BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I15

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009782909.1|  PREDICTED: bifunctional monodehydroascorbate...    164   2e-46   Nicotiana sylvestris
ref|XP_009595413.1|  PREDICTED: bifunctional monodehydroascorbate...    162   1e-45   Nicotiana tomentosiformis
ref|XP_009621603.1|  PREDICTED: alpha carbonic anhydrase 7              157   2e-43   Nicotiana tomentosiformis
ref|XP_011090098.1|  PREDICTED: alpha carbonic anhydrase 7              155   5e-43   
ref|XP_009776894.1|  PREDICTED: bifunctional monodehydroascorbate...    153   3e-42   Nicotiana sylvestris
emb|CDP11563.1|  unnamed protein product                                152   2e-41   Coffea canephora [robusta coffee]
ref|XP_004242097.1|  PREDICTED: bifunctional monodehydroascorbate...    150   5e-41   Solanum lycopersicum
ref|XP_004251153.1|  PREDICTED: alpha carbonic anhydrase 7              150   8e-41   Solanum lycopersicum
ref|XP_009795833.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    148   2e-40   Nicotiana sylvestris
ref|XP_006340168.1|  PREDICTED: bifunctional monodehydroascorbate...    148   4e-40   Solanum tuberosum [potatoes]
ref|XP_006424534.1|  hypothetical protein CICLE_v10030314mg             148   4e-40   Citrus clementina [clementine]
ref|XP_006340169.1|  PREDICTED: bifunctional monodehydroascorbate...    148   5e-40   Solanum tuberosum [potatoes]
ref|XP_006365755.1|  PREDICTED: bifunctional monodehydroascorbate...    148   6e-40   
ref|XP_006488640.1|  PREDICTED: bifunctional monodehydroascorbate...    147   2e-39   Citrus sinensis [apfelsine]
gb|KDO73355.1|  hypothetical protein CISIN_1g046862mg                   147   2e-39   Citrus sinensis [apfelsine]
ref|XP_007016796.1|  Alpha carbonic anhydrase 7                         146   2e-39   Theobroma cacao [chocolate]
ref|XP_006424533.1|  hypothetical protein CICLE_v10029790mg             146   3e-39   Citrus clementina [clementine]
gb|KJB83847.1|  hypothetical protein B456_013G267400                    145   8e-39   Gossypium raimondii
gb|KDO73356.1|  hypothetical protein CISIN_1g039445mg                   144   1e-38   Citrus sinensis [apfelsine]
emb|CDP07086.1|  unnamed protein product                                144   2e-38   Coffea canephora [robusta coffee]
gb|KDP44024.1|  hypothetical protein JCGZ_05491                         144   2e-38   Jatropha curcas
ref|XP_006384924.1|  hypothetical protein POPTR_0004s22280g             144   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011044411.1|  PREDICTED: alpha carbonic anhydrase 7-like         143   3e-38   Populus euphratica
ref|XP_006488639.1|  PREDICTED: bifunctional monodehydroascorbate...    143   4e-38   Citrus sinensis [apfelsine]
ref|XP_004160913.1|  PREDICTED: bifunctional monodehydroascorbate...    142   7e-38   
ref|XP_004139554.1|  PREDICTED: bifunctional monodehydroascorbate...    142   8e-38   Cucumis sativus [cucumbers]
ref|XP_011040911.1|  PREDICTED: alpha carbonic anhydrase 7-like         142   9e-38   Populus euphratica
sp|Q84UV8.1|NEC3_NICLS  RecName: Full=Bifunctional monodehydroasc...    142   1e-37   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_008464591.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    142   1e-37   
ref|XP_011090042.1|  PREDICTED: alpha carbonic anhydrase 7-like         142   1e-37   Sesamum indicum [beniseed]
ref|XP_008462774.1|  PREDICTED: bifunctional monodehydroascorbate...    140   5e-37   
ref|XP_011459370.1|  PREDICTED: alpha carbonic anhydrase 7              140   5e-37   Fragaria vesca subsp. vesca
ref|XP_004506042.1|  PREDICTED: bifunctional monodehydroascorbate...    140   7e-37   Cicer arietinum [garbanzo]
ref|XP_010043780.1|  PREDICTED: alpha carbonic anhydrase 7-like         140   7e-37   Eucalyptus grandis [rose gum]
ref|XP_009367040.1|  PREDICTED: alpha carbonic anhydrase 7-like         139   9e-37   Pyrus x bretschneideri [bai li]
ref|XP_008359452.1|  PREDICTED: bifunctional monodehydroascorbate...    139   2e-36   
gb|KJB56186.1|  hypothetical protein B456_009G109100                    138   3e-36   Gossypium raimondii
ref|XP_008462808.1|  PREDICTED: bifunctional monodehydroascorbate...    138   3e-36   Cucumis melo [Oriental melon]
ref|XP_010046439.1|  PREDICTED: alpha carbonic anhydrase 7-like         138   4e-36   Eucalyptus grandis [rose gum]
ref|XP_007016793.1|  Alpha carbonic anhydrase 7                         137   6e-36   
ref|XP_004139442.1|  PREDICTED: bifunctional monodehydroascorbate...    137   6e-36   Cucumis sativus [cucumbers]
ref|XP_003541987.1|  PREDICTED: bifunctional monodehydroascorbate...    137   7e-36   Glycine max [soybeans]
ref|XP_010109502.1|  hypothetical protein L484_007522                   137   8e-36   Morus notabilis
gb|KJB56185.1|  hypothetical protein B456_009G109000                    137   9e-36   Gossypium raimondii
ref|XP_010050504.1|  PREDICTED: alpha carbonic anhydrase 7-like         136   2e-35   Eucalyptus grandis [rose gum]
ref|XP_010262876.1|  PREDICTED: alpha carbonic anhydrase 7-like         136   3e-35   
ref|XP_004139553.1|  PREDICTED: bifunctional monodehydroascorbate...    135   4e-35   
gb|KDP44023.1|  hypothetical protein JCGZ_05490                         135   4e-35   Jatropha curcas
gb|KGN64826.1|  hypothetical protein Csa_1G120420                       135   5e-35   Cucumis sativus [cucumbers]
ref|XP_008810946.1|  PREDICTED: alpha carbonic anhydrase 7-like         135   6e-35   Phoenix dactylifera
gb|KHG27075.1|  Bifunctional monodehydroascorbate reductase and c...    134   8e-35   Gossypium arboreum [tree cotton]
ref|XP_009356885.1|  PREDICTED: alpha carbonic anhydrase 7-like         134   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_008462817.1|  PREDICTED: bifunctional monodehydroascorbate...    134   1e-34   Cucumis melo [Oriental melon]
ref|XP_008462825.1|  PREDICTED: bifunctional monodehydroascorbate...    134   1e-34   Cucumis melo [Oriental melon]
ref|XP_010109499.1|  hypothetical protein L484_007519                   134   2e-34   Morus notabilis
ref|XP_010050537.1|  PREDICTED: alpha carbonic anhydrase 7-like         134   2e-34   Eucalyptus grandis [rose gum]
ref|XP_008385339.1|  PREDICTED: bifunctional monodehydroascorbate...    133   2e-34   Malus domestica [apple tree]
ref|XP_004160914.1|  PREDICTED: bifunctional monodehydroascorbate...    133   2e-34   
ref|XP_006594167.1|  PREDICTED: bifunctional monodehydroascorbate...    133   3e-34   Glycine max [soybeans]
ref|XP_002282495.2|  PREDICTED: alpha carbonic anhydrase 7              132   4e-34   Vitis vinifera
ref|XP_002529418.1|  carbonic anhydrase, putative                       132   6e-34   Ricinus communis
ref|XP_004515925.1|  PREDICTED: bifunctional monodehydroascorbate...    132   7e-34   Cicer arietinum [garbanzo]
ref|XP_008227263.1|  PREDICTED: bifunctional monodehydroascorbate...    132   7e-34   Prunus mume [ume]
emb|CDX95097.1|  BnaC05g05740D                                          132   8e-34   
gb|KHN39018.1|  Bifunctional monodehydroascorbate reductase and c...    132   8e-34   Glycine soja [wild soybean]
ref|XP_006417733.1|  hypothetical protein EUTSA_v10008451mg             132   9e-34   Eutrema salsugineum [saltwater cress]
gb|KGN64825.1|  hypothetical protein Csa_1G120410                       131   9e-34   Cucumis sativus [cucumbers]
ref|XP_003535188.1|  PREDICTED: bifunctional monodehydroascorbate...    132   9e-34   Glycine max [soybeans]
ref|XP_008227262.1|  PREDICTED: bifunctional monodehydroascorbate...    132   1e-33   Prunus mume [ume]
ref|XP_007206520.1|  hypothetical protein PRUPE_ppa019410mg             131   2e-33   Prunus persica
ref|XP_010443286.1|  PREDICTED: alpha carbonic anhydrase 8-like         132   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009391366.1|  PREDICTED: alpha carbonic anhydrase 7-like         131   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK43123.1|  hypothetical protein AALP_AA1G083400                    131   2e-33   Arabis alpina [alpine rockcress]
ref|XP_010458030.1|  PREDICTED: alpha carbonic anhydrase 5              130   2e-33   Camelina sativa [gold-of-pleasure]
gb|KEH16352.1|  eukaryotic-type carbonic anhydrase                      130   2e-33   Medicago truncatula
ref|XP_010458032.1|  PREDICTED: alpha carbonic anhydrase 7              130   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004506040.1|  PREDICTED: bifunctional monodehydroascorbate...    130   3e-33   Cicer arietinum [garbanzo]
ref|XP_007144378.1|  hypothetical protein PHAVU_007G151300g             130   3e-33   Phaseolus vulgaris [French bean]
gb|ACU22677.1|  unknown                                                 128   3e-33   Glycine max [soybeans]
ref|XP_010488317.1|  PREDICTED: alpha carbonic anhydrase 5              130   4e-33   Camelina sativa [gold-of-pleasure]
gb|KHN48240.1|  Bifunctional monodehydroascorbate reductase and c...    130   4e-33   Glycine soja [wild soybean]
ref|XP_006845947.1|  hypothetical protein AMTR_s00157p00092470          129   4e-33   
ref|XP_006304810.1|  hypothetical protein CARUB_v10012428mg             130   4e-33   
ref|XP_008442725.1|  PREDICTED: bifunctional monodehydroascorbate...    130   5e-33   Cucumis melo [Oriental melon]
ref|XP_009132759.1|  PREDICTED: alpha carbonic anhydrase 2-like         129   5e-33   Brassica rapa
ref|XP_010488326.1|  PREDICTED: alpha carbonic anhydrase 7              129   6e-33   Camelina sativa [gold-of-pleasure]
gb|KDO81077.1|  hypothetical protein CISIN_1g038655mg                   129   7e-33   Citrus sinensis [apfelsine]
ref|XP_006409842.1|  hypothetical protein EUTSA_v10017075mg             129   7e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006473002.1|  PREDICTED: bifunctional monodehydroascorbate...    129   7e-33   Citrus sinensis [apfelsine]
ref|XP_010414580.1|  PREDICTED: alpha carbonic anhydrase 2-like         129   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008462835.1|  PREDICTED: bifunctional monodehydroascorbate...    129   1e-32   
ref|XP_006433902.1|  hypothetical protein CICLE_v10003227mg             129   1e-32   
ref|XP_006281537.1|  hypothetical protein CARUB_v10027638mg             129   1e-32   
ref|XP_003539200.1|  PREDICTED: bifunctional monodehydroascorbate...    128   2e-32   Glycine max [soybeans]
ref|XP_003538184.1|  PREDICTED: bifunctional monodehydroascorbate...    128   2e-32   Glycine max [soybeans]
gb|KHN38743.1|  Bifunctional monodehydroascorbate reductase and c...    128   2e-32   Glycine soja [wild soybean]
ref|NP_172285.2|  alpha carbonic anhydrase 5                            128   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044414.1|  PREDICTED: LOW QUALITY PROTEIN: alpha carbon...    127   2e-32   Populus euphratica
gb|KGN59000.1|  hypothetical protein Csa_3G742880                       128   2e-32   Cucumis sativus [cucumbers]
ref|XP_009113037.1|  PREDICTED: alpha carbonic anhydrase 2-like         127   3e-32   Brassica rapa
ref|XP_002314288.2|  hypothetical protein POPTR_0009s01540g             128   3e-32   
emb|CDY45963.1|  BnaA09g13030D                                          127   3e-32   Brassica napus [oilseed rape]
ref|XP_006296034.1|  hypothetical protein CARUB_v10025180mg             127   3e-32   
ref|XP_010470128.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    127   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_007203913.1|  hypothetical protein PRUPE_ppa016859mg             129   3e-32   
ref|XP_002529419.1|  carbonic anhydrase, putative                       127   4e-32   Ricinus communis
ref|XP_009148063.1|  PREDICTED: alpha carbonic anhydrase 5              127   4e-32   Brassica rapa
emb|CDY45480.1|  BnaC09g12980D                                          127   4e-32   Brassica napus [oilseed rape]
ref|XP_008241384.1|  PREDICTED: bifunctional monodehydroascorbate...    127   4e-32   Prunus mume [ume]
ref|XP_002892434.1|  carbonic anhydrase family protein                  127   5e-32   Arabidopsis lyrata subsp. lyrata
emb|CDX93595.1|  BnaA06g04530D                                          127   5e-32   
ref|XP_010510673.1|  PREDICTED: alpha carbonic anhydrase 2-like         127   5e-32   Camelina sativa [gold-of-pleasure]
gb|KJB16757.1|  hypothetical protein B456_002G246000                    128   5e-32   Gossypium raimondii
ref|XP_008226047.1|  PREDICTED: bifunctional monodehydroascorbate...    127   5e-32   Prunus mume [ume]
ref|XP_010450977.1|  PREDICTED: alpha carbonic anhydrase 8              128   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010696305.1|  PREDICTED: alpha carbonic anhydrase 7-like         127   6e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002892432.1|  carbonate dehydratase/ zinc ion binding protein    127   6e-32   
ref|XP_009400916.1|  PREDICTED: alpha carbonic anhydrase 7-like         127   7e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009103655.1|  PREDICTED: alpha carbonic anhydrase 2              126   8e-32   Brassica rapa
ref|XP_010521744.1|  PREDICTED: alpha carbonic anhydrase 7-like         126   8e-32   Tarenaya hassleriana [spider flower]
ref|XP_010272832.1|  PREDICTED: alpha carbonic anhydrase 7-like         126   8e-32   Nelumbo nucifera [Indian lotus]
gb|KHG14539.1|  Bifunctional monodehydroascorbate reductase and c...    127   9e-32   Gossypium arboreum [tree cotton]
ref|XP_010475597.1|  PREDICTED: alpha carbonic anhydrase 5-like         126   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006303231.1|  hypothetical protein CARUB_v10012300mg             126   1e-31   Capsella rubella
ref|XP_009148224.1|  PREDICTED: alpha carbonic anhydrase 7-like         126   1e-31   Brassica rapa
ref|XP_002864450.1|  hypothetical protein ARALYDRAFT_331944             127   1e-31   
ref|XP_010475599.1|  PREDICTED: alpha carbonic anhydrase 7-like         126   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009399717.1|  PREDICTED: alpha carbonic anhydrase 7-like         126   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY04545.1|  BnaA07g13710D                                          125   2e-31   
ref|XP_008362138.1|  PREDICTED: bifunctional monodehydroascorbate...    125   2e-31   
ref|XP_002268233.1|  PREDICTED: alpha carbonic anhydrase 7              125   3e-31   Vitis vinifera
emb|CDX95095.1|  BnaC05g05760D                                          125   3e-31   
ref|XP_007150177.1|  hypothetical protein PHAVU_005G133000g             124   4e-31   Phaseolus vulgaris [French bean]
ref|XP_010241820.1|  PREDICTED: alpha carbonic anhydrase 7-like         125   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_011468146.1|  PREDICTED: alpha carbonic anhydrase 7-like         125   4e-31   Fragaria vesca subsp. vesca
gb|AFK33933.1|  unknown                                                 124   5e-31   Medicago truncatula
ref|NP_172287.1|  alpha carbonic anhydrase 7                            124   5e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KEH42158.1|  eukaryotic-type carbonic anhydrase                      124   5e-31   Medicago truncatula
emb|CDY23976.1|  BnaC03g17150D                                          124   5e-31   Brassica napus [oilseed rape]
ref|XP_006339307.1|  PREDICTED: bifunctional monodehydroascorbate...    123   6e-31   
sp|Q9FM99.2|ATCA8_ARATH  RecName: Full=Alpha carbonic anhydrase 8...    124   6e-31   
ref|NP_200444.1|  alpha carbonic anhydrase 8                            125   6e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43125.1|  hypothetical protein AALP_AA1G083600                    124   7e-31   Arabis alpina [alpine rockcress]
gb|KCW89335.1|  hypothetical protein EUGRSUZ_A01626                     123   7e-31   Eucalyptus grandis [rose gum]
ref|XP_010050514.1|  PREDICTED: alpha carbonic anhydrase 7-like         124   1e-30   Eucalyptus grandis [rose gum]
ref|XP_002519458.1|  carbonic anhydrase, putative                       123   1e-30   Ricinus communis
gb|KDP26093.1|  hypothetical protein JCGZ_21126                         123   1e-30   Jatropha curcas
gb|KEH42156.1|  eukaryotic-type carbonic anhydrase                      124   1e-30   Medicago truncatula
ref|XP_010050524.1|  PREDICTED: alpha carbonic anhydrase 7-like         124   1e-30   Eucalyptus grandis [rose gum]
ref|XP_008802055.1|  PREDICTED: alpha carbonic anhydrase 7-like         123   1e-30   Phoenix dactylifera
gb|KFK32339.1|  hypothetical protein AALP_AA6G228800                    123   2e-30   Arabis alpina [alpine rockcress]
ref|XP_004168624.1|  PREDICTED: bifunctional monodehydroascorbate...    123   2e-30   
ref|XP_004249474.1|  PREDICTED: alpha carbonic anhydrase 7-like         123   2e-30   Solanum lycopersicum
gb|ABK22387.1|  unknown                                                 123   2e-30   Picea sitchensis
ref|XP_010916592.1|  PREDICTED: alpha carbonic anhydrase 7-like         122   2e-30   Elaeis guineensis
gb|KCW47834.1|  hypothetical protein EUGRSUZ_K01571                     122   3e-30   Eucalyptus grandis [rose gum]
ref|XP_004241280.1|  PREDICTED: bifunctional monodehydroascorbate...    122   3e-30   Solanum lycopersicum
ref|XP_010322405.1|  PREDICTED: bifunctional monodehydroascorbate...    122   3e-30   Solanum lycopersicum
ref|XP_010036307.1|  PREDICTED: alpha carbonic anhydrase 4-like         122   4e-30   Eucalyptus grandis [rose gum]
ref|XP_004166480.1|  PREDICTED: bifunctional monodehydroascorbate...    121   4e-30   
gb|KJB62357.1|  hypothetical protein B456_009G413500                    120   4e-30   Gossypium raimondii
ref|XP_010696309.1|  PREDICTED: alpha carbonic anhydrase 7-like         122   4e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009148066.1|  PREDICTED: alpha carbonic anhydrase 7-like         122   4e-30   Brassica rapa
gb|AFK36418.1|  unknown                                                 122   5e-30   Lotus japonicus
ref|XP_004242096.1|  PREDICTED: bifunctional monodehydroascorbate...    121   5e-30   
ref|XP_010090219.1|  hypothetical protein L484_016558                   121   5e-30   
ref|XP_011094588.1|  PREDICTED: alpha carbonic anhydrase 7-like         122   5e-30   Sesamum indicum [beniseed]
ref|XP_010267256.1|  PREDICTED: alpha carbonic anhydrase 7-like         122   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_004139552.1|  PREDICTED: bifunctional monodehydroascorbate...    121   6e-30   
ref|XP_011018803.1|  PREDICTED: alpha carbonic anhydrase 7-like         121   7e-30   Populus euphratica
ref|XP_010098808.1|  hypothetical protein L484_022573                   121   7e-30   Morus notabilis
gb|EMT10084.1|  hypothetical protein F775_43115                         121   9e-30   
gb|KJB62360.1|  hypothetical protein B456_009G413500                    120   9e-30   Gossypium raimondii
ref|XP_010050530.1|  PREDICTED: alpha carbonic anhydrase 7-like         121   9e-30   Eucalyptus grandis [rose gum]
emb|CDX93593.1|  BnaA06g04550D                                          124   9e-30   
gb|KEH24050.1|  eukaryotic-type carbonic anhydrase                      121   9e-30   Medicago truncatula
ref|XP_011033188.1|  PREDICTED: alpha carbonic anhydrase 4-like         122   1e-29   Populus euphratica
ref|XP_004143278.1|  PREDICTED: bifunctional monodehydroascorbate...    120   1e-29   Cucumis sativus [cucumbers]
emb|CDX84811.1|  BnaA03g14190D                                          120   1e-29   
ref|XP_006381381.1|  hypothetical protein POPTR_0006s12380g             120   2e-29   
ref|XP_010269790.1|  PREDICTED: alpha carbonic anhydrase 4-like         120   2e-29   Nelumbo nucifera [Indian lotus]
gb|KJB62359.1|  hypothetical protein B456_009G413500                    120   2e-29   Gossypium raimondii
ref|XP_009380700.1|  PREDICTED: alpha carbonic anhydrase 7-like         120   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007027464.1|  Alpha carbonic anhydrase 7 isoform 2               119   2e-29   
ref|XP_008227264.1|  PREDICTED: bifunctional monodehydroascorbate...    120   2e-29   Prunus mume [ume]
ref|XP_011077301.1|  PREDICTED: alpha carbonic anhydrase 7-like         120   3e-29   Sesamum indicum [beniseed]
sp|F4IHR4.2|ATCA2_ARATH  RecName: Full=Alpha carbonic anhydrase 2...    119   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007213463.1|  hypothetical protein PRUPE_ppa024299mg             119   4e-29   Prunus persica
ref|XP_010916593.1|  PREDICTED: alpha carbonic anhydrase 7-like         119   4e-29   Elaeis guineensis
ref|XP_004172039.1|  PREDICTED: bifunctional monodehydroascorbate...    119   5e-29   
ref|XP_004300792.1|  PREDICTED: alpha carbonic anhydrase 7-like         119   5e-29   Fragaria vesca subsp. vesca
ref|XP_010279581.1|  PREDICTED: alpha carbonic anhydrase 4-like         119   5e-29   Nelumbo nucifera [Indian lotus]
ref|XP_007027463.1|  Alpha carbonic anhydrase 7 isoform 1               119   6e-29   
ref|XP_010036663.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    119   6e-29   Eucalyptus grandis [rose gum]
ref|XP_006339092.1|  PREDICTED: bifunctional monodehydroascorbate...    119   6e-29   Solanum tuberosum [potatoes]
ref|XP_010558882.1|  PREDICTED: alpha carbonic anhydrase 7-like         119   6e-29   
ref|XP_008443579.1|  PREDICTED: bifunctional monodehydroascorbate...    119   7e-29   Cucumis melo [Oriental melon]
ref|XP_008227274.1|  PREDICTED: bifunctional monodehydroascorbate...    119   7e-29   Prunus mume [ume]
ref|XP_004304476.1|  PREDICTED: alpha carbonic anhydrase 7-like         119   7e-29   Fragaria vesca subsp. vesca
ref|XP_004137981.1|  PREDICTED: bifunctional monodehydroascorbate...    120   7e-29   
gb|KHG29611.1|  Bifunctional monodehydroascorbate reductase and c...    119   8e-29   Gossypium arboreum [tree cotton]
ref|XP_002323272.2|  hypothetical protein POPTR_0016s04300g             119   9e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010036662.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    118   1e-28   Eucalyptus grandis [rose gum]
ref|XP_008383977.1|  PREDICTED: bifunctional monodehydroascorbate...    119   1e-28   
gb|KGN58999.1|  hypothetical protein Csa_3G742870                       118   1e-28   Cucumis sativus [cucumbers]
emb|CDY27409.1|  BnaC03g64490D                                          118   1e-28   Brassica napus [oilseed rape]
ref|XP_008778933.1|  PREDICTED: alpha carbonic anhydrase 7-like         118   1e-28   Phoenix dactylifera
ref|XP_002529417.1|  carbonic anhydrase, putative                       117   1e-28   
ref|XP_004168623.1|  PREDICTED: bifunctional monodehydroascorbate...    118   1e-28   
gb|EYU38572.1|  hypothetical protein MIMGU_mgv1a011717mg                118   1e-28   Erythranthe guttata [common monkey flower]
gb|KHG05281.1|  Bifunctional monodehydroascorbate reductase and c...    118   1e-28   Gossypium arboreum [tree cotton]
ref|XP_009592985.1|  PREDICTED: alpha carbonic anhydrase 7-like         118   1e-28   Nicotiana tomentosiformis
ref|XP_006401345.1|  hypothetical protein EUTSA_v10014359mg             118   1e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010439535.1|  PREDICTED: alpha carbonic anhydrase 4              117   2e-28   Camelina sativa [gold-of-pleasure]
gb|EMT00558.1|  Bifunctional monodehydroascorbate reductase and c...    118   2e-28   
ref|XP_008464600.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    118   2e-28   
ref|XP_008351630.1|  PREDICTED: bifunctional monodehydroascorbate...    118   2e-28   
ref|XP_010696307.1|  PREDICTED: alpha carbonic anhydrase 7-like         117   2e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009358738.1|  PREDICTED: alpha carbonic anhydrase 4-like         118   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_008462491.1|  PREDICTED: bifunctional monodehydroascorbate...    117   3e-28   Cucumis melo [Oriental melon]
emb|CDX76404.1|  BnaA08g09960D                                          117   4e-28   
ref|XP_007132283.1|  hypothetical protein PHAVU_011G081900g             116   5e-28   Phaseolus vulgaris [French bean]
ref|XP_006417731.1|  hypothetical protein EUTSA_v10009315mg             116   5e-28   
ref|XP_010696308.1|  PREDICTED: alpha carbonic anhydrase 7-like         117   5e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009775004.1|  PREDICTED: alpha carbonic anhydrase 7-like         116   6e-28   Nicotiana sylvestris
dbj|BAD09855.1|  putative dioscorin class A precursor                   115   8e-28   Oryza sativa Japonica Group [Japonica rice]
gb|KJB35974.1|  hypothetical protein B456_006G135100                    116   8e-28   Gossypium raimondii
ref|XP_010470127.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    116   9e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004303634.1|  PREDICTED: alpha carbonic anhydrase 4-like         116   9e-28   Fragaria vesca subsp. vesca
ref|XP_010418826.1|  PREDICTED: alpha carbonic anhydrase 2-like         113   1e-27   
ref|XP_010434249.1|  PREDICTED: alpha carbonic anhydrase 4-like         115   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010451325.1|  PREDICTED: alpha carbonic anhydrase 4-like         115   1e-27   
gb|EYU41598.1|  hypothetical protein MIMGU_mgv1a011586mg                115   1e-27   Erythranthe guttata [common monkey flower]
ref|XP_006489872.1|  PREDICTED: bifunctional monodehydroascorbate...    115   1e-27   Citrus sinensis [apfelsine]
ref|XP_004494904.1|  PREDICTED: bifunctional monodehydroascorbate...    115   1e-27   
ref|XP_007028632.1|  Carbonic anhydrase, putative                       115   2e-27   
dbj|BAD09854.1|  putative dioscorin class A precursor                   115   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|KFK28694.1|  hypothetical protein AALP_AA7G034200                    115   2e-27   Arabis alpina [alpine rockcress]
ref|XP_003537009.2|  PREDICTED: bifunctional monodehydroascorbate...    115   2e-27   Glycine max [soybeans]
ref|XP_004973661.1|  PREDICTED: bifunctional monodehydroascorbate...    115   2e-27   Setaria italica
ref|XP_002880942.1|  hypothetical protein ARALYDRAFT_320571             114   3e-27   
ref|NP_180388.2|  alpha carbonic anhydrase 2                            112   4e-27   
gb|AAD29832.1|  putative carbonic anhydrase                             113   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EMT14743.1|  Bifunctional monodehydroascorbate reductase and c...    113   5e-27   
emb|CDP15287.1|  unnamed protein product                                114   5e-27   Coffea canephora [robusta coffee]
ref|XP_008360674.1|  PREDICTED: bifunctional monodehydroascorbate...    114   5e-27   
emb|CDX94018.1|  BnaC07g36520D                                          114   5e-27   
gb|KJB16758.1|  hypothetical protein B456_002G246100                    114   6e-27   Gossypium raimondii
gb|KHN39017.1|  Bifunctional monodehydroascorbate reductase and c...    114   6e-27   Glycine soja [wild soybean]
gb|AAF79837.1|AC026875_17  T6D22.16                                     113   7e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006577712.1|  PREDICTED: bifunctional monodehydroascorbate...    113   7e-27   Glycine max [soybeans]
gb|KHN18685.1|  Bifunctional monodehydroascorbate reductase and c...    113   7e-27   Glycine soja [wild soybean]
ref|XP_006413835.1|  hypothetical protein EUTSA_v10027157mg             113   7e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010510674.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    113   8e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009363226.1|  PREDICTED: alpha carbonic anhydrase 4-like         113   9e-27   Pyrus x bretschneideri [bai li]
ref|XP_004142716.1|  PREDICTED: bifunctional monodehydroascorbate...    113   1e-26   
ref|XP_008810960.1|  PREDICTED: alpha carbonic anhydrase 7-like         112   1e-26   
ref|XP_006421163.1|  hypothetical protein CICLE_v10005610mg             112   1e-26   Citrus clementina [clementine]
emb|CDY65169.1|  BnaC05g49130D                                          112   1e-26   Brassica napus [oilseed rape]
ref|XP_007162157.1|  hypothetical protein PHAVU_001G129100g             112   1e-26   Phaseolus vulgaris [French bean]
ref|XP_006845943.1|  hypothetical protein AMTR_s00157p00085110          112   1e-26   
ref|XP_006659489.1|  PREDICTED: bifunctional monodehydroascorbate...    112   1e-26   Oryza brachyantha
ref|XP_002445622.1|  hypothetical protein SORBIDRAFT_07g022860          112   1e-26   Sorghum bicolor [broomcorn]
ref|XP_010050605.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    113   2e-26   Eucalyptus grandis [rose gum]
ref|XP_009137160.1|  PREDICTED: alpha carbonic anhydrase 4-like         112   2e-26   Brassica rapa
ref|XP_003574630.1|  PREDICTED: alpha carbonic anhydrase 7-like         112   2e-26   Brachypodium distachyon [annual false brome]
ref|XP_008241449.1|  PREDICTED: bifunctional monodehydroascorbate...    112   2e-26   
ref|XP_002278815.1|  PREDICTED: alpha carbonic anhydrase 4-like         112   2e-26   Vitis vinifera
gb|EMT00557.1|  Bifunctional monodehydroascorbate reductase and c...    112   2e-26   
ref|XP_002532664.1|  carbonic anhydrase, putative                       112   2e-26   
ref|XP_011075357.1|  PREDICTED: alpha carbonic anhydrase 4-like         112   2e-26   Sesamum indicum [beniseed]
gb|KDO48229.1|  hypothetical protein CISIN_1g025618mg                   111   2e-26   Citrus sinensis [apfelsine]
ref|XP_008241448.1|  PREDICTED: bifunctional monodehydroascorbate...    112   3e-26   Prunus mume [ume]
ref|XP_010050600.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    112   3e-26   Eucalyptus grandis [rose gum]
gb|AAF79839.1|AC026875_19  T6D22.14                                     117   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002532665.1|  carbonic anhydrase, putative                       111   3e-26   Ricinus communis
emb|CDP14170.1|  unnamed protein product                                111   4e-26   Coffea canephora [robusta coffee]
ref|XP_004959504.1|  PREDICTED: bifunctional monodehydroascorbate...    111   5e-26   Setaria italica
ref|XP_006294831.1|  hypothetical protein CARUB_v10023883mg             110   5e-26   
ref|XP_002278828.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    110   7e-26   
emb|CAM59682.1|  a-type carbonic anhydrase                              110   7e-26   
emb|CBI33385.3|  unnamed protein product                                110   7e-26   
ref|XP_009377055.1|  PREDICTED: alpha carbonic anhydrase 4-like         111   8e-26   
gb|EMS54273.1|  Bifunctional monodehydroascorbate reductase and c...    111   8e-26   
ref|XP_009377054.1|  PREDICTED: alpha carbonic anhydrase 7-like         110   9e-26   
ref|XP_007028635.1|  Alpha carbonic anhydrase 4, putative               110   9e-26   
ref|XP_009599195.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    110   1e-25   
ref|XP_006292541.1|  hypothetical protein CARUB_v10018775mg             110   1e-25   
ref|NP_193831.1|  alpha carbonic anhydrase 4                            110   1e-25   
gb|EMS55408.1|  Bifunctional monodehydroascorbate reductase and c...    110   1e-25   
gb|KJB35976.1|  hypothetical protein B456_006G135300                    110   1e-25   
ref|XP_008364026.1|  PREDICTED: bifunctional monodehydroascorbate...    109   1e-25   
gb|EMT11024.1|  Bifunctional monodehydroascorbate reductase and c...    110   1e-25   
ref|XP_009770757.1|  PREDICTED: alpha carbonic anhydrase 4-like         110   1e-25   
ref|XP_006604587.1|  PREDICTED: bifunctional monodehydroascorbate...    110   1e-25   
ref|XP_007202419.1|  hypothetical protein PRUPE_ppa009714mg             110   2e-25   
ref|XP_003520661.2|  PREDICTED: bifunctional monodehydroascorbate...    109   2e-25   
ref|XP_010646590.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    109   2e-25   
ref|XP_010904591.1|  PREDICTED: alpha carbonic anhydrase 7-like         109   2e-25   
ref|XP_002869914.1|  carbonic anhydrase family protein                  108   2e-25   
ref|XP_010510675.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    108   3e-25   
ref|XP_011048097.1|  PREDICTED: alpha carbonic anhydrase 4-like         108   4e-25   
ref|XP_007028639.1|  Carbonic anhydrase, putative                       108   4e-25   
ref|XP_002869915.1|  carbonic anhydrase family protein                  108   4e-25   
gb|ACN85304.1|  unknown                                                 109   4e-25   
ref|XP_006391784.1|  hypothetical protein EUTSA_v10023909mg             108   4e-25   
gb|KHN02302.1|  Bifunctional monodehydroascorbate reductase and c...    109   5e-25   
ref|XP_007202870.1|  hypothetical protein PRUPE_ppa015691mg             108   5e-25   
gb|AFW61791.1|  hypothetical protein ZEAMMB73_990747                    107   6e-25   
ref|XP_003520509.1|  PREDICTED: bifunctional monodehydroascorbate...    108   6e-25   
ref|XP_010036660.1|  PREDICTED: alpha carbonic anhydrase 4-like         108   6e-25   
ref|XP_008244285.1|  PREDICTED: bifunctional monodehydroascorbate...    108   6e-25   
ref|XP_002308927.2|  hypothetical protein POPTR_0006s04600g             108   6e-25   
ref|XP_008241381.1|  PREDICTED: bifunctional monodehydroascorbate...    108   7e-25   
ref|XP_002445625.1|  hypothetical protein SORBIDRAFT_07g022890          108   8e-25   
gb|EMS63276.1|  Bifunctional monodehydroascorbate reductase and c...    108   9e-25   
ref|NP_001175619.1|  Os08g0470700                                       106   9e-25   
ref|XP_002445628.1|  hypothetical protein SORBIDRAFT_07g022910          107   9e-25   
ref|XP_010555357.1|  PREDICTED: alpha carbonic anhydrase 4              107   1e-24   
ref|XP_008241447.1|  PREDICTED: bifunctional monodehydroascorbate...    107   1e-24   
ref|NP_001147028.1|  carbonic anhydrase precursor                       107   1e-24   
ref|XP_008241380.1|  PREDICTED: bifunctional monodehydroascorbate...    107   1e-24   
dbj|BAK03530.1|  predicted protein                                      107   1e-24   
gb|ADW27480.1|  carbonic anhydrase                                      107   1e-24   
gb|EEC83601.1|  hypothetical protein OsI_29288                          107   1e-24   
ref|NP_001061831.1|  Os08g0423500                                       107   1e-24   
gb|EAZ07037.1|  hypothetical protein OsI_29284                          107   2e-24   
ref|XP_008231952.1|  PREDICTED: bifunctional monodehydroascorbate...    107   2e-24   
ref|XP_006301790.1|  hypothetical protein CARUB_v10022254mg             107   2e-24   
dbj|BAC99799.1|  putative dioscorin                                     107   2e-24   
ref|XP_007144381.1|  hypothetical protein PHAVU_007G151500g             107   2e-24   
gb|EEE68706.1|  hypothetical protein OsJ_27361                          107   2e-24   
gb|AFK49331.1|  unknown                                                 105   2e-24   
ref|XP_007144380.1|  hypothetical protein PHAVU_007G151500g             106   3e-24   
ref|XP_008677173.1|  PREDICTED: carbonic anhydrase isoform X1           107   3e-24   
ref|NP_193832.1|  alpha carbonic anhydrase 6                            106   3e-24   
dbj|BAD09858.1|  putative dioscorin class A precursor                   106   3e-24   
ref|XP_009349746.1|  PREDICTED: alpha carbonic anhydrase 6-like         104   4e-24   
ref|XP_011015541.1|  PREDICTED: alpha carbonic anhydrase 4-like         105   4e-24   
ref|XP_008387558.1|  PREDICTED: bifunctional monodehydroascorbate...    106   5e-24   
dbj|BAK01826.1|  predicted protein                                      105   5e-24   
ref|XP_011048125.1|  PREDICTED: alpha carbonic anhydrase 4-like         106   5e-24   
ref|XP_010098809.1|  hypothetical protein L484_022574                   105   5e-24   
gb|EMS68433.1|  hypothetical protein TRIUR3_33908                       105   5e-24   
ref|XP_004973662.1|  PREDICTED: bifunctional monodehydroascorbate...    105   6e-24   
ref|XP_011015725.1|  PREDICTED: alpha carbonic anhydrase 4-like         106   6e-24   
ref|XP_008231951.1|  PREDICTED: bifunctional monodehydroascorbate...    105   6e-24   
dbj|BAD18020.1|  tuber storage protein                                  105   6e-24   
ref|XP_009767316.1|  PREDICTED: alpha carbonic anhydrase 7-like         105   7e-24   
ref|XP_006845945.1|  hypothetical protein AMTR_s00157p00088030          105   8e-24   
gb|ACT36288.1|  dioscorin precursor                                     105   8e-24   
gb|KHN18684.1|  Bifunctional monodehydroascorbate reductase and c...    103   8e-24   
ref|XP_010326158.1|  PREDICTED: alpha carbonic anhydrase 7-like         103   9e-24   
emb|CAA53781.1|  storage protein                                        105   9e-24   
ref|NP_001132416.1|  hypothetical protein                               105   9e-24   
ref|XP_011468689.1|  PREDICTED: alpha carbonic anhydrase 7-like         104   1e-23   
gb|ABO36620.1|  eukaryotic-type carbonic anhydrase family protein       104   1e-23   
ref|XP_004493459.1|  PREDICTED: bifunctional monodehydroascorbate...    105   1e-23   
ref|XP_008784764.1|  PREDICTED: alpha carbonic anhydrase 7-like         105   1e-23   
gb|EEC83720.1|  hypothetical protein OsI_29556                          104   1e-23   
ref|XP_003579701.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    105   1e-23   
ref|XP_010520706.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    104   1e-23   
ref|XP_010527573.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    104   1e-23   
ref|XP_007204039.1|  hypothetical protein PRUPE_ppa021069mg             104   1e-23   
gb|EYU18694.1|  hypothetical protein MIMGU_mgv11b010420mg               104   1e-23   
ref|XP_010239880.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    105   1e-23   
ref|XP_009377056.1|  PREDICTED: uncharacterized protein LOC103965713    105   1e-23   
dbj|BAK02152.1|  predicted protein                                      104   1e-23   
dbj|BAK00887.1|  predicted protein                                      104   1e-23   
ref|XP_008664513.1|  PREDICTED: bifunctional monodehydroascorbate...    105   1e-23   
ref|XP_004493458.1|  PREDICTED: bifunctional monodehydroascorbate...    104   1e-23   
ref|XP_004965905.1|  PREDICTED: bifunctional monodehydroascorbate...    104   2e-23   
gb|KDO70433.1|  hypothetical protein CISIN_1g044649mg                   101   2e-23   
ref|XP_003625103.1|  Bifunctional monodehydroascorbate reductase ...    103   2e-23   
gb|KCW47832.1|  hypothetical protein EUGRSUZ_K01571                     104   2e-23   
gb|AFK47340.1|  unknown                                                 103   2e-23   
ref|XP_009387987.1|  PREDICTED: alpha carbonic anhydrase 7-like         103   3e-23   
ref|XP_004973744.1|  PREDICTED: bifunctional monodehydroascorbate...    103   3e-23   
gb|ACN85335.1|  unknown                                                 103   3e-23   
ref|XP_009622096.1|  PREDICTED: alpha carbonic anhydrase 7-like         103   3e-23   
ref|XP_002532668.1|  carbonic anhydrase, putative                       102   4e-23   
pir||S57767  dioscorin class B - Dioscorea cayenensis (fragment)        102   5e-23
ref|XP_009599194.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    103   5e-23   
gb|AAF63334.1|AF245019_1  dioscorin A                                   103   5e-23   
ref|XP_010050579.1|  PREDICTED: alpha carbonic anhydrase 7-like         103   5e-23   
emb|CAO98735.1|  dioscorin 2 precursor                                  102   7e-23   
gb|KHN11228.1|  Bifunctional monodehydroascorbate reductase and c...  99.0    7e-23   
ref|XP_006286833.1|  hypothetical protein CARUB_v10003788mg             102   8e-23   
ref|XP_009413153.1|  PREDICTED: alpha carbonic anhydrase 7-like         102   9e-23   
emb|CAO98734.1|  dioscorin 1 precursor                                  102   1e-22   
gb|AAF60191.1|AF242551_1  dioscorin A                                   102   1e-22   
ref|NP_001149032.1|  carbonic anhydrase precursor                       102   1e-22   
tpg|DAA48425.1|  TPA: carbonic anhydrase                                102   1e-22   
ref|XP_006398874.1|  hypothetical protein EUTSA_v10014397mg             102   1e-22   
gb|ACN85275.1|  unknown                                                 102   1e-22   
ref|XP_002445624.1|  hypothetical protein SORBIDRAFT_07g022880          102   1e-22   
ref|XP_002308928.2|  hypothetical protein POPTR_0006s04610g             102   2e-22   
gb|EMT14744.1|  Bifunctional monodehydroascorbate reductase and c...    102   2e-22   
ref|XP_004973745.1|  PREDICTED: bifunctional monodehydroascorbate...    101   2e-22   
ref|XP_006284932.1|  hypothetical protein CARUB_v10006231mg             101   2e-22   
emb|CDP15426.1|  unnamed protein product                                102   2e-22   
gb|ACT36290.1|  dioscorin precursor                                     101   2e-22   
emb|CAO98738.1|  dioscorin 5 precursor                                  101   2e-22   
gb|ACT36292.1|  dioscorin precursor                                     101   2e-22   
gb|EEE68707.1|  hypothetical protein OsJ_27363                          105   2e-22   
gb|AEN14505.1|  dioscorin A3                                            100   2e-22   
ref|NP_001175588.1|  Os08g0424100                                       101   2e-22   
ref|NP_001063352.1|  Os09g0454500                                       100   3e-22   
ref|XP_006661305.1|  PREDICTED: bifunctional monodehydroascorbate...    100   3e-22   
ref|XP_006430188.1|  hypothetical protein CICLE_v10013720mg             100   3e-22   
ref|XP_010434246.1|  PREDICTED: alpha carbonic anhydrase 4-like         100   3e-22   
gb|ACT36293.1|  dioscorin precursor                                     100   3e-22   
ref|WP_013538320.1|  carbonic anhydrase                                 100   3e-22   
gb|EAZ07038.1|  hypothetical protein OsI_29285                          100   3e-22   
gb|ACN85281.1|  unknown                                                 101   3e-22   
ref|XP_006351243.1|  PREDICTED: bifunctional monodehydroascorbate...    100   3e-22   
emb|CAD40596.2|  OJ000126_13.1                                          100   3e-22   
ref|XP_011075611.1|  PREDICTED: alpha carbonic anhydrase 7-like         100   4e-22   
dbj|BAG87020.1|  unnamed protein product                                100   4e-22   
ref|XP_011075358.1|  PREDICTED: alpha carbonic anhydrase 7-like         100   4e-22   
emb|CAO98737.1|  dioscorin 4 precursor                                  100   4e-22   
gb|ACT36291.1|  dioscorin precursor                                     100   5e-22   
gb|KHN14952.1|  Bifunctional monodehydroascorbate reductase and c...    100   5e-22   
gb|ACT36289.1|  dioscorin precursor                                     100   5e-22   
ref|XP_006286119.1|  hypothetical protein CARUB_v10007668mg             100   5e-22   
emb|CAO98739.1|  dioscorin 6 precursor                                  100   5e-22   
ref|XP_008383978.1|  PREDICTED: bifunctional monodehydroascorbate...    100   5e-22   
dbj|BAD18021.1|  tuber storage protein                                  100   6e-22   
ref|XP_003560592.1|  PREDICTED: alpha carbonic anhydrase 7-like         100   6e-22   
gb|EAZ44968.1|  hypothetical protein OsJ_29611                          100   6e-22   
gb|EAZ09357.1|  hypothetical protein OsI_31629                          100   6e-22   
ref|XP_003553396.1|  PREDICTED: bifunctional monodehydroascorbate...    100   6e-22   
ref|XP_006481762.1|  PREDICTED: bifunctional monodehydroascorbate...    100   8e-22   
gb|ACN85320.1|  unknown                                                 100   8e-22   
gb|EAY94035.1|  hypothetical protein OsI_15813                        99.8    9e-22   
ref|XP_008787317.1|  PREDICTED: alpha carbonic anhydrase 2-like         100   9e-22   
emb|CAO98736.1|  dioscorin 3 precursor                                99.8    9e-22   
ref|NP_001047030.1|  Os02g0533300                                     99.4    9e-22   
ref|XP_007027757.1|  Alpha carbonic anhydrase 1, putative             99.4    1e-21   
gb|AAF44711.1|AF243526_1  dioscorin B                                 99.4    1e-21   
ref|XP_010911351.1|  PREDICTED: alpha carbonic anhydrase 7-like       95.5    1e-21   
ref|XP_007162791.1|  hypothetical protein PHAVU_001G180900g           99.0    1e-21   
ref|XP_010449136.1|  PREDICTED: alpha carbonic anhydrase 4-like       99.0    1e-21   
ref|XP_009358737.1|  PREDICTED: alpha carbonic anhydrase 7-like       99.4    2e-21   
ref|XP_009122630.1|  PREDICTED: alpha carbonic anhydrase 3            99.0    2e-21   
emb|CDY41393.1|  BnaCnng10290D                                        98.6    2e-21   
ref|XP_010090214.1|  hypothetical protein L484_016553                 99.0    2e-21   
ref|XP_010101554.1|  hypothetical protein L484_015378                 98.6    2e-21   
gb|EPS62533.1|  hypothetical protein M569_12260                       97.8    2e-21   
emb|CDP14169.1|  unnamed protein product                              98.2    2e-21   
gb|EYU18692.1|  hypothetical protein MIMGU_mgv1a011638mg              98.6    2e-21   
gb|EMS61959.1|  hypothetical protein TRIUR3_33715                     98.6    2e-21   
gb|EEE68846.1|  hypothetical protein OsJ_27636                        98.2    3e-21   
gb|ACF85948.1|  unknown                                               98.2    3e-21   
gb|AFW87497.1|  hypothetical protein ZEAMMB73_893265                  98.2    3e-21   
ref|XP_010439534.1|  PREDICTED: alpha carbonic anhydrase 4-like       98.2    3e-21   
dbj|BAJ99342.1|  predicted protein                                    98.2    3e-21   
gb|AFW87496.1|  hypothetical protein ZEAMMB73_893265                  98.2    4e-21   
gb|AFW87500.1|  hypothetical protein ZEAMMB73_893265                  96.3    4e-21   
ref|XP_011004112.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...  97.8    5e-21   
gb|ACF86177.1|  unknown                                               98.2    5e-21   
gb|ACG39127.1|  carbonic anhydrase precursor                          98.2    5e-21   
gb|AFW87495.1|  carbonic anhydrase                                    98.2    5e-21   
ref|XP_011468147.1|  PREDICTED: alpha carbonic anhydrase 7-like       97.4    6e-21   
gb|KHN10833.1|  Bifunctional monodehydroascorbate reductase and c...  96.7    7e-21   
ref|XP_006660137.1|  PREDICTED: bifunctional monodehydroascorbate...  97.1    8e-21   
ref|XP_002323427.2|  hypothetical protein POPTR_0016s08050g           97.1    8e-21   
ref|XP_006354411.1|  PREDICTED: bifunctional monodehydroascorbate...  97.4    8e-21   
gb|EYU20767.1|  hypothetical protein MIMGU_mgv1a019017mg              96.7    9e-21   
gb|EMT14740.1|  Bifunctional monodehydroascorbate reductase and c...  97.1    9e-21   
ref|XP_006659407.1|  PREDICTED: bifunctional monodehydroascorbate...  96.7    9e-21   
ref|XP_009125546.1|  PREDICTED: alpha carbonic anhydrase 3-like i...  96.7    1e-20   
ref|XP_007211988.1|  hypothetical protein PRUPE_ppa010973mg           95.9    1e-20   
gb|KFK24865.1|  hypothetical protein AALP_AA8G035000                  96.7    1e-20   
emb|CDX79018.1|  BnaA01g10850D                                        96.7    1e-20   
gb|EMT10087.1|  Bifunctional monodehydroascorbate reductase and c...  96.3    1e-20   
ref|XP_003565803.1|  PREDICTED: alpha carbonic anhydrase 7-like       96.7    1e-20   
emb|CDY35256.1|  BnaA01g07750D                                          100   1e-20   
gb|EMT15899.1|  Bifunctional monodehydroascorbate reductase and c...  96.7    1e-20   
ref|XP_008677673.1|  PREDICTED: uncharacterized protein LOC100384...  96.3    2e-20   
ref|XP_004954966.1|  PREDICTED: bifunctional monodehydroascorbate...  95.9    2e-20   
ref|XP_008784028.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...  89.7    2e-20   
ref|XP_010271743.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...  95.5    2e-20   
emb|CDY61773.1|  BnaAnng17740D                                        99.4    3e-20   
emb|CBI30302.3|  unnamed protein product                              95.5    3e-20   
ref|XP_002282507.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...  95.5    3e-20   
ref|XP_010236801.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...  95.5    3e-20   
gb|KCW89334.1|  hypothetical protein EUGRSUZ_A01625                   95.1    3e-20   
ref|XP_009134167.1|  PREDICTED: alpha carbonic anhydrase 4-like       95.1    3e-20   
gb|AFW87501.1|  hypothetical protein ZEAMMB73_893265                  95.5    4e-20   
ref|XP_010423620.1|  PREDICTED: alpha carbonic anhydrase 3            94.7    5e-20   
ref|XP_004978704.1|  PREDICTED: bifunctional monodehydroascorbate...  94.7    5e-20   
dbj|BAK07868.1|  predicted protein                                    94.7    6e-20   
ref|XP_002452206.1|  hypothetical protein SORBIDRAFT_04g021740        94.0    6e-20   
ref|XP_009115968.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...  94.7    7e-20   
gb|ABG21890.1|  Eukaryotic-type carbonic anhydrase family protein...  93.2    7e-20   
emb|CDX78118.1|  BnaA09g33130D                                        94.7    7e-20   
ref|XP_006653371.1|  PREDICTED: bifunctional monodehydroascorbate...  94.4    7e-20   
ref|XP_002462485.1|  hypothetical protein SORBIDRAFT_02g026480        91.7    8e-20   
ref|WP_036794629.1|  hypothetical protein                             94.0    1e-19   



>ref|XP_009782909.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana sylvestris]
Length=270

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            M   K+  I+FL LS   + +S EVDDE  FSYDE S+ GP+ WG++ PEW  C+ GK+Q
Sbjct  3    MAATKILFISFLFLSSAFLARSAEVDDESEFSYDEKSENGPAKWGKIHPEWSTCNTGKLQ  62

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            +PIDL +K V V SNLG +  +Y    ATL N G+ MML W  G  YL ING +Y  +Q 
Sbjct  63   SPIDLLNKRVEVVSNLGKLCTHYKPSNATLLNRGHDMMLRWEGGGGYLKINGTKYQLKQC  122

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            HWH PSEH +NG R++LEAHLVH S+DG+
Sbjct  123  HWHTPSEHTINGKRFNLEAHLVHESDDGK  151



>ref|XP_009595413.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana tomentosiformis]
Length=269

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 102/144 (71%), Gaps = 1/144 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            LF I+FL LS   + +S EVDDE  FSYDE ++ GP++WG++ PEW  C+ GK+Q+PIDL
Sbjct  7    LFIISFLFLSSAFLARSAEVDDESEFSYDEKNENGPANWGKIYPEWNTCNTGKLQSPIDL  66

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
             +K V V SNLG ++ +Y    ATL N G+ MML W  G  +L ING +Y  +Q HWH P
Sbjct  67   LNKRVEVVSNLGKLRKHYKPSNATLLNRGHDMMLRWEGGAGHLKINGTKYQLKQCHWHTP  126

Query  402  SEHVVNGTRYDLEAHLVHVSNDGE  473
            SEH +NG R++LEAHLVH S+DG+
Sbjct  127  SEHTINGKRFNLEAHLVHESDDGK  150



>ref|XP_009621603.1| PREDICTED: alpha carbonic anhydrase 7 [Nicotiana tomentosiformis]
Length=273

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 104/155 (67%), Gaps = 5/155 (3%)
 Frame = +3

Query  30   MDML----KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            M+ML    K+  ++FL L+   + +S EVDDE  F+YDE S++GP+HWGE+  EW  C++
Sbjct  1    MEMLTRTNKILFLSFLFLASALLTRSHEVDDESEFTYDEESEKGPAHWGEIHTEWSMCNS  60

Query  198  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  374
            GK+Q+PIDL ++ V V S+LG ++  Y    +TL N G+ MML W  G  ++ ING RY 
Sbjct  61   GKLQSPIDLLNERVEVVSHLGRLRRSYKPSNSTLLNRGHDMMLRWEGGAGHIEINGTRYQ  120

Query  375  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGEDC  479
              Q HWH PSEH +NG R+DLE HLVH SNDG+  
Sbjct  121  LNQAHWHSPSEHTINGKRFDLEVHLVHESNDGKTA  155



>ref|XP_011090098.1| PREDICTED: alpha carbonic anhydrase 7 [Sesamum indicum]
Length=271

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
             SI   LL V  + ++QEVDDE  FSY+ENS+ GP+HWGE+RPEW +CS+G+MQ+PIDL 
Sbjct  10   LSIFIPLLLVACLTRAQEVDDEREFSYEENSEIGPAHWGEIRPEWKECSSGEMQSPIDLL  69

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            ++ V V S+LG ++  Y     TL N G+ MML WP G  ++ ING  Y  +Q HWH PS
Sbjct  70   NERVEVVSHLGKLKRSYKPSNTTLINRGHDMMLRWPGGAGHININGTLYQLKQCHWHSPS  129

Query  405  EHVVNGTRYDLEAHLVHVSND  467
            EH ++G R+D+E HLVH S+D
Sbjct  130  EHTISGRRFDMEVHLVHQSDD  150



>ref|XP_009776894.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3, partial [Nicotiana sylvestris]
Length=260

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = +3

Query  42   KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            K+   +FL L+   + +S EVDDE  F+YDE S++GPSHWGE+  EW  C++GK+Q+PID
Sbjct  9    KILFFSFLFLTSALLARSHEVDDESEFTYDEESEKGPSHWGEIHSEWSMCNSGKLQSPID  68

Query  222  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
            L ++ V + S+LG +   Y    +TL N G+ MML W  G  ++ ING +Y   Q HWH 
Sbjct  69   LLNERVEIVSHLGRLHRSYKPSNSTLLNRGHDMMLRWEGGAGHIKINGTQYQLNQAHWHS  128

Query  399  PSEHVVNGTRYDLEAHLVHVSNDGEDC  479
            PSEH +NG R+DLE HLVH SNDG+  
Sbjct  129  PSEHTINGRRFDLEVHLVHESNDGKTA  155



>emb|CDP11563.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 101/153 (66%), Gaps = 2/153 (1%)
 Frame = +3

Query  21   IEDMDMLKLFSIAFLLLS-VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            +E++    LF   F+L++   ++ ++QE DD+ GFSYDENS RGP+HWGEL+ EW  CS 
Sbjct  1    MENLARKFLFCCCFILVTFACNLARAQEEDDQHGFSYDENSPRGPAHWGELKEEWCTCSH  60

Query  198  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  374
            G+MQ+PIDL    V V  +LG +  +Y    ATL N G+ +ML W     Y+ I+G  Y 
Sbjct  61   GRMQSPIDLPDAEVQVDPSLGKLHRHYRPSNATLINRGHDIMLRWVDDAGYIRIDGTLYQ  120

Query  375  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
             +Q HWH P+EH +NG RYDLEAHLVH S DG+
Sbjct  121  LQQCHWHSPTEHAINGERYDLEAHLVHQSPDGK  153



>ref|XP_004242097.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum lycopersicum]
Length=270

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            + K+  ++F  LS   + +S EVDDE  FSYDEN++ GP++W  + P W +C  GKMQ+P
Sbjct  6    ITKMLFVSFAFLSSAFLARSGEVDDESEFSYDENAENGPANWSNIHPNWIKCKTGKMQSP  65

Query  216  IDLESKPVV-YSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            ID  +  +   SNLG +Q  Y    ATL N G+ +ML W  G  +L ING +Y  +QVHW
Sbjct  66   IDFANNKIENVSNLGILQKLYKPSNATLLNRGHDIMLRWDDGG-FLKINGTQYRLKQVHW  124

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGEDCSAC  488
            H PSEH +NG R+D+E HLVH +NDG++ +  
Sbjct  125  HTPSEHTINGKRFDMEGHLVHETNDGKNIAVI  156



>ref|XP_004251153.1| PREDICTED: alpha carbonic anhydrase 7 [Solanum lycopersicum]
Length=276

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 97/146 (66%), Gaps = 2/146 (1%)
 Frame = +3

Query  42   KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            K+F ++FL L+   +    EVDDE  FSYD  S+ GP+HWGE+ PEW  C+ GK+Q+PID
Sbjct  11   KIFFLSFLFLTNAFIATCHEVDDESEFSYDRESENGPTHWGEIHPEWKLCNTGKLQSPID  70

Query  222  LESKPV-VYSNLGPI-QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            L ++ V V S+LG + ++Y     ATL N G+ MML W  G  ++ ING +Y   Q HWH
Sbjct  71   LLNERVEVVSHLGRLHRSYKTTSYATLLNRGHDMMLRWEGGAGHIVINGTKYQLNQAHWH  130

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDGE  473
             PSEH +NG R+DLE HLVH S DG+
Sbjct  131  SPSEHTINGRRFDLEVHLVHESEDGK  156



>ref|XP_009795833.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like, partial 
[Nicotiana sylvestris]
Length=226

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = +3

Query  42   KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            K+  I+FL LS   + +S EVDDE  FSYDE S+ GP++WG +RP+W  CS GK+Q PID
Sbjct  8    KMLFISFLFLSSVFLARSGEVDDESEFSYDEKSENGPANWGNIRPDWKDCS-GKLQPPID  66

Query  222  L-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
            L E +  V S LG +Q  Y    ATL N G+ +ML W  G  YL ING +Y  +Q+HWH 
Sbjct  67   LFELRAEVVSKLGILQTDYKPSNATLLNRGHDIMLRWDDGG-YLKINGTQYQLKQLHWHT  125

Query  399  PSEHVVNGTRYDLEAHLVHVSNDGE  473
            PSEH VNG R++LE+HLVH SN+G+
Sbjct  126  PSEHTVNGERFNLESHLVHESNNGK  150



>ref|XP_006340168.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 96/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +  ++FL L+   +    EVDDE  FSYD  S+ GP+HWGE+ PEW  C++GK+Q+PIDL
Sbjct  11   ILFLSFLFLTNAFIATCHEVDDESEFSYDRESENGPTHWGEINPEWKMCNSGKLQSPIDL  70

Query  225  ESKPV-VYSNLGPI-QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
             ++ V V S+LG + ++Y     ATL N G+ MML W  G  ++ ING +Y   Q HWH 
Sbjct  71   LNERVEVVSHLGRLHRSYKTSSYATLLNRGHDMMLRWEGGAGHIKINGTKYQLNQAHWHS  130

Query  399  PSEHVVNGTRYDLEAHLVHVSNDGE  473
            PSEH +NG R+DLE HLVH S DG+
Sbjct  131  PSEHTINGRRFDLEVHLVHESEDGK  155



>ref|XP_006424534.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
 gb|ESR37774.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
Length=275

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 97/147 (66%), Gaps = 3/147 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +   F +  LLLS T +  SQEVDDE  F+Y+E  + GPS WGEL  +W  C  G+MQ+P
Sbjct  9    LFCCFFVVLLLLSGTAI--SQEVDDEIEFNYEEGGENGPSKWGELHSKWSACKNGRMQSP  66

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L INGI Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSNATLKNRGHDMMLQWEGGAGTLRINGIEYVLQQCHW  126

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH +NG R+ LEAH+VHVS DG+
Sbjct  127  HSPSEHTINGQRFALEAHMVHVSQDGK  153



>ref|XP_006340169.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 96/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +  ++FL L+   +    EVDDE  FSYD  S+ GP+HWGE+ PEW  C++GK+Q+PIDL
Sbjct  11   ILFLSFLFLTNAFIATCHEVDDESEFSYDRESENGPTHWGEINPEWKMCNSGKLQSPIDL  70

Query  225  ESKPV-VYSNLGPI-QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
             ++ V V S+LG + ++Y     ATL N G+ MML W  G  ++ ING +Y   Q HWH 
Sbjct  71   LNERVEVVSHLGRLHRSYKTSSYATLLNRGHDMMLRWEGGAGHIKINGTKYQLNQAHWHS  130

Query  399  PSEHVVNGTRYDLEAHLVHVSNDGE  473
            PSEH +NG R+DLE HLVH S DG+
Sbjct  131  PSEHTINGRRFDLEVHLVHESEDGK  155



>ref|XP_006365755.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=270

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 99/152 (65%), Gaps = 2/152 (1%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            + K+  I+F  LS   + +S EVDDE  FSY EN++ GP++W  + P W +C  GK+Q+P
Sbjct  6    ITKMLFISFAFLSSAFLARSGEVDDESEFSYIENAENGPANWSNIHPNWIKCKTGKLQSP  65

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            ID  +  V + SNLG +Q +Y    ATL N G+ +ML W  G  +L ING +Y  +QVHW
Sbjct  66   IDFPNNKVEIVSNLGILQKFYKPSNATLLNRGHDIMLRWDDGG-FLKINGTQYRLKQVHW  124

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGEDCSAC  488
            H PSEH ++G R+D+E HLVH +NDG++ +  
Sbjct  125  HTPSEHTIDGKRFDMEGHLVHETNDGKNIAVI  156



>ref|XP_006488640.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +   F +  LLLS T +  SQEVDDE  F+Y+E  + GPS WG+L  EW  C  G+MQ+P
Sbjct  9    LFCCFFVVLLLLSGTAI--SQEVDDEIEFNYEEGGENGPSKWGQLHSEWSACKNGRMQSP  66

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSNATLKNRGHDMMLQWEGGAGTLRINGTEYVLQQCHW  126

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH +NG R+ LEAH+VHVS DG+
Sbjct  127  HSPSEHTINGQRFALEAHMVHVSQDGK  153



>gb|KDO73355.1| hypothetical protein CISIN_1g046862mg [Citrus sinensis]
Length=275

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +   F +  LLLS T +  SQEVDDE  F+Y+E  + GPS WG+L  EW  C  G+MQ+P
Sbjct  9    LFCCFFVVLLLLSGTAI--SQEVDDEIEFNYEEGGENGPSKWGQLHSEWSACKNGRMQSP  66

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSNATLKNRGHDMMLQWEGGAGTLRINGTEYVLQQCHW  126

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH +NG R+ LEAH+VHVS DG+
Sbjct  127  HSPSEHTINGQRFALEAHMVHVSQDGK  153



>ref|XP_007016796.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34415.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +FSI  L+L  +    SQEV+DE  F Y+ENS RGP+ WGE+ PEW  CS G MQ+PID+
Sbjct  12   IFSI-VLVLQYSCPATSQEVEDESEFDYNENSPRGPARWGEIHPEWSACSNGSMQSPIDM  70

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
             ++ V + S+LG ++  Y    ATL+N G+ MML W      + ING  Y  +Q HWH P
Sbjct  71   SNERVNIVSHLGRLKRSYKPSNATLKNRGHDMMLRWDGDAGAIEINGTEYALKQCHWHSP  130

Query  402  SEHVVNGTRYDLEAHLVHVSNDGE  473
            SEH +NG RYDLE HLVH S DG+
Sbjct  131  SEHTINGRRYDLEVHLVHESADGK  154



>ref|XP_006424533.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
 gb|ESR37773.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
Length=275

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +   F +  LLLS   V  SQEVDDE  F+Y+E   RGPS WGEL  EW  C  G MQ+P
Sbjct  9    LFSCFFLVLLLLSCPAV--SQEVDDEKEFNYEEEGQRGPSKWGELHKEWSDCKKGTMQSP  66

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSYATLKNRGHDMMLQWHGGAGTLLINGTEYVLKQCHW  126

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH +NG R+ LEAH+VH S DG+
Sbjct  127  HSPSEHTINGERFALEAHMVHESQDGK  153



>gb|KJB83847.1| hypothetical protein B456_013G267400 [Gossypium raimondii]
Length=274

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 97/151 (64%), Gaps = 3/151 (2%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  203
            + M  LF I F+++ + H    KSQEV+DE  FSY EN++RGPS WGE+  EW  CS G 
Sbjct  4    LQMKPLFCILFIVIILQHSRPTKSQEVEDESEFSYSENNERGPSRWGEIHEEWGACSNGT  63

Query  204  MQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFR  380
            MQ+PID+ ++ V + S+LG ++  Y    ATL N G+ MML +      + ING  Y  +
Sbjct  64   MQSPIDMFNQRVQIVSHLGKLKRSYKPANATLRNRGHDMMLRFDGEAGAIEINGTEYALQ  123

Query  381  QVHWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            Q HWH PSEH +NG R+DLEAHLVH   DG+
Sbjct  124  QCHWHSPSEHTINGRRFDLEAHLVHEGADGK  154



>gb|KDO73356.1| hypothetical protein CISIN_1g039445mg [Citrus sinensis]
Length=275

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +   F +  LLLS   V  SQEVDDE  F+Y+E   RGPS WGEL  EW  C  G MQ+P
Sbjct  9    LFSCFFLVLLLLSCPAV--SQEVDDEKEFNYEEEGQRGPSKWGELHKEWSACKKGTMQSP  66

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSYATLKNRGHDMMLQWHGGAGTLLINGTEYVLKQCHW  126

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH ++G R+ LEAH+VH S DG+
Sbjct  127  HSPSEHTIDGERFALEAHMVHESQDGK  153



>emb|CDP07086.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = +3

Query  21   IEDMDMLKLFSIAFLLLS-VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            +E++    LF   F+  +   ++ +++EV+DE  FSYDE S RGP+HWGE+R EW  C+ 
Sbjct  1    MENLTRKALFCCFFVCTTFACNLARAEEVEDEKEFSYDERSHRGPAHWGEIRQEWSMCNH  60

Query  198  GKMQTPIDL-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  374
            G MQ+PIDL +++  V S+LG +   Y    ATL N G+ MML W     ++ ING  Y 
Sbjct  61   GSMQSPIDLLDARVQVVSSLGRLHREYKPSNATLVNRGHDMMLRWVDDAGHIHINGTLYH  120

Query  375  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
             RQ HWH PSEH +NG RYDLEAHLVH + +G
Sbjct  121  LRQCHWHSPSEHSINGKRYDLEAHLVHEALNG  152



>gb|KDP44024.1| hypothetical protein JCGZ_05491 [Jatropha curcas]
Length=274

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 95/148 (64%), Gaps = 3/148 (2%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVI--KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  212
            ++L    F +  + H +   SQEV+DE  FSY++NS+ GP  WGEL PEW  CS G MQ+
Sbjct  6    IQLLCFTFFISLLFHALPSSSQEVEDEREFSYEKNSETGPERWGELHPEWSTCSNGTMQS  65

Query  213  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  389
            PIDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   + ING  Y+ RQ H
Sbjct  66   PIDLLNERVEVVSHLGKLKRSYKPSNATLKNRGHDMMLEWENGAGTIEINGTEYVLRQCH  125

Query  390  WHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            WH PSEH ++G R+ LE H+VH S DG+
Sbjct  126  WHSPSEHTIDGGRFALELHMVHESQDGK  153



>ref|XP_006384924.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
 gb|ERP62721.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
Length=274

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 95/146 (65%), Gaps = 3/146 (2%)
 Frame = +3

Query  45   LFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            LF I F L+ V+H+  I SQE++DE  F Y+  S+RGP+HWG + PEW  CS G MQ+PI
Sbjct  9    LFLITFFLVLVSHILPITSQELEDETEFDYNPYSERGPAHWGRIHPEWVACSNGSMQSPI  68

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL ++ V + S LG +   Y    ATL N G+ +ML W  G   + ING  Y+ +Q HWH
Sbjct  69   DLLNERVDIVSYLGRLNRSYKPGNATLRNRGHDIMLKWESGAGTIEINGTEYVLKQCHWH  128

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDGE  473
             PSEH ++G R+ LEAH+VH S DG+
Sbjct  129  SPSEHTIDGKRFALEAHMVHESLDGK  154



>ref|XP_011044411.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 93/146 (64%), Gaps = 3/146 (2%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVI--KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            LF I F L+ V+ ++   SQEV+DE  F+YD N ++GP++WG + PEW  CS G MQ+PI
Sbjct  9    LFLITFFLVLVSRILPATSQEVEDEADFNYDPNGEKGPANWGRIHPEWGACSNGSMQSPI  68

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL S+ V V S+LG +   Y    ATL N G+ MML W      + ING  YL +Q HWH
Sbjct  69   DLLSERVDVVSHLGRLSRSYKPANATLRNRGHDMMLKWEGAAGSIEINGTEYLLKQCHWH  128

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDGE  473
             PSEH +NG R  LE H+VH S DG+
Sbjct  129  SPSEHTINGKRLALEVHMVHESLDGK  154



>ref|XP_006488639.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +L  F +  LLLS   +  SQE DDE  F+Y+E   RGPS WGEL  EW  C  G MQ+P
Sbjct  9    LLSCFFLVLLLLSCPAL--SQEADDEKEFNYEEEGQRGPSKWGELHKEWSACKKGTMQSP  66

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSYATLKNRGHDMMLQWHGGAGTLLINGTEYVLKQCHW  126

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH ++G R+ LEAH+VH S DG+
Sbjct  127  HSPSEHTIDGERFALEAHMVHESQDGK  153



>ref|XP_004160913.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=269

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 95/145 (66%), Gaps = 5/145 (3%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            L  FS+    L  T    SQEV++E GF Y+ + ++GP+HWGELR EW +C  G MQ+PI
Sbjct  8    LIFFSLPLFSLKAT----SQEVENERGFDYERDGEKGPTHWGELRAEWHKCKGGLMQSPI  63

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL  + V V S+LG +Q  Y    ATL+N G+ MM+ W  G  Y+ +NG +Y  +Q HWH
Sbjct  64   DLLHERVEVISHLGDLQINYKSSNATLKNRGHDMMMKWVDGGGYMEMNGTQYKLKQCHWH  123

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDG  470
             PSEH ++G  +DLEAHLVH S++G
Sbjct  124  SPSEHTIDGKTFDLEAHLVHESSNG  148



>ref|XP_004139554.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=269

 Score =   142 bits (358),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 95/145 (66%), Gaps = 5/145 (3%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            L  FS+    L  T    SQEV++E GF Y+ + ++GP+HWGELR EW +C  G MQ+PI
Sbjct  8    LIFFSLLLFSLKAT----SQEVENERGFDYERDGEKGPTHWGELRAEWHKCKGGLMQSPI  63

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL  + V V S+LG +Q  Y    ATL+N G+ MM+ W  G  Y+ +NG +Y  +Q HWH
Sbjct  64   DLLHERVEVISHLGDLQINYKSSNATLKNRGHDMMMKWVDGGGYMEMNGTQYKLKQCHWH  123

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDG  470
             PSEH ++G  +DLEAHLVH S++G
Sbjct  124  SPSEHTIDGKTFDLEAHLVHESSNG  148



>ref|XP_011040911.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 93/146 (64%), Gaps = 3/146 (2%)
 Frame = +3

Query  45   LFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            LF I FLL+ V+H+  I SQEV+DE  F Y+ + ++GP+ WG + PEW  CS G MQ+PI
Sbjct  9    LFLITFLLVLVSHILPIASQEVEDEEEFDYNPDGEKGPAQWGRIHPEWGACSNGSMQSPI  68

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL ++ V + S+LG +   Y    ATL N G+ MML W  G   + ING  Y+  Q HWH
Sbjct  69   DLLNERVDIVSHLGRLNRSYKPGNATLRNRGHDMMLKWESGAGTIEINGTEYVLNQCHWH  128

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDGE  473
             PSEH +NG R  LE H+VH S DG+
Sbjct  129  SPSEHTINGKRLALEVHMVHESLDGK  154



>sp|Q84UV8.1|NEC3_NICLS RecName: Full=Bifunctional monodehydroascorbate reductase and 
carbonic anhydrase nectarin-3; AltName: Full=Nectarin-III; 
Contains: RecName: Full=Nectarin-2; Flags: Precursor [Nicotiana 
langsdorffii x Nicotiana sanderae]
 gb|AAO85482.1| nectarin III [Nicotiana langsdorffii x Nicotiana sanderae]
Length=274

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            + K+  I+FL LS   + +S EVDDE  FSYDE S+ GP++WG +RP+W +CS GK+Q+P
Sbjct  6    ITKMLFISFLFLSSVFLARSGEVDDESEFSYDEKSENGPANWGNIRPDWKECS-GKLQSP  64

Query  216  IDL-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            ID+ + +  V SNL  +Q  Y    ATL N G+ +ML    G  YL IN  +Y  +Q+HW
Sbjct  65   IDIFDLRAEVVSNLRILQKDYKPSNATLLNRGHDIMLRLDDGG-YLKINETQYQLKQLHW  123

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH +NG R++LEAHLVH SN+G+
Sbjct  124  HTPSEHTINGERFNLEAHLVHESNNGK  150



>ref|XP_008464591.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like [Cucumis 
melo]
Length=268

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 96/146 (66%), Gaps = 3/146 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +  L   + LL S+    +SQEV+DE GF Y+ + ++GP HWGELR EW +C  G MQ+P
Sbjct  5    LCSLIFSSLLLFSLK--ARSQEVEDERGFDYERDGEKGPVHWGELRAEWHKCKGGLMQSP  62

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL  + V V S+LG +Q  Y    ATL+N G+ MM+ W  G  Y+ +NG +Y  +Q HW
Sbjct  63   IDLLHERVEVISHLGDLQINYKSSNATLKNRGHDMMMKWVDGGGYMEMNGTQYKLKQCHW  122

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDG  470
            H PSEH ++G  +DLEAHLVH S++G
Sbjct  123  HSPSEHTIDGKNFDLEAHLVHESSNG  148



>ref|XP_011090042.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=274

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            +  +L S     ++QEVDDE  FSY+E+S+ GPS+WG++RPEW QC++G++Q+PIDL ++
Sbjct  14   LVLVLPSFACFTRAQEVDDERQFSYEEDSEIGPSNWGKIRPEWSQCNSGRLQSPIDLLNQ  73

Query  234  PVV-YSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  410
             V   S+LG ++  Y    ATL N G+ MML W     ++ ING  Y  RQ HWH PSEH
Sbjct  74   RVEEVSHLGRLKRNYNPSNATLINRGHDMMLRWRNDAGHIQINGTLYHLRQCHWHSPSEH  133

Query  411  VVNGTRYDLEAHLVHVSND  467
             +NG R+D+E HLVH S+D
Sbjct  134  TINGKRFDMETHLVHESDD  152



>ref|XP_008462774.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=276

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 93/139 (67%), Gaps = 2/139 (1%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
            AF+LL ++    SQEVDDE GF+YDE+ ++GPS WGEL  EW +C++GKMQ+PIDL  K 
Sbjct  16   AFVLL-LSRPAVSQEVDDESGFNYDEDGNKGPSRWGELNVEWQECNSGKMQSPIDLLHKR  74

Query  237  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
            V +       +  Y    ATL+N G+ +ML W     Y+ ING RY  +Q HWH PSEH 
Sbjct  75   VQIVPKFVDFKIAYKPTNATLKNRGHDIMLKWSDDAGYIEINGTRYFLKQCHWHSPSEHT  134

Query  414  VNGTRYDLEAHLVHVSNDG  470
            +NG ++ LEAHLVH S++G
Sbjct  135  INGEKFALEAHLVHQSHNG  153



>ref|XP_011459370.1| PREDICTED: alpha carbonic anhydrase 7 [Fragaria vesca subsp. 
vesca]
Length=275

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 95/153 (62%), Gaps = 8/153 (5%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKS-------QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  194
            MLKL S+  L  S+  V+ S        EV+DE  FSYDENS++GP+ WG +R EW  C+
Sbjct  1    MLKLSSLLILFCSIVLVLHSYQVTSHENEVEDESEFSYDENSEKGPARWGNIRREWSMCN  60

Query  195  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
             G +Q+PI+L    V V S+LG +Q  Y    ATL+N G+ +ML W     Y+ ING  Y
Sbjct  61   NGLLQSPINLSDDRVNVISDLGALQGSYKACNATLKNRGHDIMLKWQADAGYIPINGTHY  120

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
              RQ HWH PSEH +NG ++DLEAH+VH   +G
Sbjct  121  SVRQCHWHSPSEHKINGKQFDLEAHMVHDGPNG  153



>ref|XP_004506042.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=269

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 93/141 (66%), Gaps = 2/141 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            IA +LLS    + SQEV+ E  F+YDE S +GP HWG+++PEW  C  G MQ+PIDL ++
Sbjct  15   IALVLLSSCPTM-SQEVEHESEFNYDEKSMKGPQHWGDIKPEWSMCKNGTMQSPIDLLNQ  73

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  410
             V + SNLG +Q  Y    ATL+N G+ +ML       YL ING +Y+ +Q HWH PSEH
Sbjct  74   RVQIVSNLGTLQINYKPSNATLKNRGHDIMLELIANSSYLQINGTQYVLKQFHWHSPSEH  133

Query  411  VVNGTRYDLEAHLVHVSNDGE  473
             ++G R+DLE H+VH +  G+
Sbjct  134  TIDGKRFDLELHMVHQTPSGQ  154



>ref|XP_010043780.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85764.1| hypothetical protein EUGRSUZ_B02520 [Eucalyptus grandis]
Length=278

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  45   LFSIAFLLLSV-THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            L    FL+L++   + KS+EV++E  F+YD  SDRGP+ WGE+R EW  C  G MQ+PID
Sbjct  9    LLCTIFLVLALHVGLTKSEEVENESQFNYDARSDRGPARWGEIRREWEMCRNGSMQSPID  68

Query  222  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
            L S+ V V + LG ++  Y    ATL+N G+ +ML W      + +NG +YL +Q HWH 
Sbjct  69   LSSERVQVMARLGRLKRSYKASNATLKNRGHDIMLRWDGDAGSIYVNGTQYLLKQSHWHS  128

Query  399  PSEHVVNGTRYDLEAHLVHVSNDGE  473
            PSEH VNG R+DLE H+VH S +G+
Sbjct  129  PSEHAVNGRRFDLELHMVHDSPEGK  153



>ref|XP_009367040.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 91/143 (64%), Gaps = 2/143 (1%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  224
            F I  +LL+      S EV+DE  F+Y E+S++GP+ WGE+R EW  CS G MQ+PIDL 
Sbjct  13   FLIVLVLLNSCQA-SSDEVEDEREFNYKEDSEKGPARWGEIRQEWSMCSKGSMQSPIDLL  71

Query  225  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            + +  V SN G +Q  Y    ATL+N G+ MML W     ++ +NG  Y  +Q HWH  S
Sbjct  72   DDRVEVVSNFGILQGSYRPCNATLKNRGHDMMLKWEADAGFIQLNGTLYKLKQCHWHSSS  131

Query  405  EHVVNGTRYDLEAHLVHVSNDGE  473
            EH +NG R+DLEAHLVH S+ G+
Sbjct  132  EHTINGKRFDLEAHLVHESSTGK  154



>ref|XP_008359452.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 91/143 (64%), Gaps = 2/143 (1%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  224
            F I  +LL+      S EV+DE  F+Y E+S++GP+ WGE+R EW  CS G MQ+PIDL 
Sbjct  13   FLIVLVLLNSCQA-SSDEVEDEREFNYXEDSEKGPARWGEIRQEWSMCSKGSMQSPIDLL  71

Query  225  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            + +  V SN G +Q  Y    ATL+N G+ MML W     ++ +NG  Y  +Q HWH  S
Sbjct  72   DDRVEVVSNFGILQGSYRPCNATLKNRGHDMMLKWEADAGFIQLNGTLYKLKQCHWHSSS  131

Query  405  EHVVNGTRYDLEAHLVHVSNDGE  473
            EH +NG R+DLEAHLVH S+ G+
Sbjct  132  EHTINGKRFDLEAHLVHESSTGK  154



>gb|KJB56186.1| hypothetical protein B456_009G109100 [Gossypium raimondii]
Length=274

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 91/140 (65%), Gaps = 2/140 (1%)
 Frame = +3

Query  60   FLLLSV-THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
            FLLL++ +  ++SQEV+DE  F Y  NS +GP+ WGE+  EW  CS G MQ+PID+ ++ 
Sbjct  14   FLLLALHSFSVRSQEVEDESEFDYGANSTKGPARWGEIHAEWGACSNGTMQSPIDMSNER  73

Query  237  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
            V + S+LG ++  Y    ATL N G+ MML W      + ING  Y+  Q HWH PSEH 
Sbjct  74   VNIVSHLGRLKKSYKPSNATLRNRGHDMMLRWEDEAGAIEINGTEYVLHQCHWHSPSEHT  133

Query  414  VNGTRYDLEAHLVHVSNDGE  473
            +NG RYDLE H+VH S DG+
Sbjct  134  INGRRYDLELHMVHESEDGK  153



>ref|XP_008462808.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 92/142 (65%), Gaps = 3/142 (2%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            F  AFLL+S   +  SQEV+++  F Y+ N  RGP+HWG+LRPEW  C+ G+MQ+PIDL 
Sbjct  14   FFFAFLLVSWPAM--SQEVENQREFDYNTNGTRGPAHWGDLRPEWHNCNTGRMQSPIDLL  71

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            ++ V + S+    Q  Y    ATL+N G+ MML W     ++ +N  RY  RQ+HWH PS
Sbjct  72   NQRVRIVSHFTDFQIDYRSSNATLKNRGHDMMLQWSGAAGHMEVNRSRYFLRQIHWHSPS  131

Query  405  EHVVNGTRYDLEAHLVHVSNDG  470
            EH +NG R+ LEAHLVH S  G
Sbjct  132  EHTLNGKRFALEAHLVHQSQTG  153



>ref|XP_010046439.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85766.1| hypothetical protein EUGRSUZ_B02522 [Eucalyptus grandis]
Length=278

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 96/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  45   LFSIAFLLLSV-THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            +    FL+L++   +  S+EV+DE  F+YD  S+RGP+ WGE+R EW  CS+G MQ+PID
Sbjct  9    VLCTIFLVLALHVGLTTSEEVEDESEFNYDAGSERGPARWGEIRREWGMCSSGSMQSPID  68

Query  222  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
            L S+ V V ++LG ++  Y    ATL+N G+ + L W  G   + +NG  YL +Q HWH 
Sbjct  69   LSSERVQVVAHLGRLKRCYKASNATLKNRGHDITLRWEGGAGSIYVNGTWYLLKQCHWHS  128

Query  399  PSEHVVNGTRYDLEAHLVHVSNDGE  473
            PSEH VNG R+DLE H+VH S +G+
Sbjct  129  PSEHAVNGRRFDLELHMVHESLNGK  153



>ref|XP_007016793.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34412.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 2/144 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +FSI  L+L  +    S+EV+ E  F Y+ENS RGP+ WGE+ PEW  CS G MQ+PID+
Sbjct  12   IFSI-ILVLQYSCPATSREVEYESEFDYNENSARGPARWGEIHPEWRACSNGSMQSPIDM  70

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
             ++ V + S+LG ++  Y    ATL N G+ MML W      + ING  Y  +Q HWH P
Sbjct  71   SNERVNIVSHLGRLKRSYKPCNATLRNRGHDMMLRWDGDAGAIEINGTEYALKQCHWHSP  130

Query  402  SEHVVNGTRYDLEAHLVHVSNDGE  473
            SEH +NG RYDLE HLVH S D +
Sbjct  131  SEHTINGRRYDLEVHLVHESADDK  154



>ref|XP_004139442.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 ref|XP_004170043.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN64831.1| hypothetical protein Csa_1G120470 [Cucumis sativus]
Length=276

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 92/143 (64%), Gaps = 3/143 (2%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +F    LLLS   V  SQEVD+E GF+Y+E+ ++GPSHWGEL+ EW +C  GKMQ+PIDL
Sbjct  13   IFYALVLLLSRPAV--SQEVDNESGFNYNEDGNKGPSHWGELKQEWHECKTGKMQSPIDL  70

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
              + V +       +  Y    ATL N G+ +ML W     Y+ ING RY  +Q HWH P
Sbjct  71   SHQRVQIVHKFVDSKIAYNPTNATLMNRGHDIMLKWSDDAGYIEINGTRYFLKQCHWHSP  130

Query  402  SEHVVNGTRYDLEAHLVHVSNDG  470
            SEH +NG ++ LEAHLVH S++G
Sbjct  131  SEHTINGEKFALEAHLVHQSHNG  153



>ref|XP_003541987.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
 gb|KHN21504.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=274

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            LF+ AFL LS+   + SQEV+DE  FSYDE S+ GPS+WG++ PEW  C+ G MQ+PIDL
Sbjct  11   LFT-AFLFLSLP--VMSQEVEDESEFSYDEKSENGPSNWGDIHPEWSLCNNGSMQSPIDL  67

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
             ++ V + S+LG +Q  Y    AT++N G+ + L W  G  YL IN   Y+ +Q HWH P
Sbjct  68   LNERVQIVSHLGRLQMNYQPSNATIKNRGHDIKLEWVAGAGYLQINETEYVLKQCHWHSP  127

Query  402  SEHVVNGTRYDLEAHLVHVSNDGE  473
            SEH ++G R DLE H+VH +  G+
Sbjct  128  SEHTIDGKRLDLELHMVHETPSGQ  151



>ref|XP_010109502.1| hypothetical protein L484_007522 [Morus notabilis]
 gb|EXC22913.1| hypothetical protein L484_007522 [Morus notabilis]
Length=289

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 95/147 (65%), Gaps = 5/147 (3%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVI--KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            LF I F+ L V H     SQEV+DE  F Y+  S RGP+ WG++RP+W  C+ G MQ+PI
Sbjct  10   LFCIFFIFL-VLHFCPATSQEVEDERAFDYEAWSTRGPARWGQIRPDWRMCNNGTMQSPI  68

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHW  392
            DL  + V V S L  ++ +Y    ATL N G+ MM+ W  G+  Y+ +NG +YL +Q+HW
Sbjct  69   DLMDQRVQVISTLQRLRRFYKPVNATLLNRGHDMMMKWTSGEAGYIDMNGTQYLLQQLHW  128

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH +NG R+DLE H+VH S  G+
Sbjct  129  HSPSEHTINGRRFDLELHMVHQSRTGQ  155



>gb|KJB56185.1| hypothetical protein B456_009G109000 [Gossypium raimondii]
Length=274

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 90/147 (61%), Gaps = 3/147 (2%)
 Frame = +3

Query  42   KLFSIAFLLLSVTH--VIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            + F  +F +L   H   ++SQEV+DE  F Y  NS +GP+ WGE+  EW  CS G MQ+P
Sbjct  7    QFFVCSFFILLALHPFSVRSQEVEDESEFDYGANSTKGPARWGEIHAEWGACSNGTMQSP  66

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            ID+ ++ V + S+LG ++  Y    ATL N G+ MML W      + I G  Y+  Q HW
Sbjct  67   IDMSNERVNIVSHLGRLKKSYKPSNATLRNRGHDMMLRWEDEAGAIEIKGTEYVLHQCHW  126

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH +NG RYDLE H+VH S DG+
Sbjct  127  HSPSEHTINGRRYDLELHMVHESADGK  153



>ref|XP_010050504.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
Length=283

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 90/148 (61%), Gaps = 4/148 (3%)
 Frame = +3

Query  36   MLKLFSIAFLLL--SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            +L  FS+ FLL   S   +  + EV+DE  F Y   S++GP HWGELR EW  C  G+ Q
Sbjct  9    LLSAFSLFFLLAPSSAATLSTAGEVEDEREFDYIAGSEKGPKHWGELRKEWEACKKGETQ  68

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQ-RYLGINGIRYLFRQ  383
            +PIDL S+ V V   LG IQ  Y    ATL+N G+ + L W +G    + ING  Y  +Q
Sbjct  69   SPIDLSSRRVKVIPKLGGIQRSYKPSNATLKNRGHDISLQWDVGNVGSVKINGTEYFLQQ  128

Query  384  VHWHFPSEHVVNGTRYDLEAHLVHVSND  467
             HWH PSEH +NG RY++E H+VHVS D
Sbjct  129  CHWHSPSEHTINGRRYEMELHMVHVSTD  156



>ref|XP_010262876.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=294

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 93/144 (65%), Gaps = 3/144 (2%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  212
            +++    FLL+ + H     SQEV+DE  F Y E S +GP  WGE+ PEW  C  G+MQ+
Sbjct  30   IQILPSVFLLVFILHSGPTTSQEVEDEQEFDYVEGSGKGPEQWGEIHPEWALCKNGEMQS  89

Query  213  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  389
            PIDL +K V + S+LG ++  Y    AT++N G+ +ML W  G  ++ ING +Y+ +Q H
Sbjct  90   PIDLLNKRVQIVSHLGRLKRNYRPSNATIKNRGHDIMLKWVDGAGWIEINGTQYVLQQCH  149

Query  390  WHFPSEHVVNGTRYDLEAHLVHVS  461
            WH PSEH +NG R+DLE H+VH S
Sbjct  150  WHSPSEHTINGKRFDLEVHMVHQS  173



>ref|XP_004139553.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 ref|XP_004160915.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=274

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 3/143 (2%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            F  AF+L+S   +  SQEV+++  F Y+ N  RGP HWG+LRPEW  C+ G+MQ+PIDL 
Sbjct  13   FFFAFILVSWPAM--SQEVENQREFDYNTNGTRGPIHWGDLRPEWHNCNTGQMQSPIDLL  70

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            ++ V + S+    Q  Y    ATL+N G+ +ML W     ++ +N  RY  RQ+HWH PS
Sbjct  71   NQRVRIVSHFTDFQIDYGSSNATLKNRGHDIMLKWRSAAGHMEVNRTRYFLRQIHWHSPS  130

Query  405  EHVVNGTRYDLEAHLVHVSNDGE  473
            EH +NG R+ LEAHLVH S  G+
Sbjct  131  EHTINGRRFALEAHLVHQSQTGK  153



>gb|KDP44023.1| hypothetical protein JCGZ_05490 [Jatropha curcas]
Length=275

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 93/147 (63%), Gaps = 5/147 (3%)
 Frame = +3

Query  45   LFSIAFLLLSV---THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            LF   F+ +S+   T  I SQE++DE  F Y E  ++GPS WGEL PEW  C+ G MQ+P
Sbjct  9    LFFTRFIFISLLLHTLPISSQEIEDEKDFDYYE-GEKGPSRWGELHPEWSACNNGSMQSP  67

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V V S+LG ++  Y    ATL+N G+ MM+ W  G     ING  Y+ +Q HW
Sbjct  68   IDLLNERVEVVSHLGKLKREYKSSNATLKNRGHDMMMEWENGAGITEINGTEYILKQCHW  127

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH VNG R+ LE H+VH S DG+
Sbjct  128  HSPSEHSVNGVRFALELHMVHESLDGK  154



>gb|KGN64826.1| hypothetical protein Csa_1G120420 [Cucumis sativus]
Length=275

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 3/143 (2%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            F  AF+L+S   +  SQEV+++  F Y+ N  RGP HWG+LRPEW  C+ G+MQ+PIDL 
Sbjct  14   FFFAFILVSWPAM--SQEVENQREFDYNTNGTRGPIHWGDLRPEWHNCNTGQMQSPIDLL  71

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            ++ V + S+    Q  Y    ATL+N G+ +ML W     ++ +N  RY  RQ+HWH PS
Sbjct  72   NQRVRIVSHFTDFQIDYGSSNATLKNRGHDIMLKWRSAAGHMEVNRTRYFLRQIHWHSPS  131

Query  405  EHVVNGTRYDLEAHLVHVSNDGE  473
            EH +NG R+ LEAHLVH S  G+
Sbjct  132  EHTINGRRFALEAHLVHQSQTGK  154



>ref|XP_008810946.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=284

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = +3

Query  84   VIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGP  260
            V+ SQEV+DE  FSY+E S  GP HWGE+  EW  C+ G MQ+PIDL  + V ++  LG 
Sbjct  24   VVVSQEVEDEKEFSYEEGSPNGPDHWGEIHKEWAACNNGDMQSPIDLTHERVKIFPGLGR  83

Query  261  IQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  440
            ++  Y    ATL+N G+ +ML W  G  ++ ING  Y   Q HWH PSEH +NG RYDLE
Sbjct  84   LKRSYKASNATLKNRGHDIMLKWAEGGGWIRINGTEYQLMQCHWHSPSEHSINGKRYDLE  143

Query  441  AHLVHVSNDGEDC  479
             H+VH S+D ++ 
Sbjct  144  IHMVHQSSDQKNA  156



>gb|KHG27075.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=274

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 91/145 (63%), Gaps = 2/145 (1%)
 Frame = +3

Query  45   LFSIAFLLLSV-THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            L    F+LL++ +  ++SQE++DE  F Y  NS +GP+ WGE+  EW  CS G MQ+PID
Sbjct  9    LVCCFFILLALHSFSVRSQEIEDESEFDYGANSTKGPARWGEIHAEWGACSNGTMQSPID  68

Query  222  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
            + ++ V + S+LG ++  Y    ATL N G+ MML W      + I G  Y+  Q HWH 
Sbjct  69   MSNERVNIVSHLGRLKKSYKPSNATLRNRGHDMMLRWEDEAGAIEIKGREYVLHQCHWHS  128

Query  399  PSEHVVNGTRYDLEAHLVHVSNDGE  473
            PSEH +NG RYDLE H+VH S DG+
Sbjct  129  PSEHTINGRRYDLELHMVHESADGK  153



>ref|XP_009356885.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 91/142 (64%), Gaps = 2/142 (1%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            F  A +LL+  H   S+EV+D+  F+Y+E+S++GP  WGE+R EW  CS G MQ+PIDL 
Sbjct  13   FLFALVLLNSRHAT-SEEVEDQREFNYEEDSEKGPLRWGEIRQEWSMCSKGSMQSPIDLS  71

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
               V + S+LG +++ Y    ATL+N G+ MML W     ++ +NG  Y  +Q HWH  S
Sbjct  72   DDRVELVSHLGILKSNYRPCNATLKNRGHDMMLKWETDAGFILLNGTLYKLKQCHWHASS  131

Query  405  EHVVNGTRYDLEAHLVHVSNDG  470
            EH +NG R+DLE HLVH S  G
Sbjct  132  EHTINGKRFDLEVHLVHESATG  153



>ref|XP_008462817.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 2/150 (1%)
 Frame = +3

Query  24   EDMDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  203
            +  D+L   S  F  L V     SQEV+++  F Y+ N  RGP+HWG++RPEW  C  G+
Sbjct  5    QSFDLL-FCSSFFAFLLVLWPAMSQEVENQREFDYNTNGTRGPAHWGDIRPEWHTCRTGQ  63

Query  204  MQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFR  380
            MQ+PIDL ++ V + S+   ++  Y    ATL+N G+ +ML W     Y+ +N  RY  R
Sbjct  64   MQSPIDLLNQRVRIVSHFTDLKINYSSSNATLKNRGHDIMLQWSGSAGYMEVNRSRYFLR  123

Query  381  QVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            Q+HWH PSEH +NG R+ LEAHLVH S  G
Sbjct  124  QIHWHSPSEHTINGRRFALEAHLVHQSQTG  153



>ref|XP_008462825.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Cucumis melo]
Length=271

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 90/139 (65%), Gaps = 3/139 (2%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
            AFLL+S   +  SQEV+DE  F Y+E  ++GP+HWG+L+PEW  C  G+MQ+PIDL  + 
Sbjct  16   AFLLVSRLAI--SQEVEDETEFDYNEEGEKGPTHWGDLKPEWHSCKTGEMQSPIDLLHER  73

Query  237  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
            V + S    I   Y    ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH 
Sbjct  74   VRIVSLFTDIDFDYKPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHT  133

Query  414  VNGTRYDLEAHLVHVSNDG  470
            +NG R+ LEAHLVH S +G
Sbjct  134  INGKRFALEAHLVHQSQNG  152



>ref|XP_010109499.1| hypothetical protein L484_007519 [Morus notabilis]
 gb|EXC22910.1| hypothetical protein L484_007519 [Morus notabilis]
Length=274

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIK--SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            + ++F  +F  + V H     S EV+DE  F+Y++ S++GP  WGE+RPEW  CS G +Q
Sbjct  5    VTQIFLCSFFTILVLHFCPALSDEVEDESEFNYEQGSEKGPDRWGEIRPEWSTCSNGTLQ  64

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQ  383
            +PIDL  K V V S+L   +  Y    ATL+N G+ +ML W  G+  Y+ ING +YL +Q
Sbjct  65   SPIDLLDKRVEVISHLEITKRNYKPSNATLKNRGHDIMLKWNSGEAGYIEINGTQYLIQQ  124

Query  384  VHWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
             HWH PSEH +NG ++DLE H VH +  G+
Sbjct  125  CHWHSPSEHTINGNKFDLELHAVHQTPTGQ  154



>ref|XP_010050537.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89340.1| hypothetical protein EUGRSUZ_A01633 [Eucalyptus grandis]
Length=283

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 86/141 (61%), Gaps = 5/141 (4%)
 Frame = +3

Query  60   FLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES  230
            F LL++  V  S    EV+DE  F Y   S +GP HWGELR EW  C  G+MQ+PIDL S
Sbjct  16   FFLLALRSVAASSMPGEVEDEREFDYIPKSKKGPRHWGELRKEWEACKKGEMQSPIDLSS  75

Query  231  KPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPS  404
            + V V   LG I+  Y    A L+N G+ + L W LG    + ING R+  +Q HWH PS
Sbjct  76   RRVKVIPKLGEIKRSYKPSKAILKNRGHDISLQWDLGSAGSIKINGTRHFLQQFHWHSPS  135

Query  405  EHVVNGTRYDLEAHLVHVSND  467
            EH +NG RY+LE H+VHV+ D
Sbjct  136  EHTINGRRYELELHMVHVTTD  156



>ref|XP_008385339.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 93/142 (65%), Gaps = 2/142 (1%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  224
            F IA +LL+  H   S+EV+D+  F+Y+E+S++GP  WGE+R +W  CS G MQ+PIDL 
Sbjct  13   FLIALVLLNSRHAT-SEEVEDQREFNYEEDSEKGPVRWGEIRQDWSMCSKGSMQSPIDLL  71

Query  225  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            + +  + S+LG +++ Y    ATL+N G+ MML W     ++ +NG  Y  +Q HWH  S
Sbjct  72   DDRVELVSHLGILKSNYRPCNATLKNRGHDMMLKWEADPGFILLNGTLYKLKQCHWHASS  131

Query  405  EHVVNGTRYDLEAHLVHVSNDG  470
            EH +NG R+DLE HLVH S  G
Sbjct  132  EHTINGKRFDLEVHLVHESATG  153



>ref|XP_004160914.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN64829.1| hypothetical protein Csa_1G120450 [Cucumis sativus]
Length=275

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 91/143 (64%), Gaps = 3/143 (2%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            F  AFLL  V     SQEV+++  F Y+ N  RGP+HWG LRPEW  C+ G+MQ+PIDL 
Sbjct  14   FFFAFLL--VPWPAMSQEVENQREFDYNANGTRGPAHWGVLRPEWHTCNTGQMQSPIDLL  71

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            ++ V + S+   ++  Y    ATL+N G+ +ML W     Y+ +N  +Y  RQ+HWH PS
Sbjct  72   NQRVRIVSHFTDLKINYSSSNATLKNRGHDIMLQWSGRAGYMEVNKTQYFLRQIHWHSPS  131

Query  405  EHVVNGTRYDLEAHLVHVSNDGE  473
            EH +NG R+ LEAHLVH S  G+
Sbjct  132  EHTINGRRFALEAHLVHQSQTGK  154



>ref|XP_006594167.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=282

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 88/142 (62%), Gaps = 2/142 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +  +  +LL  T  I +QEV+DE  F Y + S++GPSHWGEL+ EW  C +GKMQ+PIDL
Sbjct  19   MIILVTILLHSTTWISAQEVEDESEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDL  78

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
             S  V V   LG ++ YY    AT++N G+ + L W      + ING  +   Q HWH P
Sbjct  79   SSHRVRVVPKLGELKKYYTPQNATIKNRGHDIELKWEDAGS-ININGTEFFLHQCHWHSP  137

Query  402  SEHVVNGTRYDLEAHLVHVSND  467
            SEH +NG RYDLE H+VH S +
Sbjct  138  SEHTINGRRYDLELHMVHESKN  159



>ref|XP_002282495.2| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI16339.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 90/149 (60%), Gaps = 3/149 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIK--SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            M  +   +F ++ V H     SQEV+DE  F Y++ SD+GP  WGE+  EW  C  G MQ
Sbjct  5    MTHILLCSFFIVLVLHACPAISQEVEDEKEFDYEKGSDKGPDKWGEIHEEWSTCKHGNMQ  64

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            +PIDL  + V V S+LG +Q  Y    ATL+N G+ M LSW      + ING +Y  +Q 
Sbjct  65   SPIDLLHERVQVVSHLGRLQRSYKPSQATLKNRGHDMKLSWEGDAGSIQINGTKYELKQC  124

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            HWH PSEH VNG R+DLE H++H +  G+
Sbjct  125  HWHSPSEHTVNGKRFDLELHMLHETPSGK  153



>ref|XP_002529418.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32944.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = +3

Query  93   SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  269
            SQEV++E  F Y++N +RGP+ WGEL  EW  CS G MQ+PID+ ++ V V S+LG +  
Sbjct  26   SQEVENEREFDYEKNGERGPARWGELHEEWRACSNGSMQSPIDMLNERVEVVSHLGRLNR  85

Query  270  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
             Y    ATL+N G+ MML W  G   + ING  Y+ RQ HWH PSEH ++G R+ LE H+
Sbjct  86   SYEPSNATLKNRGHDMMLEWENGAGTIEINGTEYILRQCHWHSPSEHTLDGRRFALELHM  145

Query  450  VHVSNDGE  473
            VH S DG+
Sbjct  146  VHESPDGK  153



>ref|XP_004515925.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=279

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 89/148 (60%), Gaps = 1/148 (1%)
 Frame = +3

Query  21   IEDMDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  200
            I  M +  L  +  +L+  T +  +QEV+DE  F Y + S +GPS WGEL+ EW  C  G
Sbjct  6    ILTMFLPNLLILVTILIHSTTLTIAQEVEDESEFDYIKESKKGPSRWGELKKEWASCKNG  65

Query  201  KMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLF  377
            K+Q+PIDL S  V + +NLG ++ YY    AT++N G+ + + W      + ING  +  
Sbjct  66   KLQSPIDLSSHRVRIVTNLGKLKKYYKPQNATIKNRGHDIEVKWEGDAGSININGTEFFL  125

Query  378  RQVHWHFPSEHVVNGTRYDLEAHLVHVS  461
             Q HWH PSEH +NG RYD+E H+VH S
Sbjct  126  HQCHWHSPSEHTINGRRYDMELHMVHES  153



>ref|XP_008227263.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Prunus mume]
Length=263

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 90/146 (62%), Gaps = 3/146 (2%)
 Frame = +3

Query  39   LKLFSIAFLLL--SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  212
            + +FS+ FL+L    +  + +QEV+DE  F Y + S +GP  WGE++ EW  C  G MQ+
Sbjct  9    ISIFSVLFLVLFSQYSTPVTAQEVEDEREFDYLQGSGKGPKQWGEMKKEWAACKNGGMQS  68

Query  213  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  389
            PIDL S+ V +  NLG +   Y    AT++N G+ + + W      L ING  YL +Q H
Sbjct  69   PIDLSSQRVKLIPNLGKLNTAYKPCNATVKNRGHDISIEWVGDAGSLKINGTEYLLKQCH  128

Query  390  WHFPSEHVVNGTRYDLEAHLVHVSND  467
            WH PSEH +NG RYD+E H+VH+S D
Sbjct  129  WHSPSEHSINGRRYDMELHMVHLSPD  154



>emb|CDX95097.1| BnaC05g05740D [Brassica napus]
Length=274

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 7/154 (5%)
 Frame = +3

Query  30   MDMLKLFSIAFLL-LSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            M    +  I FL+ +S+T V  S    EV+DE  FSY++  ++GP  WG L+PEW  C  
Sbjct  1    MKRPSIVCIVFLIVISITTVSSSPDHGEVEDETEFSYEKGGEKGPEKWGTLKPEWKMCGN  60

Query  198  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIR  368
            G MQ+PIDL  K V +  NLGP++ +Y+   AT++N G+ +ML +  G   +G  ING  
Sbjct  61   GTMQSPIDLTDKRVFIDHNLGPLRGHYLPSNATIKNRGHDIMLEFEGGNAGIGITINGTV  120

Query  369  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DG
Sbjct  121  YQLQQLHWHSPSEHTINGKRFVLEEHMVHQSKDG  154



>gb|KHN39018.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=278

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            I +QEV+DE  F Y + S++GPSHWGEL+ EW  C +GKMQ+PIDL S  V V   LG +
Sbjct  27   INAQEVEDESEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDLSSHRVRVVPKLGEL  86

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
            + YY    AT++N G+ + L W      + ING  +   Q HWH PSEH +NG RYDLE 
Sbjct  87   KKYYKPQNATVKNRGHDIELKWEGDAGSININGTEFFLHQCHWHSPSEHTINGRRYDLEL  146

Query  444  HLVHVSN  464
            H+VH S 
Sbjct  147  HMVHESK  153



>ref|XP_006417733.1| hypothetical protein EUTSA_v10008451mg [Eutrema salsugineum]
 gb|ESQ36086.1| hypothetical protein EUTSA_v10008451mg [Eutrema salsugineum]
Length=274

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 99/154 (64%), Gaps = 10/154 (6%)
 Frame = +3

Query  39   LKLFSIA----FLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            +K+ SI     F+ +S+T V       EV+DE  FSY++N ++GP +WG L+PEW  C  
Sbjct  1    MKISSIGCLFFFIFVSITSVSTQPGHGEVEDETEFSYEKNGEKGPENWGTLKPEWEMCGN  60

Query  198  GKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIR  368
            GKMQ+PIDL +K V+   NLG ++++Y+   AT++N G+ +ML +  G   LG  ING  
Sbjct  61   GKMQSPIDLTAKRVLIDHNLGSLRSHYLPYNATIKNRGHDIMLKFEGGNAGLGIVINGTA  120

Query  369  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            Y  +Q+HWH PSEH + G R+ LE H+VH S DG
Sbjct  121  YQLQQIHWHTPSEHTIGGRRFVLEEHVVHESKDG  154



>gb|KGN64825.1| hypothetical protein Csa_1G120410 [Cucumis sativus]
Length=254

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = +3

Query  75   VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNL  254
            ++ V  SQEV+DE  F Y+E  ++GP+HWG+L+PEW  C  G MQ+PIDL  + V  ++L
Sbjct  2    ISRVAISQEVEDETEFDYNEEGEKGPTHWGDLKPEWHSCKTGHMQSPIDLLHERVRIASL  61

Query  255  -GPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRY  431
               I+  Y    ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH +NG R+
Sbjct  62   FTNIEFNYKPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHTINGRRF  121

Query  432  DLEAHLVHVSNDG  470
             LEAHLVH S +G
Sbjct  122  ALEAHLVHQSQNG  134



>ref|XP_003535188.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=278

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            I +QEV+DE  F Y + S++GPSHWGEL+ EW  C +GKMQ+PIDL S  V V   LG +
Sbjct  27   INAQEVEDESEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDLSSHRVRVVPKLGEL  86

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
            + YY    AT++N G+ + L W      + ING  +   Q HWH PSEH +NG RYDLE 
Sbjct  87   KKYYKPQNATVKNRGHDIELKWEGDAGSININGTEFFLHQCHWHSPSEHTINGRRYDLEL  146

Query  444  HLVHVSN  464
            H+VH S 
Sbjct  147  HMVHESK  153



>ref|XP_008227262.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Prunus mume]
Length=281

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 90/146 (62%), Gaps = 3/146 (2%)
 Frame = +3

Query  39   LKLFSIAFLLL--SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  212
            + +FS+ FL+L    +  + +QEV+DE  F Y + S +GP  WGE++ EW  C  G MQ+
Sbjct  9    ISIFSVLFLVLFSQYSTPVTAQEVEDEREFDYLQGSGKGPKQWGEMKKEWAACKNGGMQS  68

Query  213  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  389
            PIDL S+ V +  NLG +   Y    AT++N G+ + + W      L ING  YL +Q H
Sbjct  69   PIDLSSQRVKLIPNLGKLNTAYKPCNATVKNRGHDISIEWVGDAGSLKINGTEYLLKQCH  128

Query  390  WHFPSEHVVNGTRYDLEAHLVHVSND  467
            WH PSEH +NG RYD+E H+VH+S D
Sbjct  129  WHSPSEHSINGRRYDMELHMVHLSPD  154



>ref|XP_007206520.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
 gb|EMJ07719.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
Length=275

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 92/144 (64%), Gaps = 2/144 (1%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  224
            F I  +LL ++    S EV+DE  F+Y+++S++GP+ WG++R EW  C+ G MQ+PIDL 
Sbjct  13   FLIVLVLL-LSCQATSDEVEDEREFNYEDDSEKGPARWGKIRQEWSMCNKGSMQSPIDLL  71

Query  225  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            + +  V S+LG +Q  Y    ATLEN G+ +ML W     ++ ING  Y  +Q HWH PS
Sbjct  72   DDRVEVVSDLGRLQGSYRPRNATLENRGHDIMLKWEADAGFIRINGTLYQLKQCHWHSPS  131

Query  405  EHVVNGTRYDLEAHLVHVSNDGED  476
            EH VN   +DLE HLVH S  G++
Sbjct  132  EHTVNDKSFDLEVHLVHQSPTGKN  155



>ref|XP_010443286.1| PREDICTED: alpha carbonic anhydrase 8-like [Camelina sativa]
 ref|XP_010443287.1| PREDICTED: alpha carbonic anhydrase 8-like [Camelina sativa]
 ref|XP_010443289.1| PREDICTED: alpha carbonic anhydrase 8-like [Camelina sativa]
Length=355

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYY  275
            EV+DE  FSY++   +GP+ WG ++ EW  C  GKMQ+PIDL  K VV +N LG +++ Y
Sbjct  99   EVEDETEFSYEKKGKKGPAKWGTIKEEWKMCGTGKMQSPIDLRDKNVVVTNKLGSLRSQY  158

Query  276  MRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +    T++N G+G+ML +  G + +GI  NG +Y  +Q+HWH PSEH +NG RY LE HL
Sbjct  159  LPSNTTIKNRGHGIMLKFKGGNKGIGITVNGTKYQLQQLHWHSPSEHTINGKRYALEKHL  218

Query  450  VHVSND  467
            VH S D
Sbjct  219  VHESED  224



>ref|XP_009391366.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 86/139 (62%), Gaps = 2/139 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            +AF LL  T +  SQEV+DE  FSY   S+ GP HWGE+  +W  C  G MQ+PIDL  K
Sbjct  13   VAFFLLQAT-LAASQEVEDEKEFSYVTGSELGPEHWGEIHKDWVACGDGHMQSPIDLSHK  71

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  410
             V +  NLG ++  Y   +A +EN G+ +ML W      + ING +Y  +Q+HWH PSEH
Sbjct  72   RVRILPNLGHLRRSYRPAMAIVENRGHDIMLKWEDEAGVIWINGTKYALKQLHWHSPSEH  131

Query  411  VVNGTRYDLEAHLVHVSND  467
             +NG RY LE H+VH S D
Sbjct  132  TINGRRYSLELHMVHESAD  150



>gb|KFK43123.1| hypothetical protein AALP_AA1G083400 [Arabis alpina]
Length=275

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 97/155 (63%), Gaps = 8/155 (5%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKSQ-----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  194
            M +  +  + FL++ ++  I S      EV+DE  F+YDE  D+GPS WG L+PEW  C 
Sbjct  1    MKISSVGCVLFLIIFISVTIVSSSPGHGEVEDESEFNYDEQGDKGPSKWGTLKPEWAMCG  60

Query  195  AGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQ--RYLGINGI  365
             GKMQ+PIDL    V++  +LG +++ Y+   ATL+N G+ +M+ +  G   + + ING 
Sbjct  61   KGKMQSPIDLCDISVLFDHDLGYLRSSYLPSNATLKNRGHDIMMKFEGGNAGKGITINGT  120

Query  366  RYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
             Y  +Q+HWH PSEH +NG R+ LE H+VH S DG
Sbjct  121  DYQLQQIHWHSPSEHTINGKRFFLEKHMVHESKDG  155



>ref|XP_010458030.1| PREDICTED: alpha carbonic anhydrase 5 [Camelina sativa]
Length=274

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  39   LKLFSIA--FLLLSVTHVIKSQ-----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            +K+ SI   FLL+ ++  I S      EV+DE  F+Y++N ++GP +WG L+PEW  C  
Sbjct  1    MKISSIGCVFLLIFISITIVSSSPDQGEVEDEAQFNYEKNGEKGPENWGRLKPEWTMCGK  60

Query  198  GKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIR  368
            G MQ+PIDL  K V+   NLG +++ Y+   AT++N G+ +ML +  G    G  ING  
Sbjct  61   GNMQSPIDLTDKRVLVDHNLGYLRSQYLPSNATIKNRGHDIMLKFEGGNAGSGITINGTE  120

Query  369  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGEDC  479
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DG + 
Sbjct  121  YKLQQIHWHSPSEHTINGKRFILEEHMVHQSKDGRNA  157



>gb|KEH16352.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=274

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 89/148 (60%), Gaps = 8/148 (5%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVI-------KSQEVDDEWGFSYDENSDRGPSHWGELRP-EWWQC  191
            M KL S+  +   +T ++        S+EV+DE  F+YDE S  GP +WG ++P EW+ C
Sbjct  1    MAKLTSLVLIFSLLTAIVLLSSCPAMSEEVEDETEFNYDEASPLGPPNWGHIKPNEWFLC  60

Query  192  SAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
              G MQ+PIDL  + V  SNLGP+Q  Y    ATL+N G+ + +       YL I+G +Y
Sbjct  61   KNGTMQSPIDLRDEVVQISNLGPLQTNYNPSNATLKNRGHDVKVELMSNSSYLQIDGTQY  120

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
               Q HWH PSEH +NG R+DLE HLVH
Sbjct  121  ELLQFHWHTPSEHTINGVRFDLELHLVH  148



>ref|XP_010458032.1| PREDICTED: alpha carbonic anhydrase 7 [Camelina sativa]
Length=276

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            + LFSI  + +S++    S  EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+P
Sbjct  13   VALFSIFTINVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGELKPEWEMCGKGEMQSP  72

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING +Y  +Q+HW
Sbjct  73   IDLMNERVNIGSHLGRLNRDYQPSNATLKNRGHDIMLKFEDGAGSIKINGFQYELQQLHW  132

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDG  470
            H PSEH VNG R+ LE H+VH    G
Sbjct  133  HSPSEHTVNGRRFALELHMVHEGKKG  158



>ref|XP_004506040.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=298

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +3

Query  36   MLKLFSI--AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            ++ +FS+  A +LLS    I SQE++++  FSYDE+S+ GP HWG+++PEW  C  G+ Q
Sbjct  11   LVSIFSLLTALVLLSSCPAI-SQELENQNEFSYDEDSEIGPQHWGDIKPEWSLCKYGERQ  69

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            +PIDL +K V + S LGP+Q       A L+N G+ + L +     YL I+GI+Y  +Q 
Sbjct  70   SPIDLINKLVEIVSYLGPLQIRSKPSNAILKNRGHDIKLEFTENSNYLLIDGIQYALKQF  129

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            HWH PSEH +NG R DLE H+VH +  G+
Sbjct  130  HWHSPSEHTINGRRLDLELHMVHQTPSGQ  158



>ref|XP_007144378.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
 gb|ESW16372.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
Length=279

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 86/141 (61%), Gaps = 1/141 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            L  +A ++L  T  I +QEV+DE  F Y + S++GPS WGEL+ EW  C +GKMQ+PIDL
Sbjct  14   LIILAIIVLHSTPWISAQEVEDESEFDYLKGSEKGPSRWGELKKEWETCKSGKMQSPIDL  73

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
             S  V V   LG ++ +Y    AT++N G+ + L W      + IN   +   Q HWH P
Sbjct  74   SSHRVKVVPKLGELKKHYKPQNATVKNRGHDIELKWGEDAGSININATDFFLHQCHWHSP  133

Query  402  SEHVVNGTRYDLEAHLVHVSN  464
            SEH +NG RYDLE H+VH S 
Sbjct  134  SEHTINGRRYDLELHMVHESK  154



>gb|ACU22677.1| unknown [Glycine max]
Length=196

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            +  L+L    VI S  V+DE  F+YD  S RGP +WG ++PEW  C  G MQ+PI+L +K
Sbjct  14   LTALVLLPFPVIMSHLVEDESEFNYDVKSKRGPYNWGNIKPEWSICKNGSMQSPINLLNK  73

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  410
             V +  +LG +   Y    ATL N G+ +ML W  G  YL IN  +Y+ +Q HWH PSEH
Sbjct  74   RVQIAPHLGKLHINYQPSNATLRNRGHNIMLEWLAGTSYLQINETQYVLKQFHWHSPSEH  133

Query  411  VVNGTRYDLEAHLVHVSNDGE  473
             ++G R+DLE H+VH ++ GE
Sbjct  134  TIDGRRFDLELHMVHEASSGE  154



>ref|XP_010488317.1| PREDICTED: alpha carbonic anhydrase 5 [Camelina sativa]
Length=274

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  39   LKLFSIA--FLLLSVTHVIKSQ-----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            +K+ SI   FLL+ ++  I S      EV+DE  F+Y++N ++GP +WG L+PEW  C  
Sbjct  1    MKISSIGCVFLLIFISITIVSSSTDQGEVEDEAQFNYEKNGEKGPENWGRLKPEWAICGK  60

Query  198  GKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIR  368
            G MQ+PIDL  K V+   NLG +++ Y+   AT++N G+ +ML +  G    G  ING  
Sbjct  61   GNMQSPIDLTDKRVLVDHNLGYLRSQYLPSNATIKNRGHDIMLKFEGGNAGSGITINGTE  120

Query  369  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGEDC  479
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DG + 
Sbjct  121  YKLQQIHWHSPSEHTINGKRFILEEHMVHQSKDGRNA  157



>gb|KHN48240.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=282

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 87/142 (61%), Gaps = 2/142 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +  +  +LL  T  I +QEV+DE  F Y + S++GPSHWG L+ EW  C +GKMQ+PIDL
Sbjct  19   MIILVTILLHSTTWISAQEVEDESEFDYIKGSEKGPSHWGGLKKEWETCKSGKMQSPIDL  78

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
             S  V V   LG ++ YY    AT++N G+ + L W      + ING  +   Q HWH P
Sbjct  79   SSHRVRVVPKLGELKKYYTPQNATIKNRGHDIELKWEDAGS-ININGTEFFLHQCHWHSP  137

Query  402  SEHVVNGTRYDLEAHLVHVSND  467
            SEH +NG RYDLE H+VH S +
Sbjct  138  SEHTINGRRYDLELHMVHESKN  159



>ref|XP_006845947.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
 gb|ERN07622.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
Length=253

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 81/128 (63%), Gaps = 2/128 (2%)
 Frame = +3

Query  102  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  278
            V+DE  F Y E+S+RGP HWGEL PEW  CS G MQ+PIDL  + V V  NLG +Q  Y 
Sbjct  2    VEDEREFDYLEDSERGPKHWGELYPEWRACSNGDMQSPIDLLHERVEVLPNLGRLQRKYK  61

Query  279  RDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
               A L+N G+ +ML W   G   L IN   Y+ +Q HWH PSEH  NG+RY LE HLVH
Sbjct  62   PAKAILKNRGHDIMLKWGKSGAGTLEINQTEYVLKQCHWHSPSEHTFNGSRYHLEVHLVH  121

Query  456  VSNDGEDC  479
             S DG++ 
Sbjct  122  QSKDGKNA  129



>ref|XP_006304810.1| hypothetical protein CARUB_v10012428mg [Capsella rubella]
 gb|EOA37708.1| hypothetical protein CARUB_v10012428mg [Capsella rubella]
Length=274

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = +3

Query  42   KLFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            ++F + F+ +++      Q EV+DE  F+Y++  D+GP +WG+L+PEW  C  G MQ+PI
Sbjct  8    RVFLLIFISITLVSSSPDQGEVEDEMQFNYEKKGDKGPENWGKLKPEWGMCGKGNMQSPI  67

Query  219  DLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVH  389
            DL  K V+    LG +++ Y+   AT++N G+ +ML +  G   LG  ING  Y  +Q+H
Sbjct  68   DLTDKRVLVDHKLGYLRSQYLPSNATIKNRGHDIMLKFEGGNAGLGITINGTEYKLQQIH  127

Query  390  WHFPSEHVVNGTRYDLEAHLVHVSNDGEDC  479
            WH PSEH +NG R+ LE H+VH S DG + 
Sbjct  128  WHSPSEHTINGKRFVLEEHMVHQSKDGRNA  157



>ref|XP_008442725.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=274

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 90/143 (63%), Gaps = 2/143 (1%)
 Frame = +3

Query  42   KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            +  ++ F +  +T  I +QEV+DE  F Y + S +GPS WG+++ EW +C  G MQ+PID
Sbjct  7    RACALVFFIFILTSAI-AQEVEDESEFDYRKGSKKGPSKWGDIKREWEKCKNGNMQSPID  65

Query  222  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
            L +K V V  +LG ++N Y   +A ++N G+ + + W      + ING  YL +Q HWH 
Sbjct  66   LSNKRVKVVKSLGQLKNKYKPSIAIIKNRGHDISVKWEEDAGSIEINGTEYLLQQAHWHS  125

Query  399  PSEHVVNGTRYDLEAHLVHVSND  467
            PSEH +NG  YDLE HLVH S++
Sbjct  126  PSEHTLNGRSYDLEVHLVHQSSN  148



>ref|XP_009132759.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=268

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 92/149 (62%), Gaps = 2/149 (1%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM  206
            M+   +  + F+LL++     +Q EV+DE  FSY+ N + GP  WG+L+PEW  C  G+M
Sbjct  1    MEKSSIQCLLFILLTIISCSNAQREVEDESEFSYEGNQENGPEKWGKLKPEWKMCGKGEM  60

Query  207  QTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ  383
            Q+PIDL +K V + S+LG +   Y    ATL N G+ MM+ +  G   + IN I Y   Q
Sbjct  61   QSPIDLMNKRVKIVSHLGRLTRDYKPANATLRNRGHDMMVRFEEGPGSIKINNIEYQLHQ  120

Query  384  VHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            +HWH PSEH +NG R+ LE H+VH S +G
Sbjct  121  LHWHSPSEHTINGRRFALELHMVHESING  149



>ref|XP_010488326.1| PREDICTED: alpha carbonic anhydrase 7 [Camelina sativa]
Length=276

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 2/146 (1%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            + LFSI  + +S++    S  EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+P
Sbjct  13   VALFSIFTINVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGELKPEWEMCGKGEMQSP  72

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V + S+LG +   Y    ATL+N G+ +ML    G   + ING +Y  +Q+HW
Sbjct  73   IDLMNERVNIGSHLGRLNRDYQPSNATLKNRGHDIMLKLEDGAGSIKINGFQYELQQLHW  132

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDG  470
            H PSEH VNG R+ LE H+VH    G
Sbjct  133  HSPSEHTVNGRRFALELHMVHEGKKG  158



>gb|KDO81077.1| hypothetical protein CISIN_1g038655mg [Citrus sinensis]
Length=275

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 92/143 (64%), Gaps = 3/143 (2%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            F    LLLS + +  S+EVD+E  F+Y++  + GP  WGE+  EW  C  G MQ+PIDL 
Sbjct  13   FFAVILLLSGSAM--SKEVDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLL  70

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            ++ V V S+LG ++  Y    ATL N G+ +ML W  G   + ING +Y+ +Q HWH PS
Sbjct  71   NERVEVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPS  130

Query  405  EHVVNGTRYDLEAHLVHVSNDGE  473
            EH ++G R+ LEAH+VH S+DG+
Sbjct  131  EHTIDGKRFALEAHMVHESHDGK  153



>ref|XP_006409842.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
 gb|ESQ51295.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
Length=271

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 91/153 (59%), Gaps = 7/153 (5%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIK----SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            MD   +    FLLL++   I      +EV+DE  FSY+ N + GP  WG+L+PEW  C  
Sbjct  1    MDKSAIQCFFFLLLTIIVTISFSNAQREVEDESEFSYERNEENGPEKWGKLKPEWKMCGK  60

Query  198  GKMQTPIDL--ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
            G+MQ+PIDL  E   VVY +LG +   Y    ATL+N G+ MML +  G   + ING  Y
Sbjct  61   GEMQSPIDLMNERVRVVY-HLGRLTRDYKPSNATLKNRGHDMMLRFEEGSGSIKINGTEY  119

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
               Q+HWH PSEH +NG R+ +E HLVH S +G
Sbjct  120  QLLQLHWHSPSEHTINGRRFAMELHLVHESING  152



>ref|XP_006473002.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 92/143 (64%), Gaps = 3/143 (2%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            F    LLLS + +  S+EVD+E  F+Y++  + GP  WGE+  EW  C  G MQ+PIDL 
Sbjct  13   FFAVILLLSGSAM--SKEVDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLL  70

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            ++ V V S+LG ++  Y    ATL N G+ +ML W  G   + ING +Y+ +Q HWH PS
Sbjct  71   NERVEVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPS  130

Query  405  EHVVNGTRYDLEAHLVHVSNDGE  473
            EH ++G R+ LEAH+VH S+DG+
Sbjct  131  EHTIDGKRFALEAHMVHESHDGK  153



>ref|XP_010414580.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 93/157 (59%), Gaps = 10/157 (6%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKS--------QEVDDEWGFSYDENSDRGPSHWGELRPEWW  185
            MD   +    F++L++   I S        +EV+DE  FSY+ N + GP +WG+L+PEW 
Sbjct  1    MDKSSIRCFFFIILTILGTIVSCSSAAKNDREVEDESEFSYEHNKENGPKNWGKLKPEWN  60

Query  186  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGIN  359
             C  G+MQ+PIDL +K V + S+LG +   Y    ATL+N G+ MML +   G     IN
Sbjct  61   MCGKGEMQSPIDLTNKRVKLVSHLGKLSRNYKPSNATLKNRGHDMMLKFGEEGAGSFKIN  120

Query  360  GIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            G  Y   Q+HWH PSEH VNG R+ LE H+VH S +G
Sbjct  121  GTEYKLLQLHWHSPSEHTVNGKRFALELHMVHESKNG  157



>ref|XP_008462835.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Cucumis melo]
Length=270

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 89/139 (64%), Gaps = 4/139 (3%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
            AFLL+S   +  SQEVD E  F Y+E  ++GP+HWG+L+PEW  C  G+MQ+PIDL  + 
Sbjct  16   AFLLVSRLAI--SQEVD-ETEFDYNEEGEKGPTHWGDLKPEWHSCKTGEMQSPIDLLHER  72

Query  237  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
            V + S    I   Y    ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH 
Sbjct  73   VRIVSLFTDIDFDYKPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHT  132

Query  414  VNGTRYDLEAHLVHVSNDG  470
            +NG R+ LEAHLVH S +G
Sbjct  133  INGKRFALEAHLVHQSQNG  151



>ref|XP_006433902.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
 gb|ESR47142.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
Length=275

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 90/143 (63%), Gaps = 3/143 (2%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  224
            F    LLLS + +  S+E D+E  F+Y++  + GP  WGE+  EW  C  G MQ+PIDL 
Sbjct  13   FFAVILLLSGSAM--SKEFDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLL  70

Query  225  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
              + VV S+LG ++  Y    ATL N G+ +ML W  G   + ING +Y+ +Q HWH PS
Sbjct  71   NERVVVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPS  130

Query  405  EHVVNGTRYDLEAHLVHVSNDGE  473
            EH ++G R+ LEAH+VH S+DG+
Sbjct  131  EHTIDGKRFALEAHMVHESHDGK  153



>ref|XP_006281537.1| hypothetical protein CARUB_v10027638mg [Capsella rubella]
 gb|EOA14435.1| hypothetical protein CARUB_v10027638mg [Capsella rubella]
Length=314

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 83/126 (66%), Gaps = 3/126 (2%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYY  275
            EV+DE  FSY++   +GP+ WG L+ EW  C  GKMQ+PIDL  K VV +  LG +++ Y
Sbjct  97   EVEDETEFSYEKKGKKGPAKWGTLKEEWKMCGKGKMQSPIDLRDKNVVVTHRLGSLRSQY  156

Query  276  MRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +    T++N G+ +ML +  G + +G  +NG RY  +Q+HWH PSEH +NG RY LE HL
Sbjct  157  LPSNTTIKNRGHDIMLKFKGGNKGIGVTVNGTRYKLQQLHWHSPSEHTINGKRYALEKHL  216

Query  450  VHVSND  467
            VH S D
Sbjct  217  VHESED  222



>ref|XP_003539200.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=276

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 2/140 (1%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
            A + LS   +I S EV+DE  F+YD  S+ GP +WG ++PEW  C  G MQ+PIDL ++ 
Sbjct  16   ALVFLSCP-LIMSHEVEDESEFNYDVKSEIGPFNWGHIKPEWSLCKIGSMQSPIDLLNER  74

Query  237  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
            V + S+LG +Q  Y    ATL+N G+ + L W  G  +L ING  Y+ +Q HWH PSEH 
Sbjct  75   VQIVSHLGTLQMNYQPSNATLKNRGHDIKLGWLAGTSFLQINGTEYVLKQFHWHSPSEHT  134

Query  414  VNGTRYDLEAHLVHVSNDGE  473
            ++G R DLE H+VH +  G+
Sbjct  135  IDGRRLDLELHMVHETPSGQ  154



>ref|XP_003538184.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Glycine max]
 gb|KHN38744.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=279

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            +  L+L    VI S  V+DE  F+YD  S RGP +WG ++PEW  C  G MQ+PI+L +K
Sbjct  14   LTALVLLPFPVIMSHLVEDESEFNYDVKSKRGPYNWGNIKPEWSICKNGSMQSPINLLNK  73

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  410
             V +  +LG +   Y    ATL N G+ +ML W  G  YL IN  +Y+ +Q HWH PSEH
Sbjct  74   RVQIAPHLGKLHINYQPSNATLRNRGHNIMLEWLAGTSYLQINETQYVLKQFHWHSPSEH  133

Query  411  VVNGTRYDLEAHLVHVSNDGE  473
             ++G R+DLE H+VH ++ GE
Sbjct  134  TIDGRRFDLELHMVHEASSGE  154



>gb|KHN38743.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=276

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 2/140 (1%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
            A + LS   +I S EV+DE  F+YD  S+ GP +WG ++PEW  C  G MQ+PIDL ++ 
Sbjct  16   ALVFLSCP-LIMSHEVEDESEFNYDVKSEIGPFNWGHIKPEWSLCKIGSMQSPIDLLNER  74

Query  237  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
            V + S+LG +Q  Y    ATL+N G+ + L W  G  +L ING  Y+ +Q HWH PSEH 
Sbjct  75   VQIVSHLGTLQMNYQPSNATLKNRGHDIKLGWLAGTSFLQINGTEYVLKQFHWHSPSEHT  134

Query  414  VNGTRYDLEAHLVHVSNDGE  473
            ++G R DLE H+VH +  G+
Sbjct  135  IDGRRLDLELHMVHETPSGQ  154



>ref|NP_172285.2| alpha carbonic anhydrase 5 [Arabidopsis thaliana]
 sp|F4HUC4.1|ATCA5_ARATH RecName: Full=Alpha carbonic anhydrase 5; Short=AtaCA5; Short=AtalphaCA5; 
AltName: Full=Alpha carbonate dehydratase 5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE28238.1| alpha carbonic anhydrase 5 [Arabidopsis thaliana]
Length=277

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 98/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  39   LKLFSIAF----LLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            +K+ SI +    + +S+T V  S    EV+DE  F+Y++  ++GP +WG L+PEW  C  
Sbjct  1    MKIPSIGYVFFLIFISITIVSSSPDHGEVEDETQFNYEKKGEKGPENWGRLKPEWAMCGK  60

Query  198  GKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIR  368
            G MQ+PIDL  K V+   NLG +++ Y+   AT++N G+ +M+ +  G   LG  ING  
Sbjct  61   GNMQSPIDLTDKRVLIDHNLGYLRSQYLPSNATIKNRGHDIMMKFEGGNAGLGITINGTE  120

Query  369  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGEDC  479
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DG + 
Sbjct  121  YKLQQIHWHSPSEHTLNGKRFVLEEHMVHQSKDGRNA  157



>ref|XP_011044414.1| PREDICTED: LOW QUALITY PROTEIN: alpha carbonic anhydrase 7 [Populus 
euphratica]
Length=262

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 87/143 (61%), Gaps = 7/143 (5%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
             SI +L+++      S+++ DE  FSYD N  +GP+ WG + P+W  CS G MQ+PIDL 
Sbjct  4    VSIEYLIMT------SKQIQDETEFSYDPNGVKGPAQWGRIHPKWGACSQGXMQSPIDLM  57

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            +  V V S+L  IQ  Y     +L N G+ M L W  G   + ING  Y+F+Q HWH PS
Sbjct  58   NNSVDVASHLRRIQRSYKPANPSLRNRGHDMTLKWEGGAGSIEINGTEYVFQQCHWHSPS  117

Query  405  EHVVNGTRYDLEAHLVHVSNDGE  473
            EH +NG R  LEAH+VH + DG+
Sbjct  118  EHTINGKRLPLEAHMVHANLDGK  140



>gb|KGN59000.1| hypothetical protein Csa_3G742880 [Cucumis sativus]
Length=275

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 84/126 (67%), Gaps = 1/126 (1%)
 Frame = +3

Query  93   SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  269
            +QEV+DE  F Y + S +GPS WG+++ EW +C+ G MQ+PIDL +K V V  +LG ++N
Sbjct  24   AQEVEDESEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVKHLGQLKN  83

Query  270  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
             Y   +A ++N G+ + + W      + ING  YL +Q HWH PSEH +NG RYDLE HL
Sbjct  84   KYKPSIAIIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHL  143

Query  450  VHVSND  467
            VH S++
Sbjct  144  VHQSSN  149



>ref|XP_009113037.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=271

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 90/153 (59%), Gaps = 6/153 (4%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKS-----QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  194
            MD   +    F+LL++   + S     +EV+DE  FSY  N + GP  WG+L+PEW  C 
Sbjct  1    MDKSSIQCFLFILLTIIVTMISCSNAQREVEDESEFSYMRNQENGPEKWGKLKPEWKMCG  60

Query  195  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
             G+MQ+PIDL  K V + S+LG +   Y    ATL N G+ MM+ +  G   + IN + Y
Sbjct  61   KGEMQSPIDLMHKRVRIVSHLGRLTRNYKPSNATLRNRGHDMMVRFEEGSSSIKINNVEY  120

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
               Q+HWH PSEH +NG R+ LE H+VH S +G
Sbjct  121  QLHQLHWHSPSEHTINGRRFALELHMVHESLNG  153



>ref|XP_002314288.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
 gb|EEE88243.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
Length=277

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = +3

Query  102  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  278
             +DE  F+YD N ++GP++WG + PEW  CS G MQ+PIDL S+ V V S+LG +   Y 
Sbjct  33   AEDEADFNYDPNGEKGPANWGRIHPEWGACSNGSMQSPIDLLSERVDVVSHLGRLSRSYK  92

Query  279  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  458
               ATL N G+ MML W      + ING  YL +Q HWH PSEH +NG R  LE H+VH 
Sbjct  93   PANATLRNRGHDMMLKWEGAAGSIEINGTEYLLKQCHWHSPSEHTINGKRLALEVHMVHE  152

Query  459  SNDGE  473
            S DG+
Sbjct  153  SLDGK  157



>emb|CDY45963.1| BnaA09g13030D [Brassica napus]
Length=271

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 90/153 (59%), Gaps = 6/153 (4%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKS-----QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  194
            MD   +    F+LL++   + S     +EV+DE  FSY  N + GP  WG+L+PEW  C 
Sbjct  1    MDKSSIQCFLFILLTIIVTMISCSNAQREVEDESEFSYMRNQENGPEKWGKLKPEWKMCG  60

Query  195  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
             G+MQ+PIDL  K V + S+LG +   Y    ATL N G+ MM+ +  G   + IN + Y
Sbjct  61   KGEMQSPIDLMHKRVRIVSHLGRLTRNYKPSNATLRNRGHDMMVRFEEGSSSIKINNVEY  120

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
               Q+HWH PSEH +NG R+ LE H+VH S +G
Sbjct  121  QLHQLHWHSPSEHTINGRRFALELHMVHESLNG  153



>ref|XP_006296034.1| hypothetical protein CARUB_v10025180mg [Capsella rubella]
 gb|EOA28932.1| hypothetical protein CARUB_v10025180mg [Capsella rubella]
Length=244

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 91/145 (63%), Gaps = 3/145 (2%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIK-SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            + +I   ++S +H  K  +EV+DE  FSY+ N + GP +WG+L+P+W  C  G+MQ+PID
Sbjct  13   ILTIFSTIVSCSHAAKHDREVEDESEFSYELNKENGPRNWGKLKPKWNMCGKGEMQSPID  72

Query  222  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWH  395
            L +K V + S+LG +   Y    ATL+N G+ MML +   G     ING  Y   Q+HWH
Sbjct  73   LMNKRVKLVSHLGKLSRNYETSNATLKNRGHDMMLKFGEEGSGSFKINGTEYNLLQLHWH  132

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDG  470
             PSEH +NG R+ LE HLVH S +G
Sbjct  133  SPSEHTINGKRFALELHLVHESKNG  157



>ref|XP_010470128.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X2 [Camelina 
sativa]
Length=276

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 93/157 (59%), Gaps = 10/157 (6%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKS--------QEVDDEWGFSYDENSDRGPSHWGELRPEWW  185
            MD   +    F++L++   I S        +EV+DE  FSY+ N + GP +WG+L+PEW 
Sbjct  1    MDKSSIRCFFFVILTILGTIVSCSSAAKNDREVEDESEFSYEHNKENGPKNWGKLKPEWN  60

Query  186  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGIN  359
             C  G+MQ+PIDL +K V + S+LG +   Y    ATL+N G+ MML +   G     IN
Sbjct  61   MCGKGEMQSPIDLMNKRVKLVSHLGKLSRNYKPSNATLKNRGHDMMLKFGEEGAGSFKIN  120

Query  360  GIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            G  Y   Q+HWH PSEH +NG R+ LE H+VH S +G
Sbjct  121  GTEYRLLQLHWHSPSEHTINGXRFALELHMVHESKNG  157



>ref|XP_007203913.1| hypothetical protein PRUPE_ppa016859mg [Prunus persica]
 gb|EMJ05112.1| hypothetical protein PRUPE_ppa016859mg [Prunus persica]
Length=340

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = +3

Query  54   IAFLLL---SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            + F+LL   S   V+++QEV+DE  F Y E S +GP++WGE++ EW  C  G MQ+PIDL
Sbjct  15   LVFVLLFMHSTISVVEAQEVEDERDFDYVEGSKKGPAYWGEIKKEWAACKHGGMQSPIDL  74

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
              K   +  +L  ++  Y    ATL+N G+ + + W      + ING  Y F+Q HWH P
Sbjct  75   PRKSFQILPSLVELKRIYKPSNATLKNRGHDIKIEWEGDAGSIKINGTDYFFKQCHWHTP  134

Query  402  SEHVVNGTRYDLEAHLVHVSND  467
            SEH +NG RYDLE H+VH S D
Sbjct  135  SEHSINGIRYDLELHMVHQSTD  156



>ref|XP_002529419.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32945.1| carbonic anhydrase, putative [Ricinus communis]
Length=272

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 83/131 (63%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   VIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGP  260
            +  SQEV+DE  F Y  NS++GP+ WGEL  EW  CS G MQ+PIDL ++ V + S LG 
Sbjct  24   LTSSQEVEDEHEFDY-RNSEKGPNRWGELHHEWGACSNGSMQSPIDLFNERVEIVSYLGR  82

Query  261  IQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  440
            +   Y    ATL+N G+ MML W  G   L ING  Y+ +Q HWH PSEH VNG  Y LE
Sbjct  83   LIRSYKPSNATLKNRGHDMMLQWETGAGTLRINGTEYILKQCHWHSPSEHTVNGKSYALE  142

Query  441  AHLVHVSNDGE  473
             H+VH S DG+
Sbjct  143  LHMVHESLDGK  153



>ref|XP_009148063.1| PREDICTED: alpha carbonic anhydrase 5 [Brassica rapa]
 ref|XP_009148064.1| PREDICTED: alpha carbonic anhydrase 5 [Brassica rapa]
Length=274

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 93/145 (64%), Gaps = 6/145 (4%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            I  +++S+T    S    EV+DE  F+Y++  ++GP  WG L+PEW  C  G MQ+PIDL
Sbjct  10   IFLIVISITTASGSPDHGEVEDETEFNYEKGGEKGPEKWGTLKPEWKMCGNGTMQSPIDL  69

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVHWH  395
              K V +  NLGP++++Y+   AT++N G+ +ML +  G   +G  ING  Y  +Q+HWH
Sbjct  70   TDKRVFIDHNLGPLRSHYLPSNATIKNRGHDIMLEFEGGNAGMGITINGTVYQLQQLHWH  129

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDG  470
             PSEH +NG R+ LE H++H S DG
Sbjct  130  SPSEHTINGKRFVLEQHMLHQSKDG  154



>emb|CDY45480.1| BnaC09g12980D [Brassica napus]
Length=271

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 90/153 (59%), Gaps = 6/153 (4%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKS-----QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  194
            MD   +    F+LL++   + S     +EV+DE  FSY  N + GP  WG+L+PEW  C 
Sbjct  1    MDKSSIQCFLFILLTIIVTMISCSNAQREVEDESEFSYMRNQENGPEKWGKLKPEWKMCG  60

Query  195  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
             G+MQ+PIDL  K V + S+LG +   Y    ATL N G+ MM+ +  G   + IN + Y
Sbjct  61   KGEMQSPIDLMHKRVRIVSHLGRLTRNYKPSNATLRNRGHDMMVRFEEGSSSIRINNVEY  120

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
               Q+HWH PSEH +NG R+ LE H+VH S +G
Sbjct  121  QLHQLHWHSPSEHTINGRRFALELHMVHESLNG  153



>ref|XP_008241384.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=288

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 90/142 (63%), Gaps = 2/142 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +F + F  L+++ V+K+QEV+DE  F Y E S +GP++WGE++ EW  C  G MQ+PIDL
Sbjct  19   VFVLLFTHLTIS-VVKAQEVEDERDFDYVEGSKKGPAYWGEIKKEWAACKHGGMQSPIDL  77

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
              K   +  +L  ++  Y    ATL+N G+ + L W      + INGI+Y  +Q HWH P
Sbjct  78   PGKSFQILPSLVELKRTYKPSNATLKNRGHDIKLEWAGNAGSIEINGIQYFLKQSHWHSP  137

Query  402  SEHVVNGTRYDLEAHLVHVSND  467
            SEH +NG RYD+E H+V+ S D
Sbjct  138  SEHSINGKRYDMELHMVYQSPD  159



>ref|XP_002892434.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68693.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 93/151 (62%), Gaps = 1/151 (1%)
 Frame = +3

Query  21   IEDMDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  200
            I+ +  + LFS+  ++   +      EV+DE  F+Y +N ++GP  WG+L+PEW  C  G
Sbjct  7    IQCIFFVALFSMFAIVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGKLKPEWEMCGKG  66

Query  201  KMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLF  377
            +MQ+PIDL ++ V V S+LG +   Y    ATL+N G+ +ML +  G   + ING RY  
Sbjct  67   EMQSPIDLMNERVNVVSHLGRLNRDYKPSNATLKNRGHDIMLKFEYGAGSIKINGFRYEL  126

Query  378  RQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            +Q+HWH PSEH +NG R+ LE H+VH    G
Sbjct  127  QQLHWHSPSEHTINGRRFALELHMVHEGKKG  157



>emb|CDX93595.1| BnaA06g04530D [Brassica napus]
Length=274

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 93/146 (64%), Gaps = 6/146 (4%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            I  +++S+T    S    EV+DE  F+Y++  ++GP  WG L+PEW  C  G MQ+PIDL
Sbjct  10   IFLIVISITTASGSPDHGEVEDETEFNYEKGGEKGPEKWGTLKPEWKMCGNGTMQSPIDL  69

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVHWH  395
              K V +  NLGP++++Y+   AT++N G+ +ML +  G   +G  ING  Y  +Q+HWH
Sbjct  70   TDKRVFIDHNLGPLRSHYLPSNATIKNRGHDIMLEFEGGNAGMGIIINGTVYQLQQLHWH  129

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDGE  473
             PSEH +NG R+ LE H++H S DG 
Sbjct  130  SPSEHTINGKRFVLEQHMLHQSKDGR  155



>ref|XP_010510673.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 93/157 (59%), Gaps = 10/157 (6%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKS--------QEVDDEWGFSYDENSDRGPSHWGELRPEWW  185
            MD   +    F++L++   I S        +EV+DE  FSY+ N + GP +WG+L+PEW 
Sbjct  1    MDKSSIRCFFFVILTILGTIVSCSSAAENDREVEDESEFSYEHNKENGPKNWGKLKPEWN  60

Query  186  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGIN  359
             C  G+MQ+PIDL +K V + S+LG +   Y    ATL+N G+ MML +   G     IN
Sbjct  61   MCGKGEMQSPIDLMNKRVKLVSHLGKLSRNYKPSNATLKNRGHDMMLKFGEEGAGSFKIN  120

Query  360  GIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            G  Y   Q+HWH PSEH +NG R+ LE H+VH S +G
Sbjct  121  GTEYKLLQLHWHSPSEHTINGRRFALELHMVHESKNG  157



>gb|KJB16757.1| hypothetical protein B456_002G246000 [Gossypium raimondii]
Length=324

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 88/143 (62%), Gaps = 2/143 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +FS+ FL  S +     +EV+DE  F Y+E S++GP HWG+L+ EW  C  G MQ+PIDL
Sbjct  60   IFSVLFLCFSASVASNDEEVEDEREFDYNEKSEKGPHHWGDLKKEWAACKTGAMQSPIDL  119

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHF  398
             +  V + +    ++  Y    + ++N G+ + L WP  +   + I+GI Y+  QVHWH 
Sbjct  120  TNDKVKIIAKSVNLEKNYKPAESIIKNRGHDISLQWPDHKAGSITIDGIEYVLLQVHWHS  179

Query  399  PSEHVVNGTRYDLEAHLVHVSND  467
            PSEH +NG RY LEAH+VH + D
Sbjct  180  PSEHTINGKRYALEAHMVHKAAD  202



>ref|XP_008226047.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Prunus mume]
Length=275

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 92/147 (63%), Gaps = 4/147 (3%)
 Frame = +3

Query  45   LFSIAFLLLSV---THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +   +FL++ V   +    S EV+DE  F+Y+++S++GP+ WGE+R EW  C+ G MQ+P
Sbjct  8    ILVCSFLIVLVWLLSCQATSDEVEDEREFNYEDDSEKGPARWGEIRQEWSMCNKGSMQSP  67

Query  216  IDL-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL + +  V S+LG +Q  Y    ATL+N G+ +ML W     ++ ING  Y  +Q HW
Sbjct  68   IDLLDDRVEVVSDLGRLQGSYRPCNATLKNRGHDIMLKWEADAGFIRINGTLYQLKQCHW  127

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH VN   +DLE HL+H S  G+
Sbjct  128  HSPSEHTVNDKSFDLEVHLLHQSPTGK  154



>ref|XP_010450977.1| PREDICTED: alpha carbonic anhydrase 8 [Camelina sativa]
Length=325

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 83/126 (66%), Gaps = 3/126 (2%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYY  275
            EV+DE  FSY++   +GP+ WG ++ EW  C  GKMQ+PIDL  K VV +  LG +++ Y
Sbjct  81   EVEDETEFSYEKKGKKGPAKWGTIKEEWKMCGTGKMQSPIDLRDKNVVVTTKLGSLRSQY  140

Query  276  MRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +    T++N G+ +ML +  G + +GI  NG +Y  +Q+HWH PSEH +NG RY LE HL
Sbjct  141  LPSNTTIKNRGHDIMLKFKGGNKGIGITVNGTKYQLQQLHWHSPSEHTINGKRYALEKHL  200

Query  450  VHVSND  467
            VH S D
Sbjct  201  VHESKD  206



>ref|XP_010696305.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=276

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 77/133 (58%), Gaps = 1/133 (1%)
 Frame = +3

Query  78   THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-ESKPVVYSNL  254
            T  +  QEVDDE  F Y   S+ GP  WGE+RPEW  CS G+MQ+PIDL +++  V    
Sbjct  23   TASVLCQEVDDEREFDYIRGSEMGPERWGEIRPEWATCSTGEMQSPIDLLDARVKVTPRS  82

Query  255  GPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYD  434
              I   Y    A L N G+ + L W      + ING  Y+ RQ HWH PSEH +NG RYD
Sbjct  83   AEINRLYRPTRAMLRNRGHDIELEWEDDSSRIQINGTEYILRQSHWHSPSEHTINGKRYD  142

Query  435  LEAHLVHVSNDGE  473
            +E H+VH S D +
Sbjct  143  MELHMVHQSRDNQ  155



>ref|XP_002892432.1| carbonate dehydratase/ zinc ion binding protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68691.1| carbonate dehydratase/ zinc ion binding protein [Arabidopsis 
lyrata subsp. lyrata]
Length=277

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 94/157 (60%), Gaps = 7/157 (4%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKSQ----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            M +  +  + FL+     ++ S     EV+DE  F+Y++  ++GP +WG L+PEW  C  
Sbjct  1    MKISSIGCVVFLIFISITIVSSSPDNGEVEDETQFNYEKKGEKGPDNWGRLKPEWAMCGK  60

Query  198  GKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIR  368
            G MQ+PIDL  K V+   NLG +++ Y+    T++N G+ +M+ +  G   LG  ING  
Sbjct  61   GNMQSPIDLTDKRVLIDHNLGYLRSQYLPSNITIKNRGHDIMMKFEGGNAGLGITINGTE  120

Query  369  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGEDC  479
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DG + 
Sbjct  121  YKLQQIHWHSPSEHTLNGKRFVLEEHMVHQSKDGRNA  157



>ref|XP_009400916.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=282

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = +3

Query  72   SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYS  248
            S +H+  SQEV+DE  FSY+E S  GP  WGE+R EW  C+ G MQ+PIDL  + V V  
Sbjct  22   SRSHLATSQEVEDESEFSYEEGSPNGPQRWGEIREEWAICNNGDMQSPIDLLHERVKVLP  81

Query  249  NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTR  428
             LG ++  Y    ATL+N G+ +ML WP     + I+G  Y  +Q HWH PSEH +NG R
Sbjct  82   GLGRLRRSYRAANATLKNRGHDIMLEWPEEAGRIHIDGTDYELKQCHWHSPSEHSINGKR  141

Query  429  YDLEAHLVHVSND  467
            + LE H+VH S D
Sbjct  142  FALELHMVHQSAD  154



>ref|XP_009103655.1| PREDICTED: alpha carbonic anhydrase 2 [Brassica rapa]
 emb|CDX71369.1| BnaC04g16040D [Brassica napus]
Length=272

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 93/152 (61%), Gaps = 4/152 (3%)
 Frame = +3

Query  27   DMDMLKLFSIAFLLLSVTHVIKS---QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            D   ++ F    L + VT +  S   +EV+DE  FSY++N + GP  WG+L+PEW  C  
Sbjct  2    DKSSIQCFLFILLTIIVTFISCSNAQREVEDESEFSYEQNVENGPEKWGKLKPEWKMCGK  61

Query  198  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  374
            G+MQ+PIDL ++ V + S+LG +   Y    A+L+N G+ MML +      + INGI Y 
Sbjct  62   GEMQSPIDLMNERVRIVSHLGRLTRNYKPCNASLKNRGHDMMLRFEERPGSIKINGIEYQ  121

Query  375  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
              Q+HWH PSEH +NG R+ LE H+VH S +G
Sbjct  122  LLQLHWHSPSEHTINGRRFALELHMVHESING  153



>ref|XP_010521744.1| PREDICTED: alpha carbonic anhydrase 7-like [Tarenaya hassleriana]
Length=274

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 91/156 (58%), Gaps = 8/156 (5%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKSQ-------EVDDEWGFSYDENSDRGPSHWGELRPEWWQ  188
            M+   +  + FLL     VI          E +DE  F+Y+   +RGP +WG+L+PEW  
Sbjct  1    MEKSSIKCMFFLLFVCVTVISHSNAAPGDGETEDEHEFNYEMEGERGPKNWGKLKPEWKM  60

Query  189  CSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGI  365
            C  GKMQ+PIDL +K V + S+LG ++  Y    ATL+N G+ MML +  G   + + G 
Sbjct  61   CGRGKMQSPIDLLNKRVRIVSHLGRLKRDYRPSNATLKNRGHDMMLRFEDGAGRIHVKGR  120

Query  366  RYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
             Y  RQ+HWH PSEH +NG R+ LE H+VH S +G 
Sbjct  121  PYTLRQIHWHSPSEHTINGKRFALELHMVHESKNGR  156



>ref|XP_010272832.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
 ref|XP_010272833.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=270

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHV---IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  200
            M+ +K   +A LL+  + +   + ++EV+DE  F+Y E S  GP HWGE+  EW  C  G
Sbjct  1    MEPIKPIFLAILLVIPSLLFSPVTTEEVEDEREFNYVEGSGVGPEHWGEIHEEWAACGNG  60

Query  201  KMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLF  377
            +MQ+PIDL  K V V  +LG ++  Y    A L N G+ +M+ W      + ING RY  
Sbjct  61   EMQSPIDLSEKKVEVLHHLGKLKRRYRPSRAVLVNRGHDIMIKWVERAGSIYINGTRYFL  120

Query  378  RQVHWHFPSEHVVNGTRYDLEAHLVHVSND  467
            R  HWH PSEH +NG RY LE H+VH S+D
Sbjct  121  RHCHWHSPSEHTINGVRYALEGHMVHESSD  150



>gb|KHG14539.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=289

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 88/143 (62%), Gaps = 2/143 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +FS+ FL  S +     +EV+DE  F Y+ENS +GP HWG+L+ EW  C  G MQ+PIDL
Sbjct  25   IFSVLFLCFSASVAHNDEEVEDEREFDYNENSSKGPLHWGDLKTEWAACKNGAMQSPIDL  84

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHF  398
             +  V + +    ++  Y    + ++N G+ + L WP  +   + I+GI Y+  QVHWH 
Sbjct  85   TNDRVKIITKSVKLEKNYKPAESIIKNRGHDISLQWPDHKAGSIIIDGIEYVLLQVHWHS  144

Query  399  PSEHVVNGTRYDLEAHLVHVSND  467
            PSEH +NG RY LEAH+VH + D
Sbjct  145  PSEHTINGKRYALEAHMVHKAAD  167



>ref|XP_010475597.1| PREDICTED: alpha carbonic anhydrase 5-like [Camelina sativa]
Length=281

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 3/127 (2%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYY  275
            EV+DE  F+Y++N ++GP +WG L+PEW  C  G MQ+PIDL  K V+   NLG +++ Y
Sbjct  28   EVEDEEQFNYEKNGEKGPENWGRLKPEWAMCGKGNMQSPIDLTDKRVLVDHNLGYLRSQY  87

Query  276  MRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +   AT++N G+ +ML +  G    G  ING  Y  +Q+HWH PSEH +NG R+ LE H+
Sbjct  88   LPSNATIKNRGHDIMLKFEGGNAGSGITINGTEYKLQQIHWHSPSEHTINGKRFILEEHM  147

Query  450  VHVSNDG  470
            VH S DG
Sbjct  148  VHQSKDG  154



>ref|XP_006303231.1| hypothetical protein CARUB_v10012300mg [Capsella rubella]
 gb|EOA36129.1| hypothetical protein CARUB_v10012300mg [Capsella rubella]
Length=276

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = +3

Query  39   LKLFSI-AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            + LFSI  F +L  +      EV+DE  F+Y EN ++GP  WGEL+PEW  C  G+MQ+P
Sbjct  13   VALFSIFTFNVLISSAASSHGEVEDEHEFNYKENDEKGPERWGELKPEWEMCGKGEMQSP  72

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL ++ V + S+LG +   Y    ATL+N G+ +M+ +  G   + ING  Y  +Q+HW
Sbjct  73   IDLMNERVNIVSHLGRLNRDYEPSNATLKNRGHDIMIKFEDGAGNIKINGFEYELQQLHW  132

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDG  470
            H PSEH +NG R  LE H+VH   +G
Sbjct  133  HSPSEHTINGRRLALELHMVHEGKNG  158



>ref|XP_009148224.1| PREDICTED: alpha carbonic anhydrase 7-like [Brassica rapa]
Length=272

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 89/141 (63%), Gaps = 2/141 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES  230
            I F L S +    S  EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PID+ +
Sbjct  14   IIFTLFSFSTAATSNGEVEDEREFNYKKNDDKGPDRWGEIKPEWEMCGKGELQSPIDMMN  73

Query  231  KPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE  407
            + V + S+LG +   Y    AT++N G+ +ML +  G   + ING +Y  +Q+HWH PSE
Sbjct  74   ERVKIVSHLGRLIRDYEASNATIKNRGHDIMLKFEDGAGSIKINGFQYELQQLHWHSPSE  133

Query  408  HVVNGTRYDLEAHLVHVSNDG  470
            H VNG R+ LE H+VH   +G
Sbjct  134  HTVNGRRFALELHMVHEGKNG  154



>ref|XP_002864450.1| hypothetical protein ARALYDRAFT_331944 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40709.1| hypothetical protein ARALYDRAFT_331944 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 82/126 (65%), Gaps = 3/126 (2%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYY  275
            EV+DE  FSY+   ++GP+ WG L  EW  C  GKMQ+PIDL  K VV SN  G +++ Y
Sbjct  87   EVEDETEFSYEMKGNKGPAKWGTLHAEWKMCGIGKMQSPIDLSDKNVVVSNKFGSLRSQY  146

Query  276  MRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +    T++N G+ +ML +  G + +G  I GI+Y  +Q+HWH PSEH +NG R+ LE HL
Sbjct  147  LPSNTTIKNRGHDIMLKFKGGNKGIGVTIRGIKYQLQQLHWHSPSEHTINGKRFALEEHL  206

Query  450  VHVSND  467
            VH S D
Sbjct  207  VHESKD  212



>ref|XP_010475599.1| PREDICTED: alpha carbonic anhydrase 7-like [Camelina sativa]
Length=277

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 90/144 (63%), Gaps = 2/144 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
              SI  + +S++    S  EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+PID
Sbjct  16   FISIFTINVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGELKPEWELCGKGEMQSPID  75

Query  222  LESKPVVY-SNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
            L ++ V+  S+LG +   Y    ATL+N G+ +ML +  G   + ING +Y  +Q+HWH 
Sbjct  76   LMNERVIIGSHLGRLNRDYQPSNATLKNRGHDIMLKFEDGAGSIKINGFQYELQQLHWHS  135

Query  399  PSEHVVNGTRYDLEAHLVHVSNDG  470
            PSEH VNG R+ LE H+VH    G
Sbjct  136  PSEHTVNGRRFALELHMVHEGKKG  159



>ref|XP_009399717.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            F   F L SV  ++ S+EV+DE  FSY++ S+ GP HWGE+  +W  C  G MQ+PIDL 
Sbjct  12   FLAIFTLQSV--LVASREVEDEKEFSYEKGSETGPEHWGEIHKDWAACGKGHMQSPIDLT  69

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
             K V +  +LG ++  Y    A L+N G+ +ML W      L ING  Y  +Q+HWH PS
Sbjct  70   HKRVQILPHLGRLRRSYHPAEAILKNRGHDIMLKWEEEAGGLWINGTEYALKQLHWHSPS  129

Query  405  EHVVNGTRYDLEAHLVHVSNDGEDC  479
            EH V+G RY LE H+VH S D +  
Sbjct  130  EHTVDGRRYSLEMHMVHESTDNKTA  154



>emb|CDY04545.1| BnaA07g13710D [Brassica napus]
Length=272

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 93/152 (61%), Gaps = 4/152 (3%)
 Frame = +3

Query  27   DMDMLKLFSIAFLLLSVTHVIKS---QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            D   ++ F    L + VT +  S   +EV+DE  FSY++N + GP  WG+L+PEW  C  
Sbjct  2    DKSSIQCFLFILLTIIVTFISCSNAQREVEDESEFSYEQNVENGPEKWGKLKPEWKMCGK  61

Query  198  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  374
            G+MQ+PIDL ++ V + S+LG +   Y    A+L+N G+ MML +      + INGI Y 
Sbjct  62   GEMQSPIDLMNERVRIVSHLGRLTRNYKPCNASLKNRGHDMMLRFEERPGSIKINGIIYQ  121

Query  375  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
              Q+HWH PSEH +NG R+ LE H+VH S +G
Sbjct  122  LLQLHWHSPSEHTINGRRFALELHMVHESING  153



>ref|XP_008362138.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=279

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 85/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            F + F L S T  I +QEV+DE  F Y + S +GP  WG  + EW  C  G MQ+PIDL 
Sbjct  13   FCLVFFLCSATS-ITAQEVEDEREFDYLQGSGKGPKQWGAXKKEWSACKNGGMQSPIDLS  71

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            S  V +  NLG +   Y    AT++N G+ + + W      + ING +YL +Q HWH PS
Sbjct  72   SHRVTLVPNLGKLNISYNPCNATVKNRGHDISIYWEGNAGSIHINGTQYLLKQSHWHSPS  131

Query  405  EHVVNGTRYDLEAHLVHVSND  467
            EH VNG RYD+E H+VH+S+D
Sbjct  132  EHSVNGRRYDMELHMVHLSSD  152



>ref|XP_002268233.1| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI30161.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            I +QEV+DE  F Y E S++GP HWGEL+ EW  C+ G +Q+PIDL ++ V V   LG +
Sbjct  26   IIAQEVEDEREFEYIEGSEKGPKHWGELKEEWAACNNGDLQSPIDLSNQRVKVIPKLGDL  85

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
            +  Y    AT++N G+ + L W      + ING  Y  +Q HWH PSEH +NG RYDLE 
Sbjct  86   KRNYKLCNATVKNRGHDISLQWVGDAGSIRINGTEYKLQQGHWHAPSEHSINGRRYDLEL  145

Query  444  HLVHVSND  467
            H+VHVS D
Sbjct  146  HMVHVSPD  153



>emb|CDX95095.1| BnaC05g05760D [Brassica napus]
Length=272

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 88/141 (62%), Gaps = 2/141 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES  230
            I F L S +    S  EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PIDL +
Sbjct  14   IIFTLFSFSTAATSHGEVEDEHEFNYKKNDDKGPERWGEIKPEWEMCGKGELQSPIDLMN  73

Query  231  KPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE  407
            + V + S+LG +   Y    AT++N G+ +ML +  G   + ING  Y  +Q+HWH PSE
Sbjct  74   ERVKIVSHLGRLIRDYEPSNATIKNRGHDIMLKFKDGAGSIKINGFHYELQQLHWHSPSE  133

Query  408  HVVNGTRYDLEAHLVHVSNDG  470
            H VNG R+ LE H+VH   +G
Sbjct  134  HTVNGRRFALELHMVHEGKNG  154



>ref|XP_007150177.1| hypothetical protein PHAVU_005G133000g [Phaseolus vulgaris]
 gb|ESW22171.1| hypothetical protein PHAVU_005G133000g [Phaseolus vulgaris]
Length=271

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 98/152 (64%), Gaps = 3/152 (2%)
 Frame = +3

Query  21   IEDMDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  200
            +E +  + L   + L LS++  + S+EVDDE  FSY+E S+ GPSHWG++ PEW  C+ G
Sbjct  1    MEKLATMVLICCSLLFLSLS--VMSREVDDESEFSYEEESENGPSHWGDIHPEWRLCNNG  58

Query  201  KMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLF  377
             MQ+PIDL ++ V + S LG +Q  Y    A++ N G+ +ML W  G  +L IN  +Y+ 
Sbjct  59   SMQSPIDLLNERVEIVSQLGRLQMNYQPSNASIRNRGHDIMLEWVAGAGHLQINETKYVL  118

Query  378  RQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
             Q HWH PSEH ++G R+DLE H+VH +  G+
Sbjct  119  NQCHWHSPSEHTIDGKRFDLELHIVHETPSGQ  150



>ref|XP_010241820.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=282

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 84/146 (58%), Gaps = 3/146 (2%)
 Frame = +3

Query  39   LKLFSIAFLLLSV--THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  212
            +  F +  LLL +  T      EV+DE  F Y E S +GP HWGEL  EW  C  G MQ+
Sbjct  8    MSTFGLVCLLLLIFNTEAATFHEVEDEREFDYLEGSGKGPDHWGELHEEWAACKNGDMQS  67

Query  213  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  389
            PIDL ++ V +   LG ++  Y    A L+N G+ + L W  G   + ING  Y+  Q H
Sbjct  68   PIDLLNERVQLVPGLGRLKRSYKPSNAILKNRGHDIALEWGEGAGSININGXDYVLEQCH  127

Query  390  WHFPSEHVVNGTRYDLEAHLVHVSND  467
            WH PSEH +NG R+DLE H+VHVS D
Sbjct  128  WHSPSEHTLNGKRFDLELHMVHVSPD  153



>ref|XP_011468146.1| PREDICTED: alpha carbonic anhydrase 7-like [Fragaria vesca subsp. 
vesca]
Length=282

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 92/150 (61%), Gaps = 8/150 (5%)
 Frame = +3

Query  30   MDMLKLFSIA-FLLLSVTHV-----IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQC  191
            MD  K  SI  FL++ +  +     I +QEV+DE  F Y ++S++GP HWGELR EW  C
Sbjct  3    MDQSKSISITLFLMVLLLQILQPTSITAQEVEDESEFDYLKDSEKGPKHWGELREEWGAC  62

Query  192  SAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGI  365
              G++Q+P+DL S+ V V+ N G ++  Y    A ++N G+ + + W LG    + ING 
Sbjct  63   KTGRLQSPVDLHSEIVEVHPNNGEVRLKYRPSYAIIKNRGHDISIQWKLGAAGSVEINGT  122

Query  366  RYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
             Y   Q HWH PSEH +NG R+DLE H+VH
Sbjct  123  DYWLDQCHWHSPSEHTINGNRFDLELHMVH  152



>gb|AFK33933.1| unknown [Medicago truncatula]
Length=279

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = +3

Query  93   SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  269
            +QEV+DE  F Y ++S  GPSHWG+++ EW  C  GKMQ+PID+ S  V V   LG ++ 
Sbjct  30   AQEVEDEHEFDYTKDSKIGPSHWGKIKKEWATCKDGKMQSPIDMSSHRVKVVPKLGKLKR  89

Query  270  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +Y    AT++N G+ + + W      + ING  +   Q HWH PSEH +NG RYDLE H+
Sbjct  90   HYKPRNATIKNRGHDIEVKWKEDAGSININGTEFFLHQCHWHAPSEHTINGRRYDLELHM  149

Query  450  VHVS  461
            VH S
Sbjct  150  VHES  153



>ref|NP_172287.1| alpha carbonic anhydrase 7 [Arabidopsis thaliana]
 sp|Q8L817.1|ATCA7_ARATH RecName: Full=Alpha carbonic anhydrase 7; Short=AtaCA7; Short=AtalphaCA7; 
AltName: Full=Alpha carbonate dehydratase 7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM67440.1| putative storage protein [Arabidopsis thaliana]
 gb|AEE28240.1| alpha carbonic anhydrase 7 [Arabidopsis thaliana]
Length=275

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 1/140 (1%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            + LFSI  ++   +      EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+PI
Sbjct  13   VALFSIFTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSPI  72

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING  Y  +Q+HWH
Sbjct  73   DLMNERVNIVSHLGRLNRDYNPSNATLKNRGHDIMLKFEDGAGTIKINGFEYELQQLHWH  132

Query  396  FPSEHVVNGTRYDLEAHLVH  455
             PSEH +NG R+ LE H+VH
Sbjct  133  SPSEHTINGRRFALELHMVH  152



>gb|KEH42158.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=279

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = +3

Query  93   SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  269
            +QEV+DE  F Y ++S  GPSHWG+++ EW  C  GKMQ+PID+ S  V V   LG ++ 
Sbjct  30   AQEVEDEHEFDYTKDSKIGPSHWGKIKKEWATCKDGKMQSPIDMSSHRVKVVPKLGKLKR  89

Query  270  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +Y    AT++N G+ + + W      + ING  +   Q HWH PSEH +NG RYDLE H+
Sbjct  90   HYKPHNATIKNRGHDIEVKWKEDAGSININGTEFFLHQCHWHAPSEHTINGRRYDLELHM  149

Query  450  VHVS  461
            VH S
Sbjct  150  VHES  153



>emb|CDY23976.1| BnaC03g17150D [Brassica napus]
Length=272

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 80/126 (63%), Gaps = 1/126 (1%)
 Frame = +3

Query  96   QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  272
            +EV+DE  FSY+ N + GP  WG+L+PEW  C  G+MQ+PIDL  K V + S+LG +   
Sbjct  28   REVEDESEFSYERNQENGPEKWGKLKPEWKMCGKGEMQSPIDLLHKRVRIVSHLGRLTRD  87

Query  273  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  452
            Y    ATL N G+ MM+ +  G   + IN I Y   Q+HWH PSEH +NG R+ LE H+V
Sbjct  88   YKPANATLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPSEHTINGRRFALELHMV  147

Query  453  HVSNDG  470
            H S +G
Sbjct  148  HESANG  153



>ref|XP_006339307.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=228

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 93/157 (59%), Gaps = 2/157 (1%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM  206
            M   +  S+ F+++  +   IK+QEV+DE  F Y E S++GP  WG+L+ EW  C+ G+M
Sbjct  1    MRQQRYLSVLFIIIFFSATFIKAQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEM  60

Query  207  QTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            Q+PID+  + V      P + +Y    AT++N G+ + L W      + ING  Y  +Q 
Sbjct  61   QSPIDMSHERVRIIQ-KPDKRHYKLCNATVKNRGHDISLQWHGDAGSVSINGTNYPLQQA  119

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSNDGEDCSACSDV  497
            HWH PSEH VNG RYD+E H+VH++ +  +    S+V
Sbjct  120  HWHSPSEHTVNGRRYDMEMHMVHLNENATNKIVVSEV  156



>sp|Q9FM99.2|ATCA8_ARATH RecName: Full=Alpha carbonic anhydrase 8; Short=AtaCA8; Short=AtalphaCA8; 
AltName: Full=Alpha carbonate dehydratase 8; Flags: 
Precursor [Arabidopsis thaliana]
Length=277

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 88/144 (61%), Gaps = 6/144 (4%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +  + +S+T V  +     ++DE  FSY+   ++GP+ WG L  EW  C  GKMQ+PIDL
Sbjct  10   LVLIFISITIVSSAPALIRIEDETEFSYETKGNKGPAKWGTLDAEWKMCGIGKMQSPIDL  69

Query  225  ESKPVVYSN-LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVHWH  395
              K VV SN  G +++ Y+    T++N G+ +ML +  G + +G  I G RY  +Q+HWH
Sbjct  70   RDKNVVVSNKFGLLRSQYLPSNTTIKNRGHDIMLKFKGGNKGIGVTIRGTRYQLQQLHWH  129

Query  396  FPSEHVVNGTRYDLEAHLVHVSND  467
             PSEH +NG R+ LE HLVH S D
Sbjct  130  SPSEHTINGKRFALEEHLVHESKD  153



>ref|NP_200444.1| alpha carbonic anhydrase 8 [Arabidopsis thaliana]
 dbj|BAB11260.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96750.1| alpha carbonic anhydrase 8 [Arabidopsis thaliana]
Length=350

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 81/126 (64%), Gaps = 3/126 (2%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYY  275
            EV+DE  FSY+   ++GP+ WG L  EW  C  GKMQ+PIDL  K VV SN  G +++ Y
Sbjct  133  EVEDETEFSYETKGNKGPAKWGTLDAEWKMCGIGKMQSPIDLRDKNVVVSNKFGLLRSQY  192

Query  276  MRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +    T++N G+ +ML +  G + +G  I G RY  +Q+HWH PSEH +NG R+ LE HL
Sbjct  193  LPSNTTIKNRGHDIMLKFKGGNKGIGVTIRGTRYQLQQLHWHSPSEHTINGKRFALEEHL  252

Query  450  VHVSND  467
            VH S D
Sbjct  253  VHESKD  258



>gb|KFK43125.1| hypothetical protein AALP_AA1G083600 [Arabis alpina]
Length=272

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 7/149 (5%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQ------EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM  206
            +  I FLL+  T V  S       EV+DE  F+Y +N ++GP  WG+L+PEW  C  G++
Sbjct  6    IRCIFFLLIISTVVSLSNAATSHGEVEDEHEFNYKKNDEKGPERWGKLKPEWEMCGKGEI  65

Query  207  QTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ  383
            Q+PIDL ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING +Y  +Q
Sbjct  66   QSPIDLMNERVNIVSHLGRLNRNYKPSNATLKNRGHDIMLRFENGAGSIKINGSQYELQQ  125

Query  384  VHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            +HWH PSEH VNG R+ LE H+VH + +G
Sbjct  126  LHWHSPSEHSVNGRRFALELHMVHEAKNG  154



>gb|KCW89335.1| hypothetical protein EUGRSUZ_A01626, partial [Eucalyptus grandis]
Length=249

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 76/122 (62%), Gaps = 2/122 (2%)
 Frame = +3

Query  108  DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRD  284
            DE  F Y   S++GP HWGELR EW  C  G+ Q+PIDL S+ V V   LG IQ  Y   
Sbjct  1    DEREFDYIAGSEKGPKHWGELRKEWEACKKGETQSPIDLSSRRVKVIPKLGGIQRSYKPS  60

Query  285  VATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVS  461
             ATL+N G+ + L W +G    + ING  Y  +Q HWH PSEH +NG RY++E H+VHVS
Sbjct  61   NATLKNRGHDISLQWDVGNVGSVKINGTEYFLQQCHWHSPSEHTINGRRYEMELHMVHVS  120

Query  462  ND  467
             D
Sbjct  121  TD  122



>ref|XP_010050514.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89336.1| hypothetical protein EUGRSUZ_A01627 [Eucalyptus grandis]
Length=283

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 75/125 (60%), Gaps = 2/125 (2%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  275
            E +DE  F Y   S++GP HWGELR +W  C  G+MQ+PIDL S+ V V   LG I   Y
Sbjct  32   ETEDEREFDYIAGSEKGPMHWGELRKDWEACKKGEMQSPIDLSSQGVKVMPKLGEIDRSY  91

Query  276  MRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  452
                ATL N G+ + L W  G    + ING  Y  +Q HWH PSEH +NG RY LE H+V
Sbjct  92   KPSNATLMNRGHDISLQWDTGNAGSIKINGTEYFLQQCHWHSPSEHTINGRRYALELHMV  151

Query  453  HVSND  467
            HVS D
Sbjct  152  HVSTD  156



>ref|XP_002519458.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF42872.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 90/146 (62%), Gaps = 6/146 (4%)
 Frame = +3

Query  45   LFSIAFLL--LSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
             F+IA L+  L  +H +K+QEV+DE  F Y + S++GP  WGEL+ EW  C  G +Q+PI
Sbjct  9    FFTIATLISVLLFSHQVKAQEVEDEREFDYIQGSEKGPEKWGELKKEWASCKNGTLQSPI  68

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRY--LGINGIRYLFRQVH  389
            D+ ++ V +    G ++  Y    +T++N G+ + L W  G +   + ING  Y  +Q H
Sbjct  69   DMSNQRVKIIPKSGDLKRNYRSCNSTVKNRGHDISLQWE-GHKAGSVNINGTGYFLQQCH  127

Query  390  WHFPSEHVVNGTRYDLEAHLVHVSND  467
            WH PSEH +NG RYD+E H+VH S D
Sbjct  128  WHSPSEHTINGRRYDMELHMVHESTD  153



>gb|KDP26093.1| hypothetical protein JCGZ_21126 [Jatropha curcas]
Length=269

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 11/144 (8%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            + SIAF            EV DE  F+YDE++ +GP HWG + PEW  C+ GK+Q+PIDL
Sbjct  16   IISIAF----------ESEVGDESPFTYDEDTGKGPKHWGNIEPEWQVCNNGKLQSPIDL  65

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
             +K V   S LG +   Y    A+++N G+ + + W      + ING  Y  +Q HWH P
Sbjct  66   LNKRVQTSSKLGKLHRCYKPAPASVKNRGHDIAVIWKGDAGKIKINGTDYKLQQCHWHSP  125

Query  402  SEHVVNGTRYDLEAHLVHVSNDGE  473
            SEH  NG+RY+LE HLVH S++G+
Sbjct  126  SEHTFNGSRYELEIHLVHESSEGK  149



>gb|KEH42156.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=286

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 2/152 (1%)
 Frame = +3

Query  12   KL*IEDMDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQC  191
            KL  E+   L+   +  ++L  T  I++QEV+DE  F Y E S++GP HWGEL+ EW  C
Sbjct  2    KLERENTYTLRTSLMILIILLYTTSIRAQEVEDEREFDYIEGSEKGPHHWGELKEEWAAC  61

Query  192  SAGKMQTPIDL--ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGI  365
              G MQ+PIDL  E   ++ +    I+  Y    AT+ N G+ + + W      + ING 
Sbjct  62   KHGDMQSPIDLSNERVKIIPNYRQVIKTKYKSSNATIINRGHDIAVFWRGDAGSISINGT  121

Query  366  RYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVS  461
            ++   Q HWH PSEH +NG +YDLE H+VH+S
Sbjct  122  KFFLHQCHWHSPSEHSINGRKYDLEMHMVHIS  153



>ref|XP_010050524.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89338.1| hypothetical protein EUGRSUZ_A01630 [Eucalyptus grandis]
Length=283

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 77/125 (62%), Gaps = 2/125 (2%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  275
            E +DE  F Y   S++GP HWGELR +W  C  G+MQ+PIDL S+ V V   LG I+  +
Sbjct  32   EAEDEREFDYIPGSEKGPMHWGELRKDWEACKKGEMQSPIDLSSERVQVMPKLGEIERNH  91

Query  276  MRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  452
                ATL+N G+ + L W  G    + ING  Y  +Q HWH PSEH +NG RY LE H+V
Sbjct  92   KPSNATLKNRGHDISLQWDTGNAGSIKINGTEYFLQQCHWHSPSEHTINGRRYALELHMV  151

Query  453  HVSND  467
            HVS D
Sbjct  152  HVSTD  156



>ref|XP_008802055.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=275

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 84/139 (60%), Gaps = 1/139 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            +A L    T  + SQEV+DE  FSY+  S+ GP  WGEL  EW  C  GK+Q+PIDL  +
Sbjct  14   LAILFFFSTSPVASQEVEDEKEFSYEIGSETGPERWGELHEEWSACGKGKLQSPIDLSDE  73

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  410
             V V    GP+++ Y    A ++N G+ + + W      + ING +Y+ +Q+HWH PSEH
Sbjct  74   RVQVLHQSGPLRSSYHPADAVMKNRGHDIEIKWENQTGGVWINGTKYVLKQLHWHSPSEH  133

Query  411  VVNGTRYDLEAHLVHVSND  467
             +NG RY LE H+VH S D
Sbjct  134  TINGRRYSLELHMVHQSAD  152



>gb|KFK32339.1| hypothetical protein AALP_AA6G228800 [Arabis alpina]
Length=271

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 90/153 (59%), Gaps = 7/153 (5%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKSQ----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            MD   +     +LL++     +Q    EV+DE  FSY++N + GP  WG+L+PEW  C  
Sbjct  1    MDKTSIQCFFLVLLTIVSCSSAQSNLREVEDERDFSYEQNKETGPEKWGKLKPEWKMCGK  60

Query  198  GKMQTPIDLESKPV--VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
            G++Q+PIDL +  V  VY +LG +   Y    ATL+N G+ MML +      + ING  Y
Sbjct  61   GELQSPIDLTNDRVKLVY-HLGRLTKDYKPSNATLKNRGHDMMLRFEEESGSIKINGTEY  119

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
               Q+HWH PSEH +NG R+ LE H+VH S +G
Sbjct  120  QLLQLHWHSPSEHTINGRRFALELHMVHESING  152



>ref|XP_004168624.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=280

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = +3

Query  102  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  278
            V+DE  F Y + S +GPS WG+++ EW +C+ G MQ+PIDL +K V V  +LG ++N Y 
Sbjct  32   VEDESEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVKHLGQLKNKYK  91

Query  279  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  458
              +A ++N G+ + + W      + ING  YL +Q HWH PSEH +NG RYDLE HLVH 
Sbjct  92   PSIAIIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHLVHQ  151

Query  459  SND  467
            S++
Sbjct  152  SSN  154



>ref|XP_004249474.1| PREDICTED: alpha carbonic anhydrase 7-like [Solanum lycopersicum]
Length=269

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 90/150 (60%), Gaps = 2/150 (1%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSV-THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM  206
            M   +  SI F+++   T  IK+QEV+DE  F Y E S++GP  WG+L+ EW  C+ G+M
Sbjct  1    MKQQRYLSILFIIIFFSTTFIKAQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEM  60

Query  207  QTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            Q+PID+  + V      P + +Y    AT++N G+ + L W      + ING  Y  +Q 
Sbjct  61   QSPIDMSHERVRIIQ-KPDKRHYKLCNATVKNRGHDISLQWHGDAGSVTINGTNYPLQQA  119

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSNDGED  476
            HWH PSEH VNG RYD+E H+VH++ +  +
Sbjct  120  HWHSPSEHTVNGRRYDMEMHMVHLNENATN  149



>gb|ABK22387.1| unknown [Picea sitchensis]
Length=271

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 85/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            IAF L+     +++QE+DDE  F Y E   +GP HWGEL+ EW  C  G  Q+PID+  +
Sbjct  10   IAFALILFIAGVRTQEIDDEREFEYKEGP-KGPEHWGELKEEWKACGRGTQQSPIDVVKR  68

Query  234  PVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  410
              + S NLG +   Y    ATL N G+ +M++W  G   + I G R+  +Q HWH P+EH
Sbjct  69   NAIISPNLGTLHRIYHPANATLVNRGHDIMVNWSEGAGSVEIKGKRFTLKQCHWHTPAEH  128

Query  411  VVNGTRYDLEAHLVHVSNDGE  473
             ++G ++ LE HLVH + DGE
Sbjct  129  TIDGKQHPLEIHLVHQAVDGE  149



>ref|XP_010916592.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=275

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 86/149 (58%), Gaps = 1/149 (1%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +L    +A L    T  + SQEV+DE  FSY+  S+ GP HWGEL  EW  C  GK+Q+P
Sbjct  8    LLSSIFLAILFFFSTSPVTSQEVEDEKDFSYESGSETGPEHWGELHTEWSACGKGKLQSP  67

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL  + V V   LG +++ Y    A ++N G+ + + W      + ING +Y  +Q+HW
Sbjct  68   IDLSDERVQVVHQLGQLRSSYRPADAVMKNRGHDIEIKWENHTGGIWINGTKYDLKQLHW  127

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGEDC  479
            H PSEH +N  RY LE H+VH + D +  
Sbjct  128  HSPSEHTINRHRYSLELHMVHQTTDNKTA  156



>gb|KCW47834.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=278

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 93/154 (60%), Gaps = 5/154 (3%)
 Frame = +3

Query  24   EDMDMLKLFSIAF---LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  194
             +M +L+   + F   LLL+++   +S EVDDE  F+Y E + +GP  WG++ P W  C 
Sbjct  28   REMGILRSSFVFFALGLLLTLSSASES-EVDDETPFTYIEGTGKGPKEWGQIDPRWQACG  86

Query  195  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
             GK+Q+PIDL ++ V V+ NLG ++  Y    A + N G+ + + W      + ING  Y
Sbjct  87   MGKLQSPIDLLNERVQVFPNLGKLKRDYKPAPAIVRNRGHDITVMWKGDAGKININGTYY  146

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
               Q HWH PSEH  NG+RYDLE H+VH+S+ GE
Sbjct  147  KLLQCHWHSPSEHTFNGSRYDLELHMVHLSSHGE  180



>ref|XP_004241280.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Solanum lycopersicum]
Length=273

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 87/130 (67%), Gaps = 6/130 (5%)
 Frame = +3

Query  90   KSQEVDDEWG-FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            +S EVDD    FSYD+ ++ GP+ WGE+      C+ G +Q+PIDL++K V V SNLG +
Sbjct  24   RSLEVDDTSDEFSYDQYANNGPAKWGEISS---NCN-GNLQSPIDLDNKVVEVVSNLGIL  79

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
            Q YY    ATL N G+ +ML W     YL IN  +Y   Q+HWH PSEH ++G RYD+EA
Sbjct  80   QKYYKPSNATLVNRGHDIMLRWDGDAGYLKINETQYQLLQIHWHTPSEHSIDGKRYDMEA  139

Query  444  HLVHVSNDGE  473
            HLVH+S+DG+
Sbjct  140  HLVHMSSDGK  149



>ref|XP_010322405.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Solanum lycopersicum]
Length=255

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 87/130 (67%), Gaps = 6/130 (5%)
 Frame = +3

Query  90   KSQEVDDEWG-FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            +S EVDD    FSYD+ ++ GP+ WGE+      C+ G +Q+PIDL++K V V SNLG +
Sbjct  24   RSLEVDDTSDEFSYDQYANNGPAKWGEISS---NCN-GNLQSPIDLDNKVVEVVSNLGIL  79

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
            Q YY    ATL N G+ +ML W     YL IN  +Y   Q+HWH PSEH ++G RYD+EA
Sbjct  80   QKYYKPSNATLVNRGHDIMLRWDGDAGYLKINETQYQLLQIHWHTPSEHSIDGKRYDMEA  139

Query  444  HLVHVSNDGE  473
            HLVH+S+DG+
Sbjct  140  HLVHMSSDGK  149



>ref|XP_010036307.1| PREDICTED: alpha carbonic anhydrase 4-like [Eucalyptus grandis]
 gb|KCW47833.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=299

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 93/154 (60%), Gaps = 5/154 (3%)
 Frame = +3

Query  24   EDMDMLKLFSIAF---LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  194
             +M +L+   + F   LLL+++   +S EVDDE  F+Y E + +GP  WG++ P W  C 
Sbjct  28   REMGILRSSFVFFALGLLLTLSSASES-EVDDETPFTYIEGTGKGPKEWGQIDPRWQACG  86

Query  195  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
             GK+Q+PIDL ++ V V+ NLG ++  Y    A + N G+ + + W      + ING  Y
Sbjct  87   MGKLQSPIDLLNERVQVFPNLGKLKRDYKPAPAIVRNRGHDITVMWKGDAGKININGTYY  146

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
               Q HWH PSEH  NG+RYDLE H+VH+S+ GE
Sbjct  147  KLLQCHWHSPSEHTFNGSRYDLELHMVHLSSHGE  180



>ref|XP_004166480.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like, partial [Cucumis sativus]
Length=242

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  108  DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNL-GPIQNYYMRD  284
            DE  F Y+E  ++GP+HWG+L+PEW  C  G MQ+PIDL  + V  ++L   I+  Y   
Sbjct  1    DETEFDYNEEGEKGPTHWGDLKPEWHSCKTGHMQSPIDLLHERVRIASLFTNIEFNYKPT  60

Query  285  VATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSN  464
             ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH +NG R+ LEAHLVH S 
Sbjct  61   NATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHTINGRRFALEAHLVHQSQ  120

Query  465  DG  470
            +G
Sbjct  121  NG  122



>gb|KJB62357.1| hypothetical protein B456_009G413500 [Gossypium raimondii]
Length=195

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 2/140 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
              FL LS +  + + E ++E  F Y ENS++GPSHWG+L+ EW  C  G +Q+P+DL S+
Sbjct  18   FTFLFLSYSAPVSADEEENEREFDYLENSEKGPSHWGDLKMEWSACKNGVLQSPVDLSSQ  77

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSE  407
             V + +  G ++  Y    A L N G+ + L W       + ING  Y  +QVHWH PSE
Sbjct  78   RVKIVNKAGELKKTYKPCDAILRNRGHDISLKWHNCDAGLININGTEYSLQQVHWHSPSE  137

Query  408  HVVNGTRYDLEAHLVHVSND  467
            H +NG RY LE H+VH S D
Sbjct  138  HTINGARYALELHMVHHSTD  157



>ref|XP_010696309.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=285

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK-PVVYSNLGPI  263
            I +QEV+DE  F+Y +  +RGP +WG ++PEW  C+ G+ Q+PI+L +  P    N   I
Sbjct  26   IVAQEVEDESEFNYIQGDERGPENWGNIKPEWATCNTGRKQSPINLFAPFPETVPNFVRI  85

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
               Y     T++N G+ + L W  G   + ING+ Y+ RQ HWH PSEH +NG RY LEA
Sbjct  86   TRLYQPGQTTIKNRGHDIKLEWTEGSSSIQINGVDYILRQCHWHSPSEHAINGRRYALEA  145

Query  444  HLVHVSNDGE  473
            H VH S D +
Sbjct  146  HFVHQSLDNK  155



>ref|XP_009148066.1| PREDICTED: alpha carbonic anhydrase 7-like [Brassica rapa]
Length=272

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  275
            EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PI+L ++ V + S+LG +   Y
Sbjct  30   EVEDEHEFNYKKNDDKGPERWGEIKPEWEMCGKGEIQSPIELMNERVKIVSHLGRLIRDY  89

Query  276  MRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
                AT++N G+ +ML +  G   + ING +Y  +Q+HWH PSEH VNG R+ LE H+VH
Sbjct  90   EASNATIKNRGHDIMLKFEAGAGSIKINGFQYELQQLHWHSPSEHTVNGRRFALELHMVH  149

Query  456  VSNDG  470
               +G
Sbjct  150  EGKNG  154



>gb|AFK36418.1| unknown [Lotus japonicus]
Length=280

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = +3

Query  93   SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  269
            +QEV+DE  F+Y + +++GPS+WG ++ EW  C  GKMQ+PIDL S  V V  NLG ++ 
Sbjct  30   AQEVEDESEFNYIQGNEKGPSNWGTMKKEWKTCKTGKMQSPIDLSSHRVRVVPNLGELKK  89

Query  270  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +Y    AT++N G+ + + W      + ING  +   Q HWH PSEH +NG RY+LE H+
Sbjct  90   FYKPQNATVKNRGHDIEVKWEADAGSIIINGTEFFLHQSHWHTPSEHTINGRRYELELHM  149

Query  450  VHVS  461
            VH S
Sbjct  150  VHES  153



>ref|XP_004242096.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum lycopersicum]
Length=264

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 7/131 (5%)
 Frame = +3

Query  78   THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNL  254
            T  ++  +++DE  FSYD+N+  GPS WGE+      C+ G +Q+PID ++K V V SNL
Sbjct  21   TISLEVDQMNDE--FSYDQNAKNGPSKWGEISS---YCN-GNLQSPIDFDNKVVEVVSNL  74

Query  255  GPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYD  434
            G +Q YY    ATL N G+ +ML W     YL IN  +Y  +Q+HWH PSEH +NG RYD
Sbjct  75   GILQKYYKPSNATLVNRGHNIMLRWDGDSGYLKINETQYQLQQIHWHTPSEHSINGKRYD  134

Query  435  LEAHLVHVSND  467
            +EAHLVH+S+D
Sbjct  135  MEAHLVHMSSD  145



>ref|XP_010090219.1| hypothetical protein L484_016558 [Morus notabilis]
 gb|EXB39088.1| hypothetical protein L484_016558 [Morus notabilis]
Length=252

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 1/131 (1%)
 Frame = +3

Query  84   VIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGP  260
            + ++ EVDDE  F+Y E S +GP  WGE+ P W  C  GK+Q+PIDL  + V V+ +LG 
Sbjct  21   ICRALEVDDESPFTYVEGSGKGPKEWGEVDPHWQLCDKGKLQSPIDLLDQRVQVFPSLGK  80

Query  261  IQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  440
            ++  Y    AT++N G+ + + W      + ING  Y   Q HWH PSEH  NGTR++LE
Sbjct  81   LKRDYKPAPATIKNRGHDITVKWKGDAGKININGTDYALLQCHWHSPSEHTFNGTRFELE  140

Query  441  AHLVHVSNDGE  473
             H++H S+ GE
Sbjct  141  LHVIHKSSSGE  151



>ref|XP_011094588.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=279

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 82/144 (57%), Gaps = 0/144 (0%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +L    +AF +L  T  I +QEVDDE  F+YD+NS +GP +WG+++ EW  C+ G MQ+P
Sbjct  9    ILAPIFVAFFVLFGTKPINAQEVDDESEFNYDQNSAKGPINWGKIKEEWGGCNTGIMQSP  68

Query  216  IDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            ID+    +V     P    Y    A L+N G+ + + W      L ING  Y  R  HWH
Sbjct  69   IDISGDRMVRIISHPQTPNYKPAHALLKNRGHDIQIQWLDDAGSLSINGTEYCLRYAHWH  128

Query  396  FPSEHVVNGTRYDLEAHLVHVSND  467
             PSEH  NG RY LE HLVH + D
Sbjct  129  SPSEHTYNGKRYALELHLVHKATD  152



>ref|XP_010267256.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=282

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = +3

Query  93   SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  269
            SQEV+DE  F Y E S +GP HWGEL  EW  C  G MQ+PIDL +K V V   LG ++ 
Sbjct  28   SQEVEDEREFDYLEGSGKGPDHWGELHEEWAACKNGDMQSPIDLLNKRVQVIPALGRMKR  87

Query  270  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
             Y   +ATL+N G+ + L W  G   + ING  Y+ +Q HWH PSEH +NG R+DLE H+
Sbjct  88   SYKPSIATLKNRGHDIALQWVGGGGSININGTDYVLQQSHWHSPSEHTINGRRFDLELHM  147

Query  450  VHVSNDGEDCSACS  491
            VHV++D +  +  +
Sbjct  148  VHVTSDTKAVNKIA  161



>ref|XP_004139552.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=250

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = +3

Query  102  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  278
              DE  F Y+E  ++GP+HWG+L+PEW  C  G MQ+PIDL  + V + S    I+  Y 
Sbjct  7    TKDETEFDYNEEGEKGPTHWGDLKPEWHSCKTGHMQSPIDLLHERVRIASLFTNIEFNYK  66

Query  279  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  458
               ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH +NG R+ LEAHLVH 
Sbjct  67   PTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHTINGRRFALEAHLVHQ  126

Query  459  SNDG  470
            S +G
Sbjct  127  SQNG  130



>ref|XP_011018803.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=277

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 88/143 (62%), Gaps = 9/143 (6%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +F++    LSVT    +QEV+DE  F Y E S++GP+HWG+++ EW  C  G++Q+PID+
Sbjct  15   IFALVVSPLSVT----AQEVEDEREFDYTEGSEKGPAHWGDIKEEWADCKTGRLQSPIDM  70

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG---INGIRYLFRQVHW  392
              + V +      ++  Y    ATL+N G+ +M+ W  G+   G   +N  RY  RQ HW
Sbjct  71   SDRRVKMVQKKDNMKRNYRPFNATLKNRGHDIMVQWE-GRDKAGSIQLNCTRYFLRQCHW  129

Query  393  HFPSEHVVNGTRYDLEAHLVHVS  461
            H PSEH +NG RYD+E H++H +
Sbjct  130  HSPSEHTINGRRYDMELHMIHTT  152



>ref|XP_010098808.1| hypothetical protein L484_022573 [Morus notabilis]
 gb|EXB75896.1| hypothetical protein L484_022573 [Morus notabilis]
Length=280

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 87/149 (58%), Gaps = 8/149 (5%)
 Frame = +3

Query  45   LFSIA-FLLLSV------THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  203
            +FS + FL+L +      +  +K+QEV+DE  F Y   S++GP  WGEL+ EW  C  G 
Sbjct  8    IFSFSCFLVLVIILFSHSSKSVKAQEVEDESEFDYSRRSEKGPDRWGELKKEWSACKNGG  67

Query  204  MQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFR  380
            MQ+PIDL ++ V +   LG +   Y    AT++N G+ + + W      + ING  Y  +
Sbjct  68   MQSPIDLSNQRVKIIPKLGKLTRSYTPSNATVKNRGHDISIQWHGKAGSIKINGTEYFLQ  127

Query  381  QVHWHFPSEHVVNGTRYDLEAHLVHVSND  467
            Q HWH PSEH +NG R+ +E H+VH S D
Sbjct  128  QAHWHSPSEHTINGRRFHMELHMVHQSTD  156



>gb|EMT10084.1| hypothetical protein F775_43115 [Aegilops tauschii]
Length=278

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 87/149 (58%), Gaps = 1/149 (1%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            + +L LFS +  L ++      QE D+E  FSY  +++ GP+HWG+++ EW  C  G MQ
Sbjct  9    LAVLLLFSASVFLSAIRAARAQQETDEEEEFSYSLDAENGPAHWGDIKEEWSACGKGNMQ  68

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            +PIDL S  V +   LG + + Y+   AT+ N G+ +ML +      + I G  Y  RQ+
Sbjct  69   SPIDLASPRVSLVRGLGYLNHSYVPANATIVNRGHDIMLKFESDAGSVSIGGTPYFLRQL  128

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
             WH P+EH VNG RYD+E H+ H S  G+
Sbjct  129  QWHSPTEHSVNGRRYDMELHMFHESAQGK  157



>gb|KJB62360.1| hypothetical protein B456_009G413500 [Gossypium raimondii]
Length=245

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 2/140 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
              FL LS +  + + E ++E  F Y ENS++GPSHWG+L+ EW  C  G +Q+P+DL S+
Sbjct  18   FTFLFLSYSAPVSADEEENEREFDYLENSEKGPSHWGDLKMEWSACKNGVLQSPVDLSSQ  77

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSE  407
             V + +  G ++  Y    A L N G+ + L W       + ING  Y  +QVHWH PSE
Sbjct  78   RVKIVNKAGELKKTYKPCDAILRNRGHDISLKWHNCDAGLININGTEYSLQQVHWHSPSE  137

Query  408  HVVNGTRYDLEAHLVHVSND  467
            H +NG RY LE H+VH S D
Sbjct  138  HTINGARYALELHMVHHSTD  157



>ref|XP_010050530.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89339.1| hypothetical protein EUGRSUZ_A01632 [Eucalyptus grandis]
Length=283

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 76/125 (61%), Gaps = 2/125 (2%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  275
            E +DE  F Y   S++GP HWGELR +W  C  G+MQ+PIDL S+ V V   LG I+  +
Sbjct  32   ETEDEREFDYIPGSEKGPMHWGELRNDWEACKKGEMQSPIDLSSERVQVMPKLGEIERSH  91

Query  276  MRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  452
                ATL+N G+ + L W  G    + IN   Y  +Q HWH PSEH +NG RY LE H+V
Sbjct  92   KPSNATLKNRGHDISLQWDTGNAGSIKINSTEYFLQQCHWHSPSEHTINGRRYALELHMV  151

Query  453  HVSND  467
            HVS D
Sbjct  152  HVSTD  156



>emb|CDX93593.1| BnaA06g04550D [Brassica napus]
Length=547

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 89/141 (63%), Gaps = 2/141 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES  230
            I F L S +    S  EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PID+ +
Sbjct  289  IIFSLFSFSTAATSNGEVEDEREFNYKKNDDKGPERWGEIKPEWEMCGKGELQSPIDMMN  348

Query  231  KPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE  407
            + V + S+LG +   Y    AT++N G+ +ML +  G   + ING +Y  +Q+HWH PSE
Sbjct  349  ERVKIVSHLGRLIRDYEPSNATIKNRGHDIMLKFEDGAGSIKINGFQYELQQLHWHSPSE  408

Query  408  HVVNGTRYDLEAHLVHVSNDG  470
            H VNG R+ LE H+VH   +G
Sbjct  409  HTVNGRRFALELHMVHEGKNG  429


 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  275
            EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PIDL ++ V + S+LG +   Y
Sbjct  30   EVEDEHEFNYKKNDDKGPERWGEIKPEWEMCGKGEIQSPIDLMNERVKIVSHLGRLIRDY  89

Query  276  MRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
                AT++N G+ +ML +  G   + ING +Y  +Q+HWH PSEH VNG R+ LE H+VH
Sbjct  90   EASNATIKNRGHDIMLKFEAGAGSIKINGFQYELQQLHWHSPSEHTVNGRRFALELHMVH  149

Query  456  VSNDG  470
               +G
Sbjct  150  EGKNG  154



>gb|KEH24050.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=278

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 89/155 (57%), Gaps = 5/155 (3%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            LFSI  L +++          D+  + Y+E S +GP HWG+L+ EW  C  G+MQ+PIDL
Sbjct  8    LFSIVLLSITILFYSTLTRASDDPEYGYNEKSAKGPRHWGDLKREWAACK-GEMQSPIDL  66

Query  225  ESK--PVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
             S    V+    G ++  Y    AT+ N G+ + ++W     Y+ ING  Y  +Q HWH+
Sbjct  67   SSDRVSVMIPEFGDLKRNYKPQHATISNRGHDVAVTWEGDVGYIDINGTHYFLQQSHWHW  126

Query  399  PSEHVVNGTRYDLEAHLVHVSN--DGEDCSACSDV  497
            PSEH +NG RYDLE H+VHVS   DG + +A   V
Sbjct  127  PSEHTINGRRYDLELHMVHVSTQPDGTNKTAVVGV  161



>ref|XP_011033188.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
 ref|XP_011033189.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
Length=330

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 90/152 (59%), Gaps = 2/152 (1%)
 Frame = +3

Query  21   IEDMDMLKLFSIAFLLLSVTHVIK-SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  197
            I  M  L L S+  +  S+T  +    EV+DE  F+Y+E +++GP +WG++ P W  C  
Sbjct  59   INMMSFLLLVSLIIVSYSLTISLAFESEVEDETQFTYEEGTEKGPKNWGKINPHWEACGK  118

Query  198  GKMQTPID-LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  374
            GKMQ+PID L+ +  V+ NLG ++  Y    A ++N G+ + + W      + IN   Y 
Sbjct  119  GKMQSPIDVLDRRVEVFPNLGRLRRDYQAAPAAVKNRGHDITVIWKGDAGKITINDTDYQ  178

Query  375  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
             +Q HWH PSEH  NGTR+DLE HLVH S+ G
Sbjct  179  LQQCHWHSPSEHAFNGTRHDLELHLVHYSSQG  210



>ref|XP_004143278.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN48196.1| hypothetical protein Csa_6G446560 [Cucumis sativus]
Length=276

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 86/139 (62%), Gaps = 3/139 (2%)
 Frame = +3

Query  60   FLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            F+LL   H   I +QEV+DE  F Y E S +GP HWGE++ EW  C+ G +Q+PIDL S+
Sbjct  12   FILLYFIHSSSISAQEVEDEREFDYAEGSQKGPGHWGEIKKEWEACNNGDLQSPIDLSSQ  71

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  410
             V +   LG ++  Y    AT++N G+ + + W      + ING  Y  +Q HWH PSEH
Sbjct  72   RVKIVPQLGELKRSYYPCNATVKNRGHDISVYWYGKPGSIEINGDVYDLQQSHWHSPSEH  131

Query  411  VVNGTRYDLEAHLVHVSND  467
             VNG RYDLE H+VH S+D
Sbjct  132  SVNGRRYDLELHMVHQSSD  150



>emb|CDX84811.1| BnaA03g14190D [Brassica napus]
Length=242

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 79/124 (64%), Gaps = 1/124 (1%)
 Frame = +3

Query  102  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  278
            V+DE  FSY+ N + GP  WG+L+PEW  C  G+MQ+PIDL +K V + S+LG +   Y 
Sbjct  3    VEDESEFSYEGNQENGPEKWGKLKPEWKMCGKGEMQSPIDLMNKRVKIVSHLGRLTRDYK  62

Query  279  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  458
               ATL N G+ MM+ +  G   + IN I Y   Q+HWH PSEH +NG R+ LE H+VH 
Sbjct  63   PANATLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPSEHTINGRRFALELHMVHE  122

Query  459  SNDG  470
            S +G
Sbjct  123  SING  126



>ref|XP_006381381.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
 gb|ERP59178.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
Length=277

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 86/142 (61%), Gaps = 7/142 (5%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +F + F  LSVT    +QEV+DE  F Y E S++GP+HWG+++ EW  C  G +Q+PID+
Sbjct  15   IFVLVFSPLSVT----AQEVEDEREFDYTEGSEKGPAHWGDIKTEWADCKTGSLQSPIDM  70

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRY--LGINGIRYLFRQVHWH  395
              + V +      I+  Y    ATL+N G+ +M+ W    +   + ING RY  +Q HWH
Sbjct  71   SDRRVKMVQKTENIKRNYRPFNATLKNRGHDIMVQWEGFDKAGSIQINGARYFLQQCHWH  130

Query  396  FPSEHVVNGTRYDLEAHLVHVS  461
             PSEH +NG  YD+E H++H +
Sbjct  131  SPSEHTINGRSYDMELHMLHTT  152



>ref|XP_010269790.1| PREDICTED: alpha carbonic anhydrase 4-like [Nelumbo nucifera]
Length=274

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = +3

Query  93   SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  269
            + E +DE  F+Y E S+RGP HWG+++ +W  C  G+MQ+PIDL  + V V+S LG ++ 
Sbjct  28   ATEQEDEHEFTYKEGSERGPEHWGDIQSDWKICKKGEMQSPIDLLHERVQVFSGLGRLKR  87

Query  270  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
             Y    A  +N G+ +M+ W      + INGI Y  +Q HWH PSEH  NG+RY LE H+
Sbjct  88   DYQPAPAAAKNRGHDIMIEWKGDAGKININGINYSLKQCHWHSPSEHTFNGSRYKLELHM  147

Query  450  VHVSNDG  470
            VH+++ G
Sbjct  148  VHINSCG  154



>gb|KJB62359.1| hypothetical protein B456_009G413500 [Gossypium raimondii]
Length=278

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 83/139 (60%), Gaps = 2/139 (1%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
             FL LS +  + + E ++E  F Y ENS++GPSHWG+L+ EW  C  G +Q+P+DL S+ 
Sbjct  19   TFLFLSYSAPVSADEEENEREFDYLENSEKGPSHWGDLKMEWSACKNGVLQSPVDLSSQR  78

Query  237  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSEH  410
            V + +  G ++  Y    A L N G+ + L W       + ING  Y  +QVHWH PSEH
Sbjct  79   VKIVNKAGELKKTYKPCDAILRNRGHDISLKWHNCDAGLININGTEYSLQQVHWHSPSEH  138

Query  411  VVNGTRYDLEAHLVHVSND  467
             +NG RY LE H+VH S D
Sbjct  139  TINGARYALELHMVHHSTD  157



>ref|XP_009380700.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=273

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 82/144 (57%), Gaps = 1/144 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
             F +    L  +  + SQEV+DE  FSY   S  GP HWGE+  EW  C  G+ Q+PIDL
Sbjct  9    FFGVLIAALLQSFPVASQEVEDEKEFSYQRGSQIGPEHWGEIHHEWAACGKGRTQSPIDL  68

Query  225  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
              + V V+  LG ++  Y    A L+N G+ +ML W      + ING  Y  +Q+HWH P
Sbjct  69   SDERVQVFPCLGRLRRSYRPADAILKNRGHDIMLKWEDEAGGIWINGTEYGLKQMHWHSP  128

Query  402  SEHVVNGTRYDLEAHLVHVSNDGE  473
            SEH +NG RY +E H+VH S D +
Sbjct  129  SEHTINGRRYPMEMHMVHESADNK  152



>ref|XP_007027464.1| Alpha carbonic anhydrase 7 isoform 2 [Theobroma cacao]
 gb|EOY07966.1| Alpha carbonic anhydrase 7 isoform 2 [Theobroma cacao]
Length=242

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 81/140 (58%), Gaps = 2/140 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
             A L LS +  + +QEV+DE  F Y ENS +GPS WG+L+ EW  C  G +Q+PID+ S 
Sbjct  16   FAVLFLSYSASVSAQEVEDEREFDYLENSGKGPSQWGDLKKEWVACKNGGLQSPIDMSSL  75

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWP-LGQRYLGINGIRYLFRQVHWHFPSE  407
             V V +  G ++  Y    A ++N G+ + L WP      +  NG  Y  +Q HWH PSE
Sbjct  76   RVKVINKSGELKKRYKPCHAIVKNRGHDISLQWPNYDAGSIKTNGTEYFLQQAHWHSPSE  135

Query  408  HVVNGTRYDLEAHLVHVSND  467
            H +NG RY LE H+VH   D
Sbjct  136  HTINGRRYALELHMVHQCKD  155



>ref|XP_008227264.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=282

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 81/144 (56%), Gaps = 1/144 (1%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            +  F     L S    + +QEV+DE  F Y   S +GP  WGE++ EW  C  G +Q+PI
Sbjct  11   ISYFLFFVFLFSYFTSLAAQEVEDEREFDYLHESGKGPKQWGEIKEEWAACKNGSLQSPI  70

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL S  V +  +LG ++  Y  D ATL+N G+ + + W      + ING  Y  +Q HWH
Sbjct  71   DLSSHRVKLIPHLGNLKTSYKPDNATLKNRGHDISVQWETNAGSIEINGTEYFLKQCHWH  130

Query  396  FPSEHVVNGTRYDLEAHLVHVSND  467
             PSEH +N   YD+E H++H+S D
Sbjct  131  SPSEHSINNRSYDMELHMIHISPD  154



>ref|XP_011077301.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=278

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 80/138 (58%), Gaps = 1/138 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            I   +L+    I +QEVDDE  F Y  NSD GP  WG+++ EW  C+ G +Q+PID+ ++
Sbjct  17   IVLFILAGPKSIDAQEVDDEREFEYAANSDMGPGKWGQIKKEWAACNNGSLQSPIDMSNE  76

Query  234  PVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
             V   +    + Y   + AT+ N G+ + + W      + ING  Y  R  HWH PSEH 
Sbjct  77   RVRIISRSEKRTYRAAN-ATVRNRGHDIQMQWFGDAGSIFINGTEYPLRNAHWHSPSEHT  135

Query  414  VNGTRYDLEAHLVHVSND  467
            +NG RYDLE HLVH++ D
Sbjct  136  INGRRYDLELHLVHLNTD  153



>sp|F4IHR4.2|ATCA2_ARATH RecName: Full=Alpha carbonic anhydrase 2; Short=AtaCA2; Short=AtalphaCA2; 
AltName: Full=Alpha carbonate dehydratase 2; Flags: 
Precursor [Arabidopsis thaliana]
Length=245

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 94/157 (60%), Gaps = 10/157 (6%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLS--------VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWW  185
            MD + +    FL+L+        ++     +EV+DE  FSY+ N + GP+ WG+LRPEW 
Sbjct  1    MDKISIRCFIFLVLTSFVTTVSCLSAATDYREVEDEHEFSYEWNQENGPAKWGKLRPEWK  60

Query  186  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGIN  359
             C  G+MQ+PIDL +K V + ++L  +  +Y    ATL+N G+ MML +   G   + +N
Sbjct  61   MCGKGEMQSPIDLMNKRVRLVTHLKKLTRHYKPCNATLKNRGHDMMLKFGEEGSGSITVN  120

Query  360  GIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            G  Y   Q+HWH PSEH +NG R+ LE H+VH + +G
Sbjct  121  GTEYKLLQLHWHSPSEHTMNGRRFALELHMVHENING  157



>ref|XP_007213463.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
 gb|EMJ14662.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
Length=282

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 81/144 (56%), Gaps = 1/144 (1%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            +  F     L S    + +QEV+DE  F Y   S +GP  WGE++ EW  C  G +Q+PI
Sbjct  11   ISYFLFFVFLFSYFTSLAAQEVEDEREFDYLHESGKGPKQWGEIKEEWAACKNGSLQSPI  70

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL S  V +  +LG ++  Y  D ATL+N G+ + + W      + ING  Y  +Q HWH
Sbjct  71   DLSSHRVKLIPHLGNLKTGYKPDNATLKNRGHDISIQWETNAGSIEINGTEYFLKQCHWH  130

Query  396  FPSEHVVNGTRYDLEAHLVHVSND  467
             PSEH +N   YD+E H++H+S D
Sbjct  131  SPSEHSINNRSYDMELHMIHISPD  154



>ref|XP_010916593.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=270

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 84/147 (57%), Gaps = 1/147 (1%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +L    +A L    T  + S   +DE  FSY   S RGP HWGEL+  W  C  GK+Q+P
Sbjct  8    LLSSIFLAILFFFNTSPVTSCSQEDEREFSYVRGSKRGPEHWGELKNSWSACGTGKLQSP  67

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL  + V V   LG +++ Y    A ++N G+ + + W      + ING +Y+ +Q+HW
Sbjct  68   IDLSDERVRVLPQLGELRSSYHPANAVMKNRGHDIEIEWKNQTGGIWINGTKYVLQQLHW  127

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH +NG RY LE H+VH + D +
Sbjct  128  HLPSEHTINGRRYSLELHMVHQTADNK  154



>ref|XP_004172039.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like, partial [Cucumis sativus]
Length=248

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 81/128 (63%), Gaps = 1/128 (1%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            I +QEV+DE  F Y E S +GP HWGE++ EW  C+ G +Q+PIDL S+ V +   LG +
Sbjct  23   ISAQEVEDEREFDYAEGSQKGPGHWGEIKKEWEACNNGDLQSPIDLSSQRVKIVPQLGEL  82

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
            +  Y    AT++N G+ + + W      + ING  Y  +Q HWH PSEH VNG RYDLE 
Sbjct  83   KRSYYPCNATVKNRGHDISVYWYGKPGSIEINGDVYDLQQSHWHSPSEHSVNGRRYDLEL  142

Query  444  HLVHVSND  467
            H+VH S+D
Sbjct  143  HMVHQSSD  150



>ref|XP_004300792.1| PREDICTED: alpha carbonic anhydrase 7-like [Fragaria vesca subsp. 
vesca]
Length=283

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 2/130 (2%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            I +QEV+DE  F Y ++S +GP HWG+LR +W  C  G MQ+PIDL S+ V V  N G +
Sbjct  28   ITAQEVEDETEFDYLKDSGKGPEHWGDLREDWAACKNGTMQSPIDLRSEIVQVRPNKGEV  87

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  440
            +  Y    AT+ N G+ + + W LG    + ING  Y   Q HWH PSEH +NG R+DLE
Sbjct  88   KLKYKPSNATIRNRGHDISIQWKLGDAGSVEINGTDYWLIQGHWHSPSEHTINGKRFDLE  147

Query  441  AHLVHVSNDG  470
             H+VH+  D 
Sbjct  148  LHMVHLIPDA  157



>ref|XP_010279581.1| PREDICTED: alpha carbonic anhydrase 4-like [Nelumbo nucifera]
Length=270

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = +3

Query  75   VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSN  251
            +T    + E++DE  F+Y+E S++GP HWGE+ P W  C  G+MQ+PIDL  K V V S 
Sbjct  22   ITTRAAASELEDEHEFTYEEGSEKGPEHWGEIDPHWRVCGNGEMQSPIDLLDKRVEVVSG  81

Query  252  LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRY  431
            LG ++  Y    A + N G+ +M+ W      + IN   Y  +Q HWH PSEH  N +RY
Sbjct  82   LGKLKRDYRPAPAAVMNRGHDIMIEWKGDAGKININRTDYYLKQCHWHSPSEHTFNKSRY  141

Query  432  DLEAHLVHVSNDG  470
            +LE HLVH+++ G
Sbjct  142  NLELHLVHINSSG  154



>ref|XP_007027463.1| Alpha carbonic anhydrase 7 isoform 1 [Theobroma cacao]
 gb|EOY07965.1| Alpha carbonic anhydrase 7 isoform 1 [Theobroma cacao]
Length=282

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 81/139 (58%), Gaps = 2/139 (1%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
            A L LS +  + +QEV+DE  F Y ENS +GPS WG+L+ EW  C  G +Q+PID+ S  
Sbjct  17   AVLFLSYSASVSAQEVEDEREFDYLENSGKGPSQWGDLKKEWVACKNGGLQSPIDMSSLR  76

Query  237  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWP-LGQRYLGINGIRYLFRQVHWHFPSEH  410
            V V +  G ++  Y    A ++N G+ + L WP      +  NG  Y  +Q HWH PSEH
Sbjct  77   VKVINKSGELKKRYKPCHAIVKNRGHDISLQWPNYDAGSIKTNGTEYFLQQAHWHSPSEH  136

Query  411  VVNGTRYDLEAHLVHVSND  467
             +NG RY LE H+VH   D
Sbjct  137  TINGRRYALELHMVHQCKD  155



>ref|XP_010036663.1| PREDICTED: alpha carbonic anhydrase 4-like isoform X2 [Eucalyptus 
grandis]
Length=256

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 84/147 (57%), Gaps = 4/147 (3%)
 Frame = +3

Query  45   LFSIAFL---LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
             F++ F+   LL         EV DE  F+Y E + +GP  WG++ P W  CS GK+Q+P
Sbjct  12   FFALVFVAHGLLLTRSTASESEVGDETPFTYIEGTGKGPKEWGQIDPHWRACSTGKLQSP  71

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL  + V V+ NLG ++  Y    A + N G+ + + W      + ING  Y   Q HW
Sbjct  72   IDLLDERVQVFPNLGKLKRDYKPAPAIVRNRGHDITVMWKGYAGQININGTYYKLLQCHW  131

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH  NG++YDLE H+VH+S+ GE
Sbjct  132  HSPSEHTFNGSKYDLELHVVHLSSHGE  158



>ref|XP_006339092.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=269

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 86/144 (60%), Gaps = 4/144 (3%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            LF I F   +    IK+QEV+DE  F Y E S++GP  WG+L+ EW  C+ G+MQ+PID+
Sbjct  10   LFIIIFFSATF---IKAQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEMQSPIDM  66

Query  225  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
              + V      P + +Y    AT++N G+ + L W      + ING  Y  +Q HWH PS
Sbjct  67   SHERVRIIQ-KPDKRHYKLCNATVKNRGHDISLQWHGDAGSVSINGTNYPLQQAHWHSPS  125

Query  405  EHVVNGTRYDLEAHLVHVSNDGED  476
            EH VNG RYD+E H+VH++ +  +
Sbjct  126  EHTVNGRRYDMEMHMVHLNENATN  149



>ref|XP_010558882.1| PREDICTED: alpha carbonic anhydrase 7-like [Tarenaya hassleriana]
Length=272

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 9/146 (6%)
 Frame = +3

Query  60   FLLLSVTHVIKSQ--------EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            F LL V+    S+        EV+DE  F Y++N  +GP +WG+L+PEW  C  GKMQ+P
Sbjct  10   FFLLFVSAAAVSRMNAASSGGEVEDEHEFDYEKNGAKGPKNWGKLKPEWKLCGEGKMQSP  69

Query  216  IDL-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL   +  + SN G +   Y    A L+N G+ MML +  G   + IN ++Y   Q+HW
Sbjct  70   IDLFHDRVRLVSNTGMLNEDYHPSNAVLKNRGHDMMLKFEHGAGSIEINDMQYELGQLHW  129

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDG  470
            H PSEH +NG R+ LE H+VH S +G
Sbjct  130  HSPSEHTINGKRFALELHMVHESKNG  155



>ref|XP_008443579.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=277

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 93/153 (61%), Gaps = 9/153 (6%)
 Frame = +3

Query  36   MLKL----FSIAFLLLSVTHV----IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQC  191
            ML+L    F++AFL    + +    + S ++ +E  F Y   S++GP+ WG ++ EW  C
Sbjct  1    MLRLSQSSFTLAFLTFLTSTLLWASVISHQLQEECEFDYIGGSNKGPTKWGAIKREWANC  60

Query  192  SAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIR  368
            + GKMQ+PIDL +K + V +++G +   Y+   A L+N G+ + + W      + ING +
Sbjct  61   NYGKMQSPIDLSTKTIQVVNSMGQLNKRYIPFGAILKNRGHDVSVGWEGNAGSIEINGTQ  120

Query  369  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSND  467
            Y  +Q HWH PSEH +NG RYDLE H+VH S++
Sbjct  121  YFLKQTHWHSPSEHTINGKRYDLELHVVHQSSN  153



>ref|XP_008227274.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=282

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 1/128 (1%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            +++QEV+DE  F Y + S +GP  WGE++ EW  C  G MQ+PIDL S+ V +  NLG +
Sbjct  28   VEAQEVEDEREFDYLQRSGKGPKQWGEMKKEWAACKNGVMQSPIDLSSQRVKLIPNLGKL  87

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
               Y    AT++N G+ + + W      + ING  YL +Q HWH PSEH +NG R  +E 
Sbjct  88   NTTYKPCNATVKNRGHDISMEWMGNAGSIQINGTEYLLKQCHWHSPSEHSINGRRNAMEL  147

Query  444  HLVHVSND  467
            H+VH+S D
Sbjct  148  HMVHLSLD  155



>ref|XP_004304476.1| PREDICTED: alpha carbonic anhydrase 7-like [Fragaria vesca subsp. 
vesca]
Length=284

 Score =   119 bits (298),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            I +QEV+DE  F Y ++S++GP HWGELR EW  C  G +Q+P+DL S+ V V+ N G +
Sbjct  30   ITAQEVEDEREFDYLKDSEKGPKHWGELREEWAACKNGTLQSPVDLLSEIVEVHPNKGEV  89

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  440
            +  Y    AT+ N G+ + + W LG    + ING  Y   Q HWH P+EH +NG  +DLE
Sbjct  90   RLKYRPSNATIRNRGHDISIQWKLGDAGSMEINGTDYWLDQCHWHSPTEHTINGKIFDLE  149

Query  441  AHLVHVSNDGE  473
             H+VH+  D +
Sbjct  150  LHMVHLIPDAK  160



>ref|XP_004137981.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=352

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = +3

Query  102  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  278
            V++E  F Y + S +GPS WG+++ EW +C+ G MQ+PIDL +K V V  +LG ++N Y 
Sbjct  104  VENESEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVKHLGQLKNKYK  163

Query  279  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  458
              +A ++N G+ + + W      + ING  YL +Q HWH PSEH +NG RYDLE HLVH 
Sbjct  164  PSIAIIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHLVHQ  223

Query  459  SND  467
            S++
Sbjct  224  SSN  226


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = +3

Query  42   KLFSIAFLLLSVTHVIKSQEVDDEWG----FSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            + FS+AFL++  + ++ +  +  + G    F Y   S++GP+ WG ++ EW +C+ GKMQ
Sbjct  6    RTFSLAFLIILTSTLLWASVLSHQPGEVCEFDYIGGSNKGPTKWGAIKEEWSKCNNGKMQ  65

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMML  323
            +PIDL +  + V ++LGP+   Y    ATL N G+ + +
Sbjct  66   SPIDLSTNTINVVNSLGPLNREYNPFSATLRNRGHDISV  104



>gb|KHG29611.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=278

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 82/139 (59%), Gaps = 2/139 (1%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES-K  233
             FL LS +  + + E ++E  F Y ENS++GPSHWG+L+ EW  C  G +Q+PIDL S +
Sbjct  19   TFLFLSYSASVSADEEENEREFDYLENSEKGPSHWGDLKMEWSACKNGVLQSPIDLSSQR  78

Query  234  PVVYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSEH  410
              + +  G ++  Y    A L N G+ + L W       + ING  Y  +QVHWH PSEH
Sbjct  79   AKIVNKAGELKKTYKPCDAILRNRGHDISLKWHNCFAGLININGSEYSLQQVHWHSPSEH  138

Query  411  VVNGTRYDLEAHLVHVSND  467
             +NG RY LE H+VH S D
Sbjct  139  TINGARYALELHMVHHSTD  157



>ref|XP_002323272.2| hypothetical protein POPTR_0016s04300g [Populus trichocarpa]
 gb|EEF05033.2| hypothetical protein POPTR_0016s04300g [Populus trichocarpa]
Length=283

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 92/153 (60%), Gaps = 4/153 (3%)
 Frame = +3

Query  21   IEDMDMLKLFSIAFLL--LSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  194
            I  M  L L S+  +   L+++  ++S EV+DE  F+Y+E ++ GP +WG++ P W  C 
Sbjct  12   INMMSFLLLVSLIIVSYSLAISLALES-EVEDETQFTYEEGTEEGPKNWGKINPHWEACG  70

Query  195  AGKMQTPID-LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  371
             GKMQ+PID L+ +  V+ NLG ++  Y    A ++N G+ + + W      + IN   Y
Sbjct  71   KGKMQSPIDVLDRRVEVFPNLGKLRRDYQAAPAAVKNRGHDITVIWKGDAGKITINDTDY  130

Query  372  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
              +Q HWH PSEH  NG+R+DLE HLVH S+ G
Sbjct  131  QLQQCHWHSPSEHTFNGSRHDLELHLVHYSSQG  163



>ref|XP_010036662.1| PREDICTED: alpha carbonic anhydrase 4-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW48290.1| hypothetical protein EUGRSUZ_K02021 [Eucalyptus grandis]
Length=277

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 84/147 (57%), Gaps = 4/147 (3%)
 Frame = +3

Query  45   LFSIAFL---LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
             F++ F+   LL         EV DE  F+Y E + +GP  WG++ P W  CS GK+Q+P
Sbjct  12   FFALVFVAHGLLLTRSTASESEVGDETPFTYIEGTGKGPKEWGQIDPHWRACSTGKLQSP  71

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL  + V V+ NLG ++  Y    A + N G+ + + W      + ING  Y   Q HW
Sbjct  72   IDLLDERVQVFPNLGKLKRDYKPAPAIVRNRGHDITVMWKGYAGQININGTYYKLLQCHW  131

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH  NG++YDLE H+VH+S+ GE
Sbjct  132  HSPSEHTFNGSKYDLELHVVHLSSHGE  158



>ref|XP_008383977.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=339

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 86/154 (56%), Gaps = 3/154 (2%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            L+ F++  +LL +  + + ++ +D E  F Y E S++GP HWGEL+ EW  C  GK Q+P
Sbjct  10   LRFFALTIILLYLHPIALTAKPLDQEIEFDYREGSEKGPQHWGELKKEWTACKDGKSQSP  69

Query  216  IDL--ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  389
            IDL  +    V      +  ++    ATL+N G+ + L W      + ING  Y  +Q H
Sbjct  70   IDLMEDGATKVIPTFRDLTMHHKPSGATLKNEGHYIALEWEGDAGSIQINGTNYFLKQCH  129

Query  390  WHFPSEHVVNGTRYDLEAHLVHVSNDGEDCSACS  491
            WH PSEH +NG RYDLE H+VH S D    +  +
Sbjct  130  WHTPSEHTINGIRYDLELHMVHRSADKNSVAVIA  163



>gb|KGN58999.1| hypothetical protein Csa_3G742870 [Cucumis sativus]
Length=280

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 91/145 (63%), Gaps = 5/145 (3%)
 Frame = +3

Query  42   KLFSIAFLLLSVTHVIKSQEVDDEWG----FSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            + FS+AFL++  + ++ +  +  + G    F Y   S++GP+ WG ++ EW +C+ GKMQ
Sbjct  6    RTFSLAFLIILTSTLLWASVLSHQPGEVCEFDYIGGSNKGPTKWGAIKEEWSKCNNGKMQ  65

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            +PIDL +  + V ++LGP+   Y    ATL N G+ + ++W      + IN  +YL +Q+
Sbjct  66   SPIDLSTNTINVVNSLGPLNREYNPFSATLRNRGHDISVAWEGNVGSIEINWTKYLLKQI  125

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVS  461
            HWH PSEH +NG RYDLE H+VH S
Sbjct  126  HWHSPSEHTLNGRRYDLELHVVHES  150



>emb|CDY27409.1| BnaC03g64490D [Brassica napus]
Length=268

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 83/144 (58%), Gaps = 2/144 (1%)
 Frame = +3

Query  48   FSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            F++ FL LS +++   +  EVDDE  F+Y++N ++GP  WG++ P W  C+ GK Q+PID
Sbjct  11   FALFFLYLSFSNISLARGAEVDDETSFTYEKNPEKGPEGWGKINPHWKTCNIGKFQSPID  70

Query  222  LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
            L +  V        +  Y    A + N G+ +M+SW      + I    Y   Q HWH P
Sbjct  71   LTNTRVSIIRDEAWRRQYKPAPAVIVNRGHDVMVSWKGDAGKITIRRTEYKLVQCHWHSP  130

Query  402  SEHVVNGTRYDLEAHLVHVSNDGE  473
            SEH VNGTRYD+E H+VH S  G+
Sbjct  131  SEHTVNGTRYDMELHMVHTSAGGK  154



>ref|XP_008778933.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=273

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 86/139 (62%), Gaps = 1/139 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            +A  LL       ++EV DE  FSY+ +S+ GP +WG++  +W  C+ G+MQ+P+DL  K
Sbjct  13   VAVFLLRCIPRTTAEEVGDEREFSYESDSEHGPENWGKIHEDWAICNKGQMQSPLDLLDK  72

Query  234  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  410
             V V+ +LGP++  Y   +A ++N G+ +M+ W      + IN   Y  +Q+HWH PSEH
Sbjct  73   RVQVHHHLGPLRRTYRAALAVVKNRGHDIMVKWEEDPGAIWINETMYTLKQLHWHAPSEH  132

Query  411  VVNGTRYDLEAHLVHVSND  467
             +NG RY +E H+VH S D
Sbjct  133  TLNGRRYAVEMHMVHESAD  151



>ref|XP_002529417.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32943.1| carbonic anhydrase, putative [Ricinus communis]
Length=253

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = +3

Query  108  DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL---ESKPVVYSNLGPIQNYYM  278
            DE  FSY++N ++GP+ WGEL  EW  CS+G MQ+PIDL   +   +  S  G  +NY  
Sbjct  8    DEKEFSYEKNDEKGPARWGELTEEWKTCSSGSMQSPIDLPINQRVQLASSTEGLNRNYSA  67

Query  279  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  458
             D A L+N G+ + L W  G   + ING  Y  +Q+HWH PSEH +NG R+ LE H+VH 
Sbjct  68   SD-AILKNTGHDIELEWEAGAGTIEINGTEYTLKQLHWHSPSEHTINGRRFALEMHMVHE  126

Query  459  SNDGE  473
            S DG+
Sbjct  127  SKDGK  131



>ref|XP_004168623.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=280

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 91/145 (63%), Gaps = 5/145 (3%)
 Frame = +3

Query  42   KLFSIAFLLLSVTHVIKSQEVDDEWG----FSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            + FS+AFL++  + ++ +  +  + G    F Y   S++GP+ WG ++ EW +C+ GKMQ
Sbjct  6    RTFSLAFLIILTSTLLWASVLSHQPGEVCEFDYIGGSNKGPTKWGAIKEEWSKCNNGKMQ  65

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            +PIDL +  + V ++LGP+   Y    ATL N G+ + ++W      + IN  +YL +Q+
Sbjct  66   SPIDLSTNTINVVNSLGPLTREYNPFSATLRNRGHDISVAWEGNVGSIEINWTKYLLKQI  125

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVS  461
            HWH PSEH +NG RYDLE H+VH S
Sbjct  126  HWHSPSEHTLNGRRYDLELHVVHES  150



>gb|EYU38572.1| hypothetical protein MIMGU_mgv1a011717mg [Erythranthe guttata]
Length=272

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 82/136 (60%), Gaps = 1/136 (1%)
 Frame = +3

Query  60   FLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV  239
             +LL     I +QEV+DE  F Y +  ++GP  WGE++ EW  C+ G  Q+PID+ ++ V
Sbjct  11   IVLLFGAKSINAQEVEDEREFDYSKKGEKGPRKWGEIKKEWGACNNGSFQSPIDMSNERV  70

Query  240  VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVN  419
            V  +    +NY + + AT++N G+ + + W      + IN   Y  RQ HWH PSEH +N
Sbjct  71   VIFSRPEKRNYRLTN-ATIKNRGHDIQIEWFGDAGSIFINNTEYPLRQAHWHSPSEHTIN  129

Query  420  GTRYDLEAHLVHVSND  467
            G RYD+E HLVH++ D
Sbjct  130  GRRYDMELHLVHLNTD  145



>gb|KHG05281.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=286

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 83/141 (59%), Gaps = 3/141 (2%)
 Frame = +3

Query  48   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  227
            FS+ FL  S +     +EV+DE  F Y+EN  +GP HWG+L+ EW  C  G +Q+PIDL 
Sbjct  26   FSVLFLCFSASVAHNDEEVEDEREFDYNENGAKGPHHWGDLKKEWAACKNGAIQSPIDLT  85

Query  228  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
            +  V + +    I+  Y    + ++N G+ +      G   + I+GI Y+  QVHWH PS
Sbjct  86   NDRVKIITKSVKIEKNYKPAESIIKNRGHDISPDHKAGS--ITIDGIEYVLLQVHWHSPS  143

Query  405  EHVVNGTRYDLEAHLVHVSND  467
            EH +NG RY LEAH+VH + D
Sbjct  144  EHTINGKRYALEAHMVHKAAD  164



>ref|XP_009592985.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana tomentosiformis]
Length=272

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 87/148 (59%), Gaps = 1/148 (1%)
 Frame = +3

Query  54   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  233
            I FLL      I++QEV+DE  F Y   S++GP  WG+L+ EW  C+ G+MQ+PIDL ++
Sbjct  13   IYFLLFLPATSIRAQEVEDEREFDYAAKSEKGPRMWGKLKKEWDACNKGEMQSPIDLSNE  72

Query  234  PVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
             V        +NY + + AT++N G+ + L W      + ING  Y  +Q HWH PSEH 
Sbjct  73   RVRIIRKPEKRNYKLCN-ATVKNRGHDISLQWHGNAGSVLINGTEYPLQQAHWHSPSEHT  131

Query  414  VNGTRYDLEAHLVHVSNDGEDCSACSDV  497
            VNG RY +E H+VH++ +  +  A   V
Sbjct  132  VNGRRYAMEMHMVHLNENATNKIAVIGV  159



>ref|XP_006401345.1| hypothetical protein EUTSA_v10014359mg [Eutrema salsugineum]
 gb|ESQ42798.1| hypothetical protein EUTSA_v10014359mg [Eutrema salsugineum]
Length=275

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 89/149 (60%), Gaps = 10/149 (7%)
 Frame = +3

Query  57   AFLLLSVTHVI-------KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
             FLL+ VT  I          EV+DE  FSY+    +GP+  G L+ +W  C  GKMQ+P
Sbjct  9    VFLLIIVTISIVLSAPPPPGGEVEDETEFSYETLGKKGPAKRGTLKEDWKMCGTGKMQSP  68

Query  216  IDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQV  386
            ID+  K VV +  LG ++++Y+    T++N G+ +ML +  G +  GI     +Y  +Q+
Sbjct  69   IDIRDKNVVVTYKLGSLRSHYLPSNTTMKNRGHDIMLKFKGGNQGFGIIIGNTKYKLQQL  128

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            HWH PSEH +NG R+ LEAHLVH S +G+
Sbjct  129  HWHSPSEHTINGKRFALEAHLVHESKNGK  157



>ref|XP_010439535.1| PREDICTED: alpha carbonic anhydrase 4 [Camelina sativa]
Length=267

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 86/149 (58%), Gaps = 1/149 (1%)
 Frame = +3

Query  27   DMDMLKLFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  203
            + + +  F++ F+ LS   + + + EVDDE  F+Y++ +++GP  WG++ PEW  C+ G+
Sbjct  4    NTNTIFFFALFFIYLSFPEISLANSEVDDETSFTYEQKTEKGPEGWGQINPEWKVCNTGR  63

Query  204  MQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ  383
             Q+PIDL ++ V   +       Y    A + N G+ +M+SW      + I    +   Q
Sbjct  64   FQSPIDLTNERVSLIHDQAWNRQYQPAPAVITNRGHDIMVSWKGDAGKITIRQTDFKLVQ  123

Query  384  VHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
             HWH PSEH VNGTRYDLE H+VH S  G
Sbjct  124  CHWHSPSEHTVNGTRYDLELHMVHTSARG  152



>gb|EMT00558.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=284

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 87/146 (60%), Gaps = 1/146 (1%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            L LFS + +L +V      QE + E  FSY  +++ GP+HWGE++ EW  C  G++Q+PI
Sbjct  18   LLLFSASIILSAVPAARAQQETEHEEEFSYSLDAENGPAHWGEIKEEWSACGKGEIQSPI  77

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL    V +   LG + + Y    A++ N G+ +M+ +      + I+G  Y  RQ+HWH
Sbjct  78   DLAGPRVTLVRRLGHLNHSYAPANASIVNRGHDIMVRFEGDAGSVSIDGTAYHLRQLHWH  137

Query  396  FPSEHVVNGTRYDLEAHLVHVSNDGE  473
             P+EH VNG RYD+E H+VH S  G+
Sbjct  138  APTEHSVNGRRYDMELHMVHQSAQGK  163



>ref|XP_008464600.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like [Cucumis 
melo]
Length=278

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 75/128 (59%), Gaps = 1/128 (1%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  275
            EV DE  FSY+E +  GP  WG+L+PEW  C  GK Q+PI++  + V V  NLG +   Y
Sbjct  38   EVGDESLFSYNEGNGNGPKEWGKLKPEWKSCGKGKYQSPINIVEEDVQVLPNLGKLTRDY  97

Query  276  MRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
                A L+N G+ +++ W      + +NG +Y   Q HWH PSEH  NG RYDLE H+VH
Sbjct  98   NPAPAILKNRGHDILIRWEKDAGKITMNGTKYKLSQCHWHAPSEHSFNGKRYDLEMHIVH  157

Query  456  VSNDGEDC  479
             SN  E  
Sbjct  158  TSNHNETA  165



>ref|XP_008351630.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 81/140 (58%), Gaps = 1/140 (1%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
            +FL +    +  S EV DE  F+Y E + +GP  WG++ P+W  C  GKMQ+PIDL  + 
Sbjct  22   SFLTICNAALEDSDEVGDETAFTYLEGTGKGPKKWGQIDPQWKVCDNGKMQSPIDLLDQR  81

Query  237  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
            V V+  LG ++  Y    A ++N G+ + + W        ING  Y   Q HWH PSEH 
Sbjct  82   VQVFPKLGKLKRXYKPAPAIVKNRGHDITMRWNGDAGKTKINGTDYRLLQCHWHSPSEHT  141

Query  414  VNGTRYDLEAHLVHVSNDGE  473
             NG+RY LE H+VHVS+ G+
Sbjct  142  FNGSRYALEFHIVHVSSTGK  161



>ref|XP_010696307.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=279

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 1/126 (1%)
 Frame = +3

Query  93   SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  269
            +QEVDDE  F Y   S+RGP  WG +R EW  C  G+ Q+PIDL  + V V      I  
Sbjct  27   AQEVDDETEFDYLRGSERGPDRWGHIREEWATCRTGRYQSPIDLLHRRVQVIPKSAEIVK  86

Query  270  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
            +Y    AT+ N G+ +M+ W      + ING  Y+ RQ HWH PSEH +NG+R+  E HL
Sbjct  87   FYKAGNATVRNRGHDIMIEWEGEDSKIQINGTTYILRQCHWHSPSEHTINGSRFAAELHL  146

Query  450  VHVSND  467
            VH + D
Sbjct  147  VHQTPD  152



>ref|XP_009358738.1| PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]
Length=339

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 86/154 (56%), Gaps = 3/154 (2%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            L+ F++  +LL +  + + ++ +D E  F Y E S++GP HWGEL+ EW  C  GK Q+P
Sbjct  10   LQFFALTIILLYLHPIALTAKPLDQEIEFDYREGSEKGPQHWGELKKEWTACKDGKSQSP  69

Query  216  IDL--ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  389
            IDL  +    V      +  ++    ATL+N G+ + L W      + ING  Y  +Q H
Sbjct  70   IDLMEDGATKVIPTFRDLTMHHKPSGATLKNDGHYVALEWEGDAGSIQINGTNYFLKQCH  129

Query  390  WHFPSEHVVNGTRYDLEAHLVHVSNDGEDCSACS  491
            WH PSEH +NG RYDLE H+VH S D    +  +
Sbjct  130  WHTPSEHTINGIRYDLELHMVHRSADKNSVAVIA  163



>ref|XP_008462491.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=276

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  263
            I +QEV+DE  F Y E S +GP HWGE++ EW  C+ G +Q+PIDL S+ V +   LG +
Sbjct  23   ISAQEVEDERDFDYVEWSQKGPGHWGEIKKEWEACNNGDLQSPIDLSSERVKIVPQLGEL  82

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
            +  Y    AT++N G+ + + W      + ING+ Y  +Q HWH PSEH +NG RYDLE 
Sbjct  83   KRNYYPCNATVKNRGHDISVYWYGKPGSIEINGVVYDLQQSHWHSPSEHSINGRRYDLEL  142

Query  444  HLVHVSND  467
            H+VH S+D
Sbjct  143  HMVHQSSD  150



>emb|CDX76404.1| BnaA08g09960D [Brassica napus]
Length=268

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 82/144 (57%), Gaps = 2/144 (1%)
 Frame = +3

Query  48   FSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            F++ FL L  +++   +  EVDDE  F+Y++N ++GP  WG++ P W  C+ GK Q+PID
Sbjct  11   FALFFLYLCFSNISLARGAEVDDETPFTYEQNPEKGPEGWGKINPHWKTCNTGKFQSPID  70

Query  222  LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
            L +  V        +  Y    A + N G+ +M+SW      + I    Y   Q HWH P
Sbjct  71   LTNARVSIIRDEAWRRQYKPAPAVIVNRGHDVMVSWKGDAGKITIRRTEYKLVQCHWHSP  130

Query  402  SEHVVNGTRYDLEAHLVHVSNDGE  473
            SEH VNGTRYD+E H+VH S  G+
Sbjct  131  SEHTVNGTRYDMELHMVHTSAGGK  154



>ref|XP_007132283.1| hypothetical protein PHAVU_011G081900g [Phaseolus vulgaris]
 gb|ESW04277.1| hypothetical protein PHAVU_011G081900g [Phaseolus vulgaris]
Length=274

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 82/139 (59%), Gaps = 1/139 (1%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  236
            A +LLS   +  S+EV++E  F+YD  S  GP +WG++ PEW  C  G MQ+PI+  +  
Sbjct  16   ALVLLSCP-ITMSEEVENEKEFTYDMKSKSGPENWGDIEPEWNLCKKGSMQSPINFLNGV  74

Query  237  VVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVV  416
               +NLG ++  Y      L N G+ + + W  G+  + ING +Y   Q HWH PSEH +
Sbjct  75   QKVNNLGELKINYKPSKVVLVNRGHDIKVKWVGGKSNIEINGTKYDLIQSHWHSPSEHAI  134

Query  417  NGTRYDLEAHLVHVSNDGE  473
            +GTR DLE H+VH +  GE
Sbjct  135  DGTRLDLELHMVHQTPSGE  153



>ref|XP_006417731.1| hypothetical protein EUTSA_v10009315mg, partial [Eutrema salsugineum]
 gb|ESQ36084.1| hypothetical protein EUTSA_v10009315mg, partial [Eutrema salsugineum]
Length=250

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = +3

Query  99   EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  275
            EV+DE  F+Y +N ++GP  WG+L+ EW  C  G +Q+PIDL ++ V   S+LG +   Y
Sbjct  32   EVEDEHEFNYKKNDEKGPERWGKLKSEWEMCGKGDIQSPIDLMNERVNTVSHLGRLNRDY  91

Query  276  MRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
                ATL+N G+ +ML +  G   + +NG +Y  +Q+HWH PSEH +NG R+ LE H+VH
Sbjct  92   RPSNATLKNRGHDIMLKFEDGAGSIKMNGFQYELQQLHWHSPSEHTINGRRFALELHMVH  151

Query  456  VSNDG  470
                G
Sbjct  152  EGKKG  156



>ref|XP_010696308.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=289

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 77/130 (59%), Gaps = 1/130 (1%)
 Frame = +3

Query  87   IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-ESKPVVYSNLGPI  263
            I +QE +DE  F+Y +  + GP +WG ++PEW  C+ G+ Q+PI+L  S P    +   I
Sbjct  26   IVAQEAEDESEFNYIQGDEIGPENWGNIKPEWATCNTGRKQSPINLLASNPQRVPSSERI  85

Query  264  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  443
              +Y      ++N G+ + L W  G   + ING+ Y+ RQ HWH PSEH +NG RY LEA
Sbjct  86   TRFYKPGQTIIKNRGHDIKLEWTEGSSRIQINGVDYILRQCHWHSPSEHTINGKRYALEA  145

Query  444  HLVHVSNDGE  473
            HL H S D +
Sbjct  146  HLTHESVDNK  155



>ref|XP_009775004.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana sylvestris]
Length=272

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 87/146 (60%), Gaps = 1/146 (1%)
 Frame = +3

Query  60   FLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV  239
            F+L   +  I++QEV+DE  F Y   S++GP  WG+++ EW  C+ G+MQ+PIDL ++ V
Sbjct  15   FVLFFFSTSIRAQEVEDEREFDYAVKSEKGPRMWGKMKKEWEACNNGEMQSPIDLSNERV  74

Query  240  VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVN  419
                    +NY + + AT++N G+ + L W      L ING  Y  +Q HWH PSEH VN
Sbjct  75   RIIRKPEKRNYKLCN-ATVKNRGHDISLQWHGDAGSLLINGTEYPLQQAHWHSPSEHTVN  133

Query  420  GTRYDLEAHLVHVSNDGEDCSACSDV  497
            G RY +E H+VH++ +  +  A   V
Sbjct  134  GRRYAMEMHMVHLNENATNKIAVIGV  159



>dbj|BAD09855.1| putative dioscorin class A precursor [Oryza sativa Japonica Group]
Length=229

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = +3

Query  96   QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  272
            +E D E  F+Y    ++GP HWG+L+PEW QC AG+MQ+PIDL  + V +  +LG + + 
Sbjct  28   EETDHEEEFTYISGDEKGPEHWGKLKPEWAQCGAGEMQSPIDLSHERVKLVRDLGYLDDS  87

Query  273  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  452
            Y    A++ N G+ +M+ +      + ING  Y  RQ+HWH P+EH V+G RYD+E H+V
Sbjct  88   YRAAEASIVNRGHDIMVRFDGDAGSVVINGTAYYLRQLHWHSPTEHSVDGRRYDMELHMV  147

Query  453  HVSND  467
            H S +
Sbjct  148  HESAE  152



>gb|KJB35974.1| hypothetical protein B456_006G135100 [Gossypium raimondii]
Length=279

 Score =   116 bits (290),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 82/148 (55%), Gaps = 2/148 (1%)
 Frame = +3

Query  24   EDMDMLKLFSIAFLLLSVTHVIKS-QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  200
            E+     +  I+FL   +   I S  EV +E  F+Y E S +GP  WG L P+W  C  G
Sbjct  8    EEPITFSILFISFLCYLLPIAIASFAEVGNESPFTYSEGSGKGPKEWGHLNPDWKLCETG  67

Query  201  KMQTPIDL-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLF  377
            K+Q+PIDL   K  V  NLG ++  Y    A ++N G+ + + W      + ING  Y  
Sbjct  68   KLQSPIDLLTGKLQVQPNLGKLKRDYKPAPALVKNRGHDITVRWKGEAGKININGTDYEL  127

Query  378  RQVHWHFPSEHVVNGTRYDLEAHLVHVS  461
             Q HWH PSEH  NGTRY+LE HLVH+S
Sbjct  128  LQCHWHSPSEHTFNGTRYELELHLVHIS  155



>ref|XP_010470127.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X1 [Camelina 
sativa]
Length=277

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 89/158 (56%), Gaps = 11/158 (7%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLS--------VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWW  185
            MD + +    FL+L+        ++     +EV+DE  FSY+   + GP  WG+L+PEW 
Sbjct  1    MDKVSIQCFIFLVLTSFVATVWCLSATTDYREVEDEREFSYERKKENGPEKWGKLKPEWK  60

Query  186  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW--PLGQRYLGI  356
             C  G++Q+PIDL +K V + ++   +   Y    ATL N G+ MML +    G   L I
Sbjct  61   LCGKGELQSPIDLMNKRVRLVTDFQKLTKDYKPCNATLINRGHDMMLRFEEEEGSGSLKI  120

Query  357  NGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            NG  Y   Q+HWH PSEH +NG R+ LE H+VH S +G
Sbjct  121  NGTEYKLLQLHWHSPSEHTINGRRFALELHMVHESKNG  158



>ref|XP_004303634.1| PREDICTED: alpha carbonic anhydrase 4-like [Fragaria vesca subsp. 
vesca]
Length=286

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 81/140 (58%), Gaps = 1/140 (1%)
 Frame = +3

Query  57   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-ESK  233
            +F ++    +  S EV DE  F+Y E + +GP  WG++ P W  C  GKMQ+PIDL +S+
Sbjct  28   SFFIICRAALDDSGEVGDELPFAYVEGTGKGPKKWGDIDPHWKACDNGKMQSPIDLLDSR  87

Query  234  PVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  413
              V+ NLG ++  Y    AT+ N G+ + + W      + IN   Y   Q HWH P+EH 
Sbjct  88   VQVFPNLGKLKRDYKPSPATVRNRGHDITVRWKKDAGKININSTDYNLVQCHWHSPAEHT  147

Query  414  VNGTRYDLEAHLVHVSNDGE  473
             NG+RY LE H++H S+ G+
Sbjct  148  FNGSRYALELHIIHTSSIGK  167



>ref|XP_010418826.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=187

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 89/158 (56%), Gaps = 11/158 (7%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLS--------VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWW  185
            MD + +    FL+L+        ++     +EV+DE  FSY+ N + GP  WG+L+PEW 
Sbjct  1    MDKVSIQCFIFLVLTSFVATVWCLSATTDYREVEDEREFSYERNKENGPEKWGKLKPEWK  60

Query  186  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWP--LGQRYLGI  356
             C  G++Q+PIDL +K V + ++   +   Y    ATL N G+ MML +    G     I
Sbjct  61   LCGKGELQSPIDLMNKRVRLVTDFQKLTKDYKPCNATLINRGHDMMLRFEEDEGPGSFKI  120

Query  357  NGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            NG  Y   Q+HWH PSEH +NG R+ LE HLVH + +G
Sbjct  121  NGTEYKLLQLHWHSPSEHTINGRRFALELHLVHENING  158



>ref|XP_010434249.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 85/149 (57%), Gaps = 1/149 (1%)
 Frame = +3

Query  27   DMDMLKLFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  203
            + + +  F++ F+ LS   + + + EVDDE  F+Y++ +++GP  WG + PEW  C+ G+
Sbjct  4    NTNTVFFFALFFIYLSFPKISLANSEVDDETPFTYEQKTEKGPEGWGNINPEWKVCNTGR  63

Query  204  MQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ  383
             Q+PIDL ++ V   +       Y    A + N G+ +M+SW      + I    +   Q
Sbjct  64   FQSPIDLTNERVSLIHDQAWNRQYQPAPAVITNRGHDIMVSWKGDAGKVTIRETDFKLVQ  123

Query  384  VHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
             HWH PSEH VNGTRYDLE H+VH S  G
Sbjct  124  CHWHSPSEHTVNGTRYDLELHMVHTSAGG  152



>ref|XP_010451325.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 82/143 (57%), Gaps = 1/143 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
             F++ F+ LS   + + + EVDDE  F+Y++ +++GP  WG + PEW  C+ G+ Q+PID
Sbjct  10   FFALFFIYLSFPKISLANSEVDDETPFTYEQKTEKGPEGWGNINPEWKVCNTGRFQSPID  69

Query  222  LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  401
            L ++ V   +       Y    A + N G+ +M+SW      + I    +   Q HWH P
Sbjct  70   LTNERVSLIHDQAWHRQYQPAPAVITNRGHDIMVSWKGDAGKITIRQTDFKLVQCHWHSP  129

Query  402  SEHVVNGTRYDLEAHLVHVSNDG  470
            SEH VNGTRYDLE H+VH S  G
Sbjct  130  SEHTVNGTRYDLELHMVHTSARG  152



>gb|EYU41598.1| hypothetical protein MIMGU_mgv1a011586mg [Erythranthe guttata]
Length=277

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 80/141 (57%), Gaps = 1/141 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  224
            +  +A L+L     I +QEV+DE  F Y E  ++GP  WG ++ EW  C+ G MQ+P+D+
Sbjct  13   ILIVACLVLLAAKSIHAQEVEDEREFDYAEKGEKGPRKWGHIKEEWAACNNGTMQSPVDM  72

Query  225  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  404
             +  V   +  P +  Y    AT+ N G+ + + W      + ING  +  R  HWH PS
Sbjct  73   SNARVRIIS-KPEKRIYRVSNATVRNRGHDIQIQWSGDAGSILINGTEFSLRYAHWHSPS  131

Query  405  EHVVNGTRYDLEAHLVHVSND  467
            EH +NG RYD+E H+VH++ D
Sbjct  132  EHTINGRRYDMELHMVHLNTD  152



>ref|XP_006489872.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=273

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 88/149 (59%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   LFSIAFLLLSVTHV-----IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            +F I   L+  +H+         EVDDE  FSY E + +GPS WG++ P W  C  GK+Q
Sbjct  8    IFIILASLILSSHLYNLVNADDSEVDDETPFSYKEETGKGPSEWGKISPHWRVCGIGKLQ  67

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            +PIDL ++ V V   LG ++  Y   +A ++N G+ + + W      + ING  Y   Q 
Sbjct  68   SPIDLLNQRVQVLPALGKLKRDYKPALAVVKNRGHDICVWWRGDAGKMHINGTIYKLLQC  127

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            HWH PSEH +NG+ Y++E HLVH+S+DG+
Sbjct  128  HWHTPSEHTINGSSYEMELHLVHLSSDGK  156



>ref|XP_004494904.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=274

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 82/145 (57%), Gaps = 4/145 (3%)
 Frame = +3

Query  30   MDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  209
            M+   L  I     ++  +I       E+G  Y E S +GP HWG+L+ EW  C  G+MQ
Sbjct  1    MEQYPLPYIKLCFCNINELIYIGARTAEYG--YKEKSAKGPKHWGDLKKEWAACK-GEMQ  57

Query  210  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            +PIDL S  V V  NLG +   Y    AT+ N G+ + +SW      + ING +Y  +  
Sbjct  58   SPIDLSSDRVSVIPNLGKLNRSYKPQHATISNRGHDIAVSWEADAGSIDINGTQYFLQTT  117

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVS  461
            HWH+PSEH +NG RYDLE H+VHVS
Sbjct  118  HWHWPSEHTINGRRYDLELHMVHVS  142



>ref|XP_007028632.1| Carbonic anhydrase, putative [Theobroma cacao]
 gb|EOY09134.1| Carbonic anhydrase, putative [Theobroma cacao]
Length=273

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 80/139 (58%), Gaps = 6/139 (4%)
 Frame = +3

Query  54   IAFLLLSVTHV----IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
             A L+LS T      I SQ  D+   F+YDE S RGPS WG L+PEW  CS G +Q+PID
Sbjct  13   FASLVLSCTSFRPTRIHSQS-DEGDEFNYDEGSGRGPSRWGSLKPEWQTCSTGNLQSPID  71

Query  222  LESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
            +    V+ S  LG +Q  Y    A L+N G+ + + W      + ING  Y   Q HWH 
Sbjct  72   IPVGSVLLSPALGDLQTSYASSPAVLKNRGHDIAVMWNGDAGKVDINGTDYKILQCHWHS  131

Query  399  PSEHVVNGTRYDLEAHLVH  455
            PSEH  +GTR+DLE H+VH
Sbjct  132  PSEHTFDGTRHDLEIHIVH  150



>dbj|BAD09854.1| putative dioscorin class A precursor [Oryza sativa Japonica Group]
 gb|EAZ07303.1| hypothetical protein OsI_29552 [Oryza sativa Indica Group]
 gb|EAZ43045.1| hypothetical protein OsJ_27633 [Oryza sativa Japonica Group]
Length=275

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = +3

Query  96   QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  272
            +E D E  F+Y    ++GP HWG+L+PEW QC AG+MQ+PIDL  + V +  +LG + + 
Sbjct  28   EETDHEEEFTYISGDEKGPEHWGKLKPEWAQCGAGEMQSPIDLSHERVKLVRDLGYLDDS  87

Query  273  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  452
            Y    A++ N G+ +M+ +      + ING  Y  RQ+HWH P+EH V+G RYD+E H+V
Sbjct  88   YRAAEASIVNRGHDIMVRFDGDAGSVVINGTAYYLRQLHWHSPTEHSVDGRRYDMELHMV  147

Query  453  HVSND  467
            H S +
Sbjct  148  HESAE  152



>gb|KFK28694.1| hypothetical protein AALP_AA7G034200 [Arabis alpina]
Length=269

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 87/149 (58%), Gaps = 6/149 (4%)
 Frame = +3

Query  39   LKLFSIAFLLLSV----THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM  206
            + +F+I F  LS      H     EVDDE  F+Y E++++GP  WG++ P W  C+ GK 
Sbjct  8    ISVFAIFFFFLSSFPNNLHA-HDLEVDDETPFTY-EHTEKGPEGWGKIDPHWRICNTGKF  65

Query  207  QTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  386
            Q+PIDL ++ V   N G     Y   +A+L+N G+ +M+SW      + I    +   Q 
Sbjct  66   QSPIDLTNQRVSLINYGAWSRQYQPALASLKNRGHDIMVSWKGDAGKITIRQKEFKLVQC  125

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            HWH PSEH VNGTRYD+E H+VH S+ G+
Sbjct  126  HWHSPSEHTVNGTRYDMELHMVHQSDRGK  154



>ref|XP_003537009.2| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=296

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 83/147 (56%), Gaps = 3/147 (2%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +L LF I  LL S +   + +E++DE  F Y   S++GP HWGE++ EW  C  G +Q+P
Sbjct  28   LLVLFMI--LLASTSTRAQVEELEDEREFDYIGASEKGPRHWGEMKKEWSSCKNGHLQSP  85

Query  216  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  392
            IDL    V +         YY    AT+ N G+ + + W      + +NG  Y  +Q HW
Sbjct  86   IDLSCARVKIIPRCRQPDIYYTATNATIINRGHDIAVYWKDDAGSVYLNGTEYFLKQCHW  145

Query  393  HFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            H PSEH +NG RYDLE H+VHVS D +
Sbjct  146  HSPSEHSMNGRRYDLEMHMVHVSPDNK  172



>ref|XP_004973661.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=285

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 1/127 (1%)
 Frame = +3

Query  96   QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  272
            QE +DE  FSYD   + GP+HWG ++ EW  CSAG MQ+PIDL  + V +   LG + + 
Sbjct  38   QETEDEHEFSYDPRDEHGPAHWGRIKAEWANCSAGGMQSPIDLAHERVTLVRALGYLDHS  97

Query  273  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  452
            Y    A++ N G+ +M+ +      + ING  Y  RQ+HWH P+EH V+G +YD+E HLV
Sbjct  98   YRPAQASIVNRGHDIMVRFKGDAGSVVINGTAYYLRQLHWHAPTEHTVDGRQYDMELHLV  157

Query  453  HVSNDGE  473
            H S +G+
Sbjct  158  HQSAEGK  164



>ref|XP_002880942.1| hypothetical protein ARALYDRAFT_320571 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57201.1| hypothetical protein ARALYDRAFT_320571 [Arabidopsis lyrata subsp. 
lyrata]
Length=248

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 81/125 (65%), Gaps = 2/125 (2%)
 Frame = +3

Query  102  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  278
            V+DE  FSY+ N + GP+ WG+LRPEW  C  G+MQ+PIDL +K V + ++L  +   Y 
Sbjct  5    VEDEHEFSYEWNQENGPAKWGKLRPEWKMCGKGEMQSPIDLMNKRVRLVTHLKKLTRDYK  64

Query  279  RDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
               ATL+N G+ MML +   G   + +NG +Y   Q+HWH PSEH +NG R+ LE H+VH
Sbjct  65   PCNATLKNRGHDMMLKFGEEGSGSIKVNGTKYKLLQLHWHSPSEHTINGRRFALELHMVH  124

Query  456  VSNDG  470
             + +G
Sbjct  125  ENING  129



>ref|NP_180388.2| alpha carbonic anhydrase 2 [Arabidopsis thaliana]
 gb|AEC08091.1| alpha carbonic anhydrase 2 [Arabidopsis thaliana]
Length=217

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 81/125 (65%), Gaps = 2/125 (2%)
 Frame = +3

Query  102  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  278
            V+DE  FSY+ N + GP+ WG+LRPEW  C  G+MQ+PIDL +K V + ++L  +  +Y 
Sbjct  5    VEDEHEFSYEWNQENGPAKWGKLRPEWKMCGKGEMQSPIDLMNKRVRLVTHLKKLTRHYK  64

Query  279  RDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
               ATL+N G+ MML +   G   + +NG  Y   Q+HWH PSEH +NG R+ LE H+VH
Sbjct  65   PCNATLKNRGHDMMLKFGEEGSGSITVNGTEYKLLQLHWHSPSEHTMNGRRFALELHMVH  124

Query  456  VSNDG  470
             + +G
Sbjct  125  ENING  129



>gb|AAD29832.1| putative carbonic anhydrase [Arabidopsis thaliana]
Length=248

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 81/125 (65%), Gaps = 2/125 (2%)
 Frame = +3

Query  102  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  278
            V+DE  FSY+ N + GP+ WG+LRPEW  C  G+MQ+PIDL +K V + ++L  +  +Y 
Sbjct  5    VEDEHEFSYEWNQENGPAKWGKLRPEWKMCGKGEMQSPIDLMNKRVRLVTHLKKLTRHYK  64

Query  279  RDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  455
               ATL+N G+ MML +   G   + +NG  Y   Q+HWH PSEH +NG R+ LE H+VH
Sbjct  65   PCNATLKNRGHDMMLKFGEEGSGSITVNGTEYKLLQLHWHSPSEHTMNGRRFALELHMVH  124

Query  456  VSNDG  470
             + +G
Sbjct  125  ENING  129



>gb|EMT14743.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=238

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVI----KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM  206
            L L   A LLL     +      QE+DDE  FSYD  S+ GP +WG+++ EW  C+ G++
Sbjct  7    LHLAVWALLLLHFAAFVPEARAQQEIDDESEFSYDSRSENGPENWGKIKEEWVTCATGRV  66

Query  207  QTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ  383
            Q+PIDL  +    + NLG + + Y    A++ N G+ + +++      L ING  Y  RQ
Sbjct  67   QSPIDLSDRHAAQAPNLGYLHHSYRPAEASIVNRGHDITVTFQRDTGSLWINGTAYHLRQ  126

Query  384  VHWHFPSEHVVNGTRYDLEAHLVHVSNDGE  473
            VHWH PSEH +NG +Y LE H+VH+S + +
Sbjct  127  VHWHSPSEHHLNGRQYSLELHMVHLSAENK  156



>emb|CDP15287.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 86/163 (53%), Gaps = 23/163 (14%)
 Frame = +3

Query  45   LFSIAFLLLSVTHVI--------KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  200
            L S+  LLL VT ++        K+QEV+DE  F Y E S +GP  WG+L+ EW  CS G
Sbjct  12   LGSVILLLLVVTSILLLFGATSTKAQEVEDEREFDYAEGSKKGPKRWGKLKKEWAACSNG  71

Query  201  KMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFR  380
              Q+PID+ ++ V   +  P +  Y    AT++N G+ + L W      + ING  Y  R
Sbjct  72   AFQSPIDMSNERVRLIS-KPERPIYKPTNATIKNRGHDISLQWGGDAGSIAINGTVYPLR  130

Query  381  QVHWHFPSEHVVNGT--------------RYDLEAHLVHVSND  467
            Q HWH PSEH + G               RYDLE H+VH+S D
Sbjct  131  QAHWHSPSEHTIRGRRHLSLFSGFLRSFFRYDLELHMVHLSTD  173



>ref|XP_008360674.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 78/128 (61%), Gaps = 1/128 (1%)
 Frame = +3

Query  93   SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  269
            S EV DE  F+Y E + +GP  WGE+ P W  C  GK+Q+PIDL  + V V+ +LG ++ 
Sbjct  33   SDEVGDETPFTYLEGTGKGPKKWGEIDPHWKVCDTGKLQSPIDLLDQRVQVFPHLGKLKR  92

Query  270  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  449
             Y    AT++N G+ + + W      + ING  Y   Q HWH PSEH  NG+RY LE H+
Sbjct  93   GYKPAPATVKNRGHDITMRWNGDAGKININGTDYRLLQCHWHSPSEHTFNGSRYALEFHV  152

Query  450  VHVSNDGE  473
            VH+S+ G+
Sbjct  153  VHLSSTGK  160



>emb|CDX94018.1| BnaC07g36520D [Brassica napus]
Length=268

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = +3

Query  27   DMDMLKLFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  200
            +   + +F++ FL LS   +      E DDE  F+Y++N ++GP  W ++ P W  C+ G
Sbjct  4    NTKTIMIFALFFLCLSFPSISLANDAEADDETPFTYEQNPEKGPEGWSKINPHWKVCNNG  63

Query  201  KMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFR  380
            K+Q+PIDL +  V   +    +  Y    A + N G+ +M+SW      L I  + +   
Sbjct  64   KLQSPIDLTNARVSLIHDEAWRREYKPAPAVIMNRGHDVMVSWKGDAGKLTIREMEFKLV  123

Query  381  QVHWHFPSEHVVNGTRYDLEAHLVHVSNDG  470
            Q HWH PSEH VNGTRYDLE H+VH S  G
Sbjct  124  QCHWHSPSEHTVNGTRYDLELHMVHTSARG  153



>gb|KJB16758.1| hypothetical protein B456_002G246100 [Gossypium raimondii]
Length=279

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 82/147 (56%), Gaps = 5/147 (3%)
 Frame = +3

Query  36   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  215
            +L +FS  F   S +  + +QEV+DE  FSY E S +GP+ WG ++ EW  C  GK Q+P
Sbjct  12   VLLIFSALFHSYSTS--VSAQEVEDEQEFSYSEESGKGPNQWGNIKKEWSDCKTGKNQSP  69

Query  216  IDLES-KPVVYSNLGPIQNYYMRDVATLENHGYGMMLS--WPLGQRYLGINGIRYLFRQV  386
            ID+ S K  V  N G +   Y      ++N G+ + L   W      + ING  Y  +Q 
Sbjct  70   IDIPSRKTKVIKNPGRLDMLYKPTEFIVKNRGHDISLKIHWLKSAGSIKINGTEYFLQQA  129

Query  387  HWHFPSEHVVNGTRYDLEAHLVHVSND  467
            HWH PSEH ++G RY LE HLVH + D
Sbjct  130  HWHSPSEHAIDGRRYALEVHLVHQAKD  156



>gb|KHN39017.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=296

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 82/145 (57%), Gaps = 2/145 (1%)
 Frame = +3

Query  45   LFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  221
            LF +  +LL+ T    + +E++DE  F Y   S++GP HWGE++ EW  C  G +Q+PID
Sbjct  28   LFVLFIILLASTSTRAQVEELEDEREFDYIGASEKGPRHWGEMKKEWSSCKNGHLQSPID  87

Query  222  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  398
            L    V +         YY    AT+ N G+ + + W      + +NG  Y  +Q HWH 
Sbjct  88   LSCARVKIIPRCRQPDIYYTATNATIINRGHDIAVYWKDDAGSVYLNGTEYFLKQCHWHS  147

Query  399  PSEHVVNGTRYDLEAHLVHVSNDGE  473
            PSEH +NG RYDLE H+VHVS D +
Sbjct  148  PSEHSMNGRRYDLEMHMVHVSPDNK  172



>gb|AAF79837.1|AC026875_17 T6D22.16 [Arabidopsis thaliana]
Length=263

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 81/131 (62%), Gaps = 1/131 (1%)
 Frame = +3

Query  39   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  218
            + LFSI  ++   +      EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+PI
Sbjct  13   VALFSIFTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSPI  72

Query  219  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  395
            DL ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING  Y  +Q+HWH
Sbjct  73   DLMNERVNIVSHLGRLNRDYNPSNATLKNRGHDIMLKFEDGAGTIKINGFEYELQQLHWH  132

Query  396  FPSEHVVNGTR  428
             PSEH +NG R
Sbjct  133  SPSEHTINGRR  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960