCNL++G+WV D SYPL+  S CP I  EFDC+KYGRPD QYLKY W+PD CDLPR
Sbjct  37   IKQKGCNLYQGKWVYDESYPLFDSSKCPSIRKEFDCLKYGRPDHQYLKYRWQPDGCDLPR  96

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYG  524
            FDGG+ L+R +GKK+MFVGDS+S N W SL C++   VP S I+     T S V F+ YG
Sbjct  97   FDGGDFLRRVKGKKIMFVGDSVSSNHWQSLVCLLSQHVPGSNISRVTSNTTSTVVFQNYG  156

Query  525  VTLYLYHTTYLVDIVKE  575
            V++ ++ + YLVDI +E
Sbjct  157  VSVTMFLSHYLVDIEQE  173



>ref|XP_010272739.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=354

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            ++S GC+L++G WV+D S+PLY  ++CPFID EF+C KYGRPDKQYLKY WKP  CDLPR
Sbjct  32   LASSGCDLYQGSWVLDDSFPLYDTASCPFIDSEFNCQKYGRPDKQYLKYRWKPTGCDLPR  91

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYG  524
            F+  + L+R++GKK+MFVGDSLSLN W SL CM+HA+VP +  T   ++     T  +YG
Sbjct  92   FNAVDFLRRFKGKKIMFVGDSLSLNQWQSLICMLHAAVPQANYTLVNRQIF---TLPDYG  148

Query  525  VTLYLYHTTYLVDIVKE  575
            V++ L    YLVDIV E
Sbjct  149  VSVILSRNEYLVDIVPE  165



>gb|EMS68140.1| hypothetical protein TRIUR3_18149 [Triticum urartu]
Length=197

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CN+F+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRFDG +
Sbjct  70   CNMFQGSWVYDEAMPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFDGRD  129

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGV  527
            LL RW+GKKV+FVGDS+SLN W SL CM+HA+ P S+ +YSR   +S VTF+   V
Sbjct  130  LLSRWKGKKVLFVGDSISLNQWESLVCMLHAAAPASRTSYSRGNPVSTVTFQVRAV  185



>ref|XP_003599941.1| hypothetical protein MTR_3g049330 [Medicago truncatula]
 gb|AES70192.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=351

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 104/170 (61%), Gaps = 15/170 (9%)
 Frame = +3

Query  66   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  245
            V +I VLL++  HG                    +  GC+LF+G+WV D SYPLYQ S C
Sbjct  8    VSLIHVLLMIHVHGKTIG---------------FAKSGCDLFQGKWVYDESYPLYQTSQC  52

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFI+ EFDC   GRPDK YLKY W+P  CDLPRF+G + L+R+RGK ++FVGDSLSLN W
Sbjct  53   PFIEKEFDCQNNGRPDKFYLKYRWQPTKCDLPRFNGEDFLRRYRGKSILFVGDSLSLNQW  112

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SL CM+H +VP +  T  R   LS  TF  YGV +      +LVDI  E
Sbjct  113  QSLTCMLHIAVPQAHYTLVRIGDLSIFTFTTYGVKVMFSRNAFLVDIFSE  162



>gb|KHN13696.1| hypothetical protein glysoja_034006 [Glycine soja]
Length=364

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 114/173 (66%), Gaps = 5/173 (3%)
 Frame = +3

Query  63   GVVIIAVLLLVQGHGGRAAQNNVSHLLSW--GGKEIVSSGGCNLFRGRWVVDSSYPLYQP  236
            GV+ +  LL V   GG     +V     W    +E      CN++ GRW +D SYPLY  
Sbjct  7    GVICLCQLLCVVNTGGGG---HVKSNFKWQRSQEEQEHELSCNMYEGRWELDDSYPLYDS  63

Query  237  SNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSL  416
            S CP I  EFDC+KYGRPD+QYLKY W+P+ CDLP FDG + L + +GK++MF+GDS+SL
Sbjct  64   STCPHIRKEFDCLKYGRPDQQYLKYRWQPNECDLPIFDGKDFLTKLKGKQIMFIGDSVSL  123

Query  417  NMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            N W SL C++ +SVP ++I       +S  TF++YGV++ ++H+TYLVDI +E
Sbjct  124  NQWQSLICLLRSSVPQTEILEQGDVNVSNYTFQDYGVSVIIFHSTYLVDIEEE  176



>ref|XP_010273288.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=367

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +3

Query  177  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  356
             C+L  G WV D SYPLY  S CPFI  EFDCIKYGRPD+ YL Y W+P  C+LPRFDG 
Sbjct  47   NCDLSEGSWVFDESYPLYNSSACPFIRKEFDCIKYGRPDRLYLHYRWQPHDCNLPRFDGE  106

Query  357  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLY  536
            E LKR++GKK+MF+GDS+SLN W SL CM+HA+ P + I    +++++  TF++Y V++ 
Sbjct  107  EFLKRFKGKKIMFIGDSISLNHWQSLVCMLHAAAPEAAILLETEDSITTFTFQKYDVSVM  166

Query  537  LYHTTYLVDIVKE  575
            L+++ YLVDI KE
Sbjct  167  LFNSQYLVDIEKE  179



>ref|XP_006591157.1| PREDICTED: protein YLS7-like [Glycine max]
Length=366

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 114/173 (66%), Gaps = 5/173 (3%)
 Frame = +3

Query  63   GVVIIAVLLLVQGHGGRAAQNNVSHLLSW--GGKEIVSSGGCNLFRGRWVVDSSYPLYQP  236
            GV+ +  LL V   GG     +V     W    +E      CN++ GRW +D SYPLY  
Sbjct  9    GVICLCQLLCVVNTGGGG---HVKSNFKWQRSQEEQEHELSCNMYEGRWELDDSYPLYDS  65

Query  237  SNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSL  416
            S CP I  EFDC+KYGRPD+QYLKY W+P+ CDLP FDG + L + +GK++MF+GDS+SL
Sbjct  66   STCPHIRKEFDCLKYGRPDQQYLKYRWQPNECDLPIFDGKDFLTKLKGKQIMFIGDSVSL  125

Query  417  NMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            N W SL C++ +SVP ++I       +S  TF++YGV++ ++H+TYLVDI +E
Sbjct  126  NQWQSLICLLRSSVPQTEILEQGDVNVSNYTFQDYGVSVIIFHSTYLVDIEEE  178



>ref|XP_010273483.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=365

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 111/170 (65%), Gaps = 12/170 (7%)
 Frame = +3

Query  66   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  245
            V+I A L      G     +NV         E ++S GC+ + G WV+D S+PLY  S+C
Sbjct  19   VLISAGLRQAMAEGEEDIGHNV---------EGLTSTGCDFYHGSWVLDDSFPLYDTSSC  69

Query  246  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  425
            PFID EFDC K GRPDKQYLKY WKP +CDLPRF+G + ++R++GKK+MFVGDSLSLN W
Sbjct  70   PFIDKEFDCQKNGRPDKQYLKYRWKPTACDLPRFNGEDFIRRFKGKKIMFVGDSLSLNQW  129

Query  426  NSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
             SL CM+HA+VP +K     ++     T  EYG+++ L    +LVDIV +
Sbjct  130  QSLICMLHAAVPQAKYNLVNRQAF---TLPEYGLSVMLSRNEFLVDIVSD  176



>ref|XP_010925980.1| PREDICTED: protein trichome birefringence-like 38 [Elaeis guineensis]
Length=339

 Score =   173 bits (438),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            +S   C+LF G WV D SYP Y   +CPF   EF+C++YGRPDK YLKY W P+ CDLPR
Sbjct  12   LSPAACDLFNGSWVYDESYPPYDSESCPFNRREFNCLRYGRPDKLYLKYRWSPNGCDLPR  71

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYG  524
            FDG +LL+RWRGKK+MFVGDSLSLN +NSL C+++ +VP  K   S   TL  V F++Y 
Sbjct  72   FDGRDLLERWRGKKIMFVGDSLSLNQYNSLLCLLYMAVPNQKTNSSDNGTLKTVIFEDYN  131

Query  525  VTLYLYHTTYLVDIVKE  575
            V++  Y + YLVDIV+E
Sbjct  132  VSVMFYPSHYLVDIVRE  148



>ref|XP_008811067.1| PREDICTED: protein trichome birefringence-like 37 [Phoenix dactylifera]
Length=183

 Score =   168 bits (426),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = +3

Query  75   IAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSG-GCNLFRGRWVVDSSYPLYQPSNCPF  251
            +A L  +       A  N  H     G+   S    C+ F+G WV D +YPLY  S+CPF
Sbjct  20   VASLHGITTERFHHANKNKQHNNGTAGRRDQSKRISCDFFQGSWVYDDTYPLYDSSSCPF  79

Query  252  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  431
            ++PEFDC K+GRPDK YLKY W P++CDLPRF+G + L+RWRGKK+MFVGDS+S N W S
Sbjct  80   VEPEFDCQKHGRPDKLYLKYRWMPNACDLPRFNGKDFLERWRGKKIMFVGDSISQNQWES  139

Query  432  LACMIHASVPTSKITYSRQETLSYVTFKEYGV  527
            LACM+HASVP ++ T++R +T   +TF+ + V
Sbjct  140  LACMLHASVPYARTTFTRSKTPWTLTFEMFVV  171



>ref|XP_010106402.1| hypothetical protein L484_008607 [Morus notabilis]
 gb|EXC10441.1| hypothetical protein L484_008607 [Morus notabilis]
Length=383

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 103/143 (72%), Gaps = 2/143 (1%)
 Frame = +3

Query  147  WGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPD  326
            W  K+ +    CN++ G WV D SYPLY+  +CPFI  EF+CIKYGRPD+ YLKY W+P+
Sbjct  49   WRSKQEIKR--CNMYNGSWVFDDSYPLYESLDCPFIRKEFNCIKYGRPDRLYLKYRWQPN  106

Query  327  SCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYV  506
             CDLPRFDG + LKR  GKK+MFVGDS+SLN W SL C++HASVP S IT     ++S  
Sbjct  107  DCDLPRFDGIDFLKRLEGKKIMFVGDSVSLNQWQSLLCLLHASVPHSNITQQNDGSVSSA  166

Query  507  TFKEYGVTLYLYHTTYLVDIVKE  575
             F++Y V + L+++ YL+DI +E
Sbjct  167  IFQDYEVYVSLFNSHYLIDIEEE  189



>ref|XP_010911005.1| PREDICTED: protein trichome birefringence-like 39, partial [Elaeis 
guineensis]
Length=167

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 100/138 (72%), Gaps = 3/138 (2%)
 Frame = +3

Query  102  HGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKY  281
            H  +  Q N     + G +++     C+ F+G WV D +YP+Y   +CPF++PEFDC KY
Sbjct  33   HKNKNKQQNNG---TAGRRDLTKRISCDFFQGSWVYDDTYPIYDSLSCPFVEPEFDCQKY  89

Query  282  GRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP  461
            GRPDK YLKY W+P++CDLPRF+G + L+RWRGKK+MFVGDS+S N W SLACM+HASVP
Sbjct  90   GRPDKLYLKYRWRPNACDLPRFNGLDFLERWRGKKIMFVGDSISQNQWESLACMLHASVP  149

Query  462  TSKITYSRQETLSYVTFK  515
             ++ T++R +T   +TF+
Sbjct  150  YARTTFTRSKTPWTLTFE  167



>ref|XP_010052993.1| PREDICTED: protein trichome birefringence-like 38 [Eucalyptus 
grandis]
 gb|KCW89680.1| hypothetical protein EUGRSUZ_A01950 [Eucalyptus grandis]
Length=362

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 110/170 (65%), Gaps = 9/170 (5%)
 Frame = +3

Query  66   VVIIAVLLLVQGHGGRAA--QNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  239
            V+ + ++ ++QG  G      NNV         E     GC++F+GRWV DSSYPLY   
Sbjct  7    VICVLLIFILQGVQGEDVDVHNNVE-------IEKHRKRGCDVFQGRWVYDSSYPLYNSF  59

Query  240  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  419
            NCPF++  FDC K GR D+ YLKY W+P SC+LPRF G   LK +RGK++MFVGDSLSLN
Sbjct  60   NCPFLEQAFDCQKNGRHDRSYLKYRWQPLSCNLPRFSGSNFLKNFRGKRIMFVGDSLSLN  119

Query  420  MWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIV  569
             W S  CM+HASVP +K  +SR   +S  TF  Y V++ L+ + +LVDI+
Sbjct  120  QWQSFTCMLHASVPEAKYAFSRTGGISTFTFPAYNVSIMLHRSAFLVDIL  169



>ref|XP_010670501.1| PREDICTED: protein trichome birefringence-like 38 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 113/176 (64%), Gaps = 6/176 (3%)
 Frame = +3

Query  66   VVIIAVLLLVQGHGGRAAQNNV------SHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPL  227
            +++I ++  +       A  NV       H+++   +  +    CN+F+G WV D+SYP+
Sbjct  11   LLLIGIMSAINSCLSHNATTNVVQNHQLDHVINKFLRPKLELKNCNIFKGHWVWDASYPM  70

Query  228  YQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDS  407
            Y  S CP I  EFDC+KYGRPDK YLKY W+PD CDLPRFDG + L R RGKK+M+VGDS
Sbjct  71   YDSSQCPSIRKEFDCLKYGRPDKFYLKYRWQPDDCDLPRFDGVDFLTRMRGKKIMYVGDS  130

Query  408  LSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            LSLN W SL C++HA+VP S I   +   +    F++Y V++ +Y ++YLVDI  E
Sbjct  131  LSLNNWQSLVCLLHAAVPNSNIIQQKTGDIKSWDFQDYDVSVMMYPSSYLVDIENE  186



>gb|KCW67609.1| hypothetical protein EUGRSUZ_F01364 [Eucalyptus grandis]
Length=537

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +3

Query  165  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  344
            ++SG CNL+ G W+ D SYP+Y+ SNCPFIDP FDC+K GR DK YLKY WKP  CDLPR
Sbjct  1    MASGNCNLYEGSWLFDDSYPIYEASNCPFIDPAFDCLKNGRTDKDYLKYRWKPSKCDLPR  60

Query  345  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYG  524
            FDG + L+R RGK ++FVGDSLS NMW SL CM+H++VP S     ++  LS  +F E+G
Sbjct  61   FDGRDFLERQRGKNILFVGDSLSKNMWQSLTCMLHSAVPESAYNLKQEGDLSDFSFLEFG  120

Query  525  VTLYLYHTTYLVDIVKE  575
            V++      +LVD V+E
Sbjct  121  VSVKWLKNNFLVDEVQE  137



>gb|EMT21950.1| hypothetical protein F775_18320 [Aegilops tauschii]
Length=422

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 104/166 (63%), Gaps = 34/166 (20%)
 Frame = +3

Query  180  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  359
            CN+F G W  D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRFDG +
Sbjct  70   CNMFHGSWGYDDALPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFDGRD  129

Query  360  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFK--------  515
            LL RW+GKKV+FVGDS+SLN W SL CM+HA+ P S+ +YSR   +S VTF+        
Sbjct  130  LLSRWKGKKVLFVGDSISLNQWESLVCMLHAAAPASRTSYSRGNPVSTVTFQIQQKVQRI  189

Query  516  --------------------------EYGVTLYLYHTTYLVDIVKE  575
                                      +YG+++  Y +TYLVDIV+E
Sbjct  190  TESRHFRSFGGIVGWRADHHKRITLEDYGLSVAYYRSTYLVDIVEE  235



>ref|XP_004499843.1| PREDICTED: uncharacterized protein LOC101491454 [Cicer arietinum]
Length=354

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  353
            G CNL+ G W++D SYPLY  S CP I  EF+C+KYGR DK+YLKY W+P +C+LPRFDG
Sbjct  33   GSCNLYEGSWLLDQSYPLYDSSTCPHIRMEFNCLKYGRVDKEYLKYRWQPSNCNLPRFDG  92

Query  354  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTL  533
               L ++RGKK+MF+GDS+SLN W S  C++H+SVP ++I     E ++ VTF +Y V++
Sbjct  93   KSFLTKYRGKKIMFIGDSVSLNQWQSFMCLLHSSVPEARIIEKGGEPITNVTFLDYDVSV  152

Query  534  YLYHTTYLVDIVKE  575
             ++HTT+LVDI  E
Sbjct  153  IVFHTTHLVDIEVE  166



>gb|KDO58610.1| hypothetical protein CISIN_1g018353mg [Citrus sinensis]
Length=304

 Score =   170 bits (430),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 108/175 (62%), Gaps = 14/175 (8%)
 Frame = +3

Query  51   VMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  230
            V  +G +++  L L +G               +G  E+ +   C++F+G+WV D  YPLY
Sbjct  4    VALAGTLLVVALFLHRG--------------VYGAYELKNDNKCDIFQGKWVYDPKYPLY  49

Query  231  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  410
              SNCPFI+ EFDC K GRPD  YLKY WKP SC LPRF GG  L+R+RGK+++FVGDS+
Sbjct  50   NASNCPFIEQEFDCRKNGRPDNMYLKYRWKPTSCKLPRFRGGVFLERFRGKRILFVGDSI  109

Query  411  SLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGVTLYLYHTTYLVDIVKE  575
            SLN W SL CM+H +VP +K T  R   LS  +F  + V++      +LVDIV E
Sbjct  110  SLNQWQSLTCMLHLAVPKAKYTLIRTGGLSTFSFPAHNVSVMFSRNAFLVDIVGE  164



>gb|AAC63839.1| unknown protein [Arabidopsis thaliana]
Length=164

 Score =   165 bits (417),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 103/154 (67%), Gaps = 4/154 (3%)
 Frame = +3

Query  84   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  263
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  14   LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  72

Query  264  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  443
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  73   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  132

Query  444  IHASVPTSKITYSRQETLSYVTFKEYGVTLYLYH  545
            +HAS+P +K +  R + L+ +TF+   V ++LY+
Sbjct  133  LHASLPNAKYSLRRSQPLTSLTFQ---VLIFLYN  163



>dbj|BAB02651.1| unnamed protein product [Arabidopsis thaliana]
Length=331

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = +3

Query  168  SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  347
            ++ GC++F GRWV D SYPLY  S CPFI  EF C + GRPD  Y  + W+P SC L RF
Sbjct  30   AAEGCDMFTGRWVKDDSYPLYNSSTCPFIRHEFSCQRNGRPDLDYSTFRWQPLSCKLARF  89

Query  348  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITYSRQETLSYVTFKEYGV  527
            +G + LK+ +GKK+MFVGDSLSLN W SLACM+H+SVP S  T + Q ++S  TFKEYG+
Sbjct  90   NGLQFLKKNKGKKIMFVGDSLSLNQWQSLACMLHSSVPNSTYTLTTQGSISTYTFKEYGL  149

Query  528  TLYLYHTTYLVDIVKE  575
             L L    YLVDIV+E
Sbjct  150  ELKLDRNVYLVDIVRE  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750