BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I12

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO02551.1|  (1-6)-alpha-D-xylosyltransferase ortholog              121   4e-31   Nicotiana alata [flowering tobacco]
ref|XP_009600562.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       123   9e-30   Nicotiana tomentosiformis
ref|XP_009780568.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    118   5e-28   Nicotiana sylvestris
ref|XP_006356974.1|  PREDICTED: putative glycosyltransferase 2-like     113   3e-26   Solanum tuberosum [potatoes]
ref|XP_004229187.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       108   2e-24   Solanum lycopersicum
gb|ACE95677.1|  putative xylosyl transferase                          97.8    1e-20   Coffea canephora [robusta coffee]
emb|CDO98874.1|  unnamed protein product                              97.8    1e-20   Coffea canephora [robusta coffee]
ref|XP_011090963.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  90.5    6e-18   Sesamum indicum [beniseed]
gb|EYU43946.1|  hypothetical protein MIMGU_mgv1a027073mg              86.3    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_011071657.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  84.3    9e-16   
ref|NP_001288054.1|  calmodulin binding transcription activator 1     78.2    1e-13   Malus domestica [apple tree]
ref|XP_010098280.1|  Xyloglucan 6-xylosyltransferase                  78.2    1e-13   Morus notabilis
gb|KDO71643.1|  hypothetical protein CISIN_1g047753mg                 77.8    2e-13   Citrus sinensis [apfelsine]
ref|XP_006489090.1|  PREDICTED: putative glycosyltransferase 2-like   75.9    8e-13   Citrus sinensis [apfelsine]
ref|XP_002315554.2|  glycosyltransferase 2 family protein             74.3    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_007050873.1|  Alpha-1,6-xylosyltransferase isoform 1           73.6    4e-12   
ref|XP_006419581.1|  hypothetical protein CICLE_v10004948mg           73.6    5e-12   Citrus clementina [clementine]
ref|XP_007050874.1|  Alpha-1,6-xylosyltransferase isoform 2           73.6    5e-12   
ref|XP_011000518.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  72.4    1e-11   Populus euphratica
ref|XP_009352257.1|  PREDICTED: putative glycosyltransferase 2        72.4    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_008367147.1|  PREDICTED: putative glycosyltransferase 2        72.0    1e-11   
ref|XP_008360279.1|  PREDICTED: putative glycosyltransferase 2        72.0    1e-11   
ref|XP_010037455.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  72.0    2e-11   Eucalyptus grandis [rose gum]
ref|XP_006396461.1|  hypothetical protein EUTSA_v10028641mg           71.6    2e-11   Eutrema salsugineum [saltwater cress]
gb|EYU45549.1|  hypothetical protein MIMGU_mgv1a027105mg              71.2    3e-11   Erythranthe guttata [common monkey flower]
gb|KJB84424.1|  hypothetical protein B456_N024600                     70.1    8e-11   Gossypium raimondii
ref|XP_006291070.1|  hypothetical protein CARUB_v10017185mg           69.3    1e-10   Capsella rubella
gb|KJB22531.1|  hypothetical protein B456_004G052700                  69.3    1e-10   Gossypium raimondii
ref|XP_007224307.1|  hypothetical protein PRUPE_ppa019851mg           68.9    2e-10   
ref|XP_010652172.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     68.9    2e-10   Vitis vinifera
ref|XP_010259619.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     68.9    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_011006778.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  68.2    3e-10   Populus euphratica
ref|XP_010269507.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     68.2    3e-10   Nelumbo nucifera [Indian lotus]
emb|CAN77730.1|  hypothetical protein VITISV_027412                   67.8    4e-10   Vitis vinifera
emb|CDY11441.1|  BnaA09g40070D                                        64.3    1e-09   Brassica napus [oilseed rape]
ref|XP_004296837.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  66.2    1e-09   Fragaria vesca subsp. vesca
ref|XP_002876686.1|  hypothetical protein ARALYDRAFT_907847           66.2    1e-09   Arabidopsis lyrata subsp. lyrata
emb|CDX97271.1|  BnaA02g20620D                                        64.7    1e-09   
ref|XP_006838788.1|  hypothetical protein AMTR_s00002p00259350        65.9    2e-09   
ref|XP_002516919.1|  Xyloglucan 6-xylosyltransferase, putative        65.5    2e-09   Ricinus communis
ref|NP_191831.1|  xyloglucan 6-xylosyltransferase                     65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KHG26935.1|  Putative glycosyltransferase 2 -like protein          65.1    3e-09   Gossypium arboreum [tree cotton]
ref|NP_001268156.1|  alpha-1,6-xylosyltransferase                     64.7    4e-09   Vitis vinifera
ref|XP_006389383.1|  glycosyltransferase 2 family protein             64.7    5e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009144556.1|  PREDICTED: putative glycosyltransferase 2        64.7    5e-09   Brassica rapa
ref|XP_010468926.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1     64.3    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010413252.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  63.9    7e-09   
ref|XP_010523942.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  63.9    8e-09   Tarenaya hassleriana [spider flower]
emb|CDY65940.1|  BnaUnng01300D                                        62.4    9e-09   Brassica napus [oilseed rape]
gb|KDP27794.1|  hypothetical protein JCGZ_18874                       63.5    1e-08   Jatropha curcas
emb|CDY70090.1|  BnaCnng66640D                                        62.4    2e-08   Brassica napus [oilseed rape]
ref|XP_009116931.1|  PREDICTED: xyloglucan 6-xylosyltransferase       62.8    2e-08   Brassica rapa
emb|CDY18017.1|  BnaC03g30890D                                        62.0    3e-08   Brassica napus [oilseed rape]
ref|XP_009134428.1|  PREDICTED: putative glycosyltransferase 2        62.4    3e-08   Brassica rapa
ref|XP_007201035.1|  hypothetical protein PRUPE_ppa005690mg           61.6    4e-08   
ref|XP_003609672.1|  Xyloglucan 6-xylosyltransferase                  61.6    4e-08   Medicago truncatula
emb|CDY50378.1|  BnaCnng19100D                                        61.2    6e-08   Brassica napus [oilseed rape]
gb|KFK30846.1|  hypothetical protein AALP_AA6G033100                  62.0    6e-08   Arabis alpina [alpine rockcress]
ref|XP_008235042.1|  PREDICTED: putative glycosyltransferase 2        61.2    6e-08   Prunus mume [ume]
ref|XP_004290777.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     60.8    7e-08   Fragaria vesca subsp. vesca
ref|XP_009342118.1|  PREDICTED: putative glycosyltransferase 2        60.8    7e-08   Pyrus x bretschneideri [bai li]
ref|XP_008368989.1|  PREDICTED: putative glycosyltransferase 2        60.5    1e-07   Malus domestica [apple tree]
ref|XP_009111280.1|  PREDICTED: putative glycosyltransferase 2        60.5    1e-07   Brassica rapa
emb|CDY22055.1|  BnaA09g00840D                                        60.5    1e-07   Brassica napus [oilseed rape]
ref|XP_004508217.1|  PREDICTED: putative glycosyltransferase 2-like   60.5    1e-07   Cicer arietinum [garbanzo]
ref|XP_008438884.1|  PREDICTED: putative glycosyltransferase 2        60.1    1e-07   Cucumis melo [Oriental melon]
ref|XP_010512668.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  60.1    1e-07   Camelina sativa [gold-of-pleasure]
gb|KJB41948.1|  hypothetical protein B456_007G128800                  60.1    2e-07   Gossypium raimondii
ref|XP_004134208.1|  PREDICTED: putative glycosyltransferase 2-like   59.7    2e-07   Cucumis sativus [cucumbers]
ref|XP_006402349.1|  hypothetical protein EUTSA_v10005949mg           59.7    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_008235045.1|  PREDICTED: putative glycosyltransferase 2        58.9    3e-07   Prunus mume [ume]
ref|XP_008386651.1|  PREDICTED: putative glycosyltransferase 2        58.5    4e-07   Malus domestica [apple tree]
gb|KEH24376.1|  xyloglucan xylosyltransferase                         58.2    6e-07   Medicago truncatula
ref|XP_010522780.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     58.2    6e-07   Tarenaya hassleriana [spider flower]
gb|KEH19400.1|  xyloglucan xylosyltransferase                         58.2    7e-07   Medicago truncatula
ref|XP_003554517.1|  PREDICTED: putative glycosyltransferase 2-like   57.8    7e-07   Glycine max [soybeans]
ref|XP_003628458.1|  Alpha-1 6-xylosyltransferase                     57.8    1e-06   
emb|CDX93965.1|  BnaC04g21240D                                        56.2    2e-06   
gb|KHN43518.1|  Xyloglucan 6-xylosyltransferase                       55.8    4e-06   Glycine soja [wild soybean]
ref|XP_007138911.1|  hypothetical protein PHAVU_009G248100g           55.1    6e-06   Phaseolus vulgaris [French bean]
ref|XP_002874911.1|  hypothetical protein ARALYDRAFT_490316           54.7    1e-05   
ref|NP_567241.1|  UDP-xylosyltransferase 2                            54.3    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAC78266.1|  putative glycosyltransferase                          54.3    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456020.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     54.3    1e-05   
emb|CDY70418.1|  BnaA04g27220D                                        54.3    1e-05   Brassica napus [oilseed rape]
ref|XP_009138722.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  53.9    1e-05   Brassica rapa
ref|XP_010938345.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  53.9    1e-05   Elaeis guineensis
ref|XP_006287708.1|  hypothetical protein CARUB_v10000915mg           53.9    1e-05   
gb|ABK24302.1|  unknown                                               53.1    3e-05   Picea sitchensis
emb|CDX90935.1|  BnaA03g26150D                                        53.1    3e-05   
ref|XP_010422579.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  52.8    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009414141.1|  PREDICTED: putative glycosyltransferase 2        52.8    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006444290.1|  hypothetical protein CICLE_v10020012mg           52.4    4e-05   Citrus clementina [clementine]
ref|XP_006479923.1|  PREDICTED: putative glycosyltransferase 2-li...  52.4    5e-05   
emb|CAI11450.1|  alpha-1,6-xylosyltransferase                         52.4    5e-05   Pinus taeda
ref|XP_006479922.1|  PREDICTED: putative glycosyltransferase 2-li...  52.4    5e-05   Citrus sinensis [apfelsine]
ref|XP_006479921.1|  PREDICTED: putative glycosyltransferase 2-li...  52.4    5e-05   Citrus sinensis [apfelsine]
ref|XP_010922270.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  52.0    7e-05   Elaeis guineensis
ref|XP_009416128.1|  PREDICTED: putative glycosyltransferase 2        51.6    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008790864.1|  PREDICTED: putative glycosyltransferase 2        51.6    1e-04   Phoenix dactylifera
ref|XP_008795804.1|  PREDICTED: putative glycosyltransferase 2        50.8    2e-04   Phoenix dactylifera
ref|XP_003533377.1|  PREDICTED: putative glycosyltransferase 2-li...  50.8    2e-04   Glycine max [soybeans]
ref|XP_010429788.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  50.4    2e-04   Camelina sativa [gold-of-pleasure]



>dbj|BAO02551.1| (1-6)-alpha-D-xylosyltransferase ortholog, partial [Nicotiana 
alata]
Length=155

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 7/107 (7%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDRFLSARRAWQVRRI+RNGKLT LCL LT+VV+RGNLGAG+FGTP +DLK+I DT S+
Sbjct  1    MLDRFLSARRAWQVRRIVRNGKLTFLCLFLTIVVLRGNLGAGKFGTPGQDLKEIRDTFSY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDL  540
             RKR EPRRVLEEA+QV+ T       T+ G G  S DS +Y  FDL
Sbjct  61   VRKRVEPRRVLEEAQQVDTT-------TEGGVGATSSDSNNYATFDL  100



>ref|XP_009600562.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nicotiana tomentosiformis]
Length=464

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 7/107 (7%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDRFLSARRAWQVRRI+RNGKLT LCL LT+VV+RGNLGAG+FGTP +DLK+I DT S+
Sbjct  1    MLDRFLSARRAWQVRRIVRNGKLTFLCLFLTIVVLRGNLGAGKFGTPGQDLKEIRDTFSY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDL  540
             RKR EPRRVLEEA+QV+        AT+ G G  S DS +Y  FDL
Sbjct  61   VRKRVEPRRVLEEAQQVD-------TATEGGGGATSSDSNNYATFDL  100



>ref|XP_009780568.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Nicotiana 
sylvestris]
Length=466

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 84/109 (77%), Gaps = 9/109 (8%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDRFLSARRAWQVRRI+RNGKLT LCL LT+VV+RGNLGAG+FGTP +DLK+I DT S+
Sbjct  1    MLDRFLSARRAWQVRRIVRNGKLTFLCLFLTIVVLRGNLGAGKFGTPGQDLKEIRDTFSY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSG--VGSEDSRSYKEFDL  540
             RKR EPRRVLEEA+QV+        AT+ G G    S DS +Y  FDL
Sbjct  61   VRKRVEPRRVLEEAQQVD-------TATEGGGGATATSSDSNNYATFDL  102



>ref|XP_006356974.1| PREDICTED: putative glycosyltransferase 2-like [Solanum tuberosum]
Length=464

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDRFLSARRAWQVRRI+RNGKLT LCL LTV+V+RGNLGAGRFGTP +DLK+I +T S+
Sbjct  1    MLDRFLSARRAWQVRRIMRNGKLTFLCLFLTVIVLRGNLGAGRFGTPGQDLKEIRETFSY  60

Query  400  YRKRTEPRRVLEEAEQVNLT  459
            YRKR EPRRVLEEA+QV+ T
Sbjct  61   YRKRVEPRRVLEEAQQVSST  80



>ref|XP_004229187.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Solanum lycopersicum]
Length=464

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDRFLSARRAWQVRRI+RNGKLT LCL LTV+V+RGNLGAGRFGTP +DLK+I +T S+
Sbjct  1    MLDRFLSARRAWQVRRIMRNGKLTFLCLFLTVIVLRGNLGAGRFGTPGQDLKEIRETFSY  60

Query  400  YRKRTEPRRVLEEA  441
            YRKR EPRRVLEEA
Sbjct  61   YRKRVEPRRVLEEA  74



>gb|ACE95677.1| putative xylosyl transferase [Coffea canephora]
Length=460

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 11/107 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R LS RRA Q++R+LRNGKLTLLCL LTV+V+R NLGAG+FGTPE+DL DI +T S+
Sbjct  1    MLERCLSPRRARQMQRLLRNGKLTLLCLFLTVIVLRANLGAGKFGTPEQDLNDIRETFSY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDL  540
             R+R EPRRVLEEA Q          ATD+G+     D+ SY +FD+
Sbjct  61   IRRRAEPRRVLEEARQT-------FTATDNGAS----DTNSYADFDI  96



>emb|CDO98874.1| unnamed protein product [Coffea canephora]
Length=460

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 11/107 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R LS RRA Q++R+LRNGKLTLLCL LTV+V+R NLGAG+FGTPE+DL DI +T S+
Sbjct  1    MLERCLSPRRARQMQRLLRNGKLTLLCLFLTVIVLRANLGAGKFGTPEQDLNDIRETFSY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDL  540
             R+R EPRRVLEEA Q          ATD+G+     D+ SY +FD+
Sbjct  61   IRRRAEPRRVLEEARQT-------FTATDNGAS----DTNSYADFDI  96



>ref|XP_011090963.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Sesamum indicum]
Length=459

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 78/109 (72%), Gaps = 13/109 (12%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDR  S RRA + +R+LRNGKLTLLCLVLTV+V+R NLGAG+FGTPEKDL +I +T S+
Sbjct  1    MLDRVFSPRRARRFQRLLRNGKLTLLCLVLTVIVLRANLGAGKFGTPEKDLDEIRETFSY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSED-SRSYKEFDLS  543
             R+R EPRRVLEEA+            T+  SG  +E  S SY EFD++
Sbjct  61   IRRRAEPRRVLEEAK------------TEQKSGSSTESGSNSYAEFDIT  97



>gb|EYU43946.1| hypothetical protein MIMGU_mgv1a027073mg [Erythranthe guttata]
Length=462

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 77/109 (71%), Gaps = 11/109 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R L  R A Q +RI+R GKLTLLCLVLTVVV+RGNLGAG+FGTPEKDL +I +T S+
Sbjct  1    MLERVLGPRYARQFQRIVRKGKLTLLCLVLTVVVLRGNLGAGKFGTPEKDLDEIRETFSY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSED-SRSYKEFDLS  543
             R+R EPRRVLEEA            A +  SG G+++   SY EFD++
Sbjct  61   IRRRAEPRRVLEEA----------TTAVEQKSGGGTDNGGNSYAEFDIT  99



>ref|XP_011071657.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like, partial [Sesamum 
indicum]
Length=454

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = +1

Query  238  SARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSFYRKRTE  417
              RR  Q +R+LRNGKLTLLCL LTV+++RGNLGAG+FGTPEKDL ++ +T S+ RKR E
Sbjct  1    PPRRPRQFQRLLRNGKLTLLCLFLTVIMLRGNLGAGKFGTPEKDLDELRETFSYIRKRVE  60

Query  418  PRRVLEEAEQVNLTVGDDVNATDS-GSGVGSEDSRSYKEFDLS  543
            PRRVLEEA  V         ATDS GSG     + +Y EFD++
Sbjct  61   PRRVLEEATVV---AQGQQKATDSTGSG-----TNNYAEFDIT  95



>ref|NP_001288054.1| calmodulin binding transcription activator 1 [Malus domestica]
 ref|XP_008340813.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
 ref|XP_008353228.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
 ref|XP_008361964.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
 gb|ADL36660.1| CAMTA domain class transcription factor [Malus domestica]
Length=461

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 10/108 (9%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDRFL  RRA Q++R LR+G +T LCL LTVVV+RG +GAG+FGTPE+D  DI +    
Sbjct  1    MLDRFLGPRRARQIQRALRHGTVTFLCLFLTVVVLRGTIGAGKFGTPEQDFNDIRERFYT  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            + +R EP RVLEEA         + N  D+     +  S +Y EFD+S
Sbjct  61   HNRRVEPHRVLEEATP-------ETNQKDADP---AGQSNNYAEFDIS  98



>ref|XP_010098280.1| Xyloglucan 6-xylosyltransferase [Morus notabilis]
 gb|EXB74784.1| Xyloglucan 6-xylosyltransferase [Morus notabilis]
Length=463

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R L  RR  Q++R +R+G +T LCL LTVVV+RG +GAG+FGTPE D  +I D LS+
Sbjct  1    MLERCLGVRRVRQIQRAVRHGTVTFLCLFLTVVVLRGTIGAGKFGTPELDFNEIRDHLSY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSE-DSRSYKEFDLS  543
             R+R EP RVLEEA   N          D+G+   S  D  +Y  FD+S
Sbjct  61   TRRRGEPHRVLEEASAQN----------DAGTAAASNADPNNYATFDIS  99



>gb|KDO71643.1| hypothetical protein CISIN_1g047753mg [Citrus sinensis]
Length=441

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 72/108 (67%), Gaps = 14/108 (13%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R +   RA Q++R++R+GK+TLLCL +TV+V+RG +GAG+FGTPE+D+ DI      
Sbjct  1    MLERCVGTLRARQIQRVIRHGKITLLCLFMTVIVLRGTIGAGKFGTPEQDIDDIRQHFYA  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            +RKR EP RVLEE           V  TD+     +ED  +Y++FD++
Sbjct  61   HRKRVEPHRVLEE-----------VQTTDAAK---TEDPNNYEKFDMN  94



>ref|XP_006489090.1| PREDICTED: putative glycosyltransferase 2-like [Citrus sinensis]
Length=454

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 71/108 (66%), Gaps = 14/108 (13%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R +   RA Q++R +R+GK+TLLCL +TV+V+RG +GAG+FGTPE+D+ DI      
Sbjct  1    MLERCVGTLRARQIQRAIRHGKITLLCLFMTVIVLRGTIGAGKFGTPEQDIDDIRQHFYA  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            +RKR EP RVLEE           V  TD+     +ED  +Y++FD++
Sbjct  61   HRKRVEPHRVLEE-----------VQTTDAAK---TEDPNNYEKFDMN  94



>ref|XP_002315554.2| glycosyltransferase 2 family protein [Populus trichocarpa]
 gb|EEF01725.2| glycosyltransferase 2 family protein [Populus trichocarpa]
Length=460

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 0/98 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDR +   R  Q++R +R+GK+TLLCL +TVVV+RG +GAG+FGTPE+D  D+ +    
Sbjct  1    MLDRCIGTHRVRQIQRAIRHGKITLLCLCMTVVVLRGTIGAGKFGTPEQDFNDLKNHFYA  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSED  513
             RK  EP RVL E+ Q N    D+ +  D G+   + D
Sbjct  61   ARKHGEPHRVLTESNQPNNNKNDEASNADGGNNYATFD  98



>ref|XP_007050873.1| Alpha-1,6-xylosyltransferase isoform 1 [Theobroma cacao]
 gb|EOX95030.1| Alpha-1,6-xylosyltransferase isoform 1 [Theobroma cacao]
Length=455

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 77/109 (71%), Gaps = 11/109 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+D+ L A+R+ +++R LR+ K+T++CLVLT+VV+RG +GAG+FGTPE+D  +I D   F
Sbjct  1    MIDKCLGAQRSRKIQRALRHCKVTIICLVLTLVVLRGTIGAGKFGTPEQDFIEIRD--HF  58

Query  400  Y-RKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            Y RKR EP RVLEE   V  T  ++  ATD+ +G     + +Y EFD++
Sbjct  59   YSRKRAEPHRVLEE---VQTTSSNNHAATDTDAG-----TNNYNEFDIN  99



>ref|XP_006419581.1| hypothetical protein CICLE_v10004948mg [Citrus clementina]
 gb|ESR32821.1| hypothetical protein CICLE_v10004948mg [Citrus clementina]
Length=454

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 70/108 (65%), Gaps = 14/108 (13%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R +   RA Q++R +R+GK+TLLCL +TV+V+RG +GAG+FGTPE+D+ DI      
Sbjct  1    MLERCVGTLRARQIQRAIRHGKITLLCLFMTVIVLRGTIGAGKFGTPEQDIDDIRQHFYA  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            +RKR EP RVLEE           V  TD+     + D  +Y++FD++
Sbjct  61   HRKRVEPHRVLEE-----------VQTTDAAK---TADPNNYEKFDMN  94



>ref|XP_007050874.1| Alpha-1,6-xylosyltransferase isoform 2 [Theobroma cacao]
 gb|EOX95031.1| Alpha-1,6-xylosyltransferase isoform 2 [Theobroma cacao]
Length=469

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 77/109 (71%), Gaps = 11/109 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+D+ L A+R+ +++R LR+ K+T++CLVLT+VV+RG +GAG+FGTPE+D  +I D   F
Sbjct  1    MIDKCLGAQRSRKIQRALRHCKVTIICLVLTLVVLRGTIGAGKFGTPEQDFIEIRD--HF  58

Query  400  Y-RKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            Y RKR EP RVLEE   V  T  ++  ATD+ +G     + +Y EFD++
Sbjct  59   YSRKRAEPHRVLEE---VQTTSSNNHAATDTDAG-----TNNYNEFDIN  99



>ref|XP_011000518.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Populus euphratica]
 ref|XP_011015482.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Populus euphratica]
Length=460

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 8/108 (7%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDR +   R  Q++R +R+GK+TLLCL +TVVV+RG +GAG+FGTPE+D  D+ +    
Sbjct  1    MLDRCIGTHRVRQIQRAIRHGKITLLCLCMTVVVLRGTIGAGKFGTPEQDFNDLKNHFYA  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RK  EP RVL E+ Q N    D+ +  D  +        +Y  FD+S
Sbjct  61   ARKHGEPHRVLTESNQPNNNKNDEASNADGAN--------NYATFDIS  100



>ref|XP_009352257.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
Length=463

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 10/108 (9%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDR L  RRA Q++R LR G +T LCL LTVVV+RG +GAG+FGTPE+D  DI +    
Sbjct  1    MLDRCLGPRRARQIQRALRQGTVTFLCLFLTVVVLRGTVGAGKFGTPEQDFNDIRERFYT  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            + +R EP RVL+EA         + N  D+     +  S +Y EFD+S
Sbjct  61   HNRRVEPHRVLKEATP-------ETNQNDADQ---AGQSNNYAEFDIS  98



>ref|XP_008367147.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=460

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 10/108 (9%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDR L  RRA Q++R LR G +T LCL LTVVV+RG +GAG+FGTPE+D  DI +    
Sbjct  1    MLDRCLWPRRARQIQRALRQGMVTFLCLFLTVVVLRGTVGAGKFGTPEQDFNDIRERFYT  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            + +R EP RVL+EA         + N  D+     +  S +Y EFD+S
Sbjct  61   HNRRVEPHRVLKEATP-------ETNQNDADQ---AGQSNNYAEFDIS  98



>ref|XP_008360279.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=460

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 10/108 (9%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDR L  RRA Q++R LR G +T LCL LTVVV+RG +GAG+FGTPE+D  DI +    
Sbjct  1    MLDRCLWPRRARQIQRALRQGMVTFLCLFLTVVVLRGTVGAGKFGTPEQDFNDIRERFYT  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            + +R EP RVL+EA         + N  D+     +  S +Y EFD+S
Sbjct  61   HNRRVEPHRVLKEATP-------ETNQNDADQ---AGQSNNYAEFDIS  98



>ref|XP_010037455.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW84484.1| hypothetical protein EUGRSUZ_B01313 [Eucalyptus grandis]
Length=461

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLD ++ ARR +Q+RR +R+GK+T LCLV+TVVV+RG +GAG+FGTPE+D  D+ D    
Sbjct  1    MLDNWVGARRGYQIRRAMRHGKVTALCLVMTVVVLRGTIGAGKFGTPEQDFNDLRDHF-I  59

Query  400  YRKRTEPRRVLEEA  441
             RKR EP RVLEE 
Sbjct  60   SRKRGEPHRVLEEV  73



>ref|XP_006396461.1| hypothetical protein EUTSA_v10028641mg [Eutrema salsugineum]
 gb|ESQ37914.1| hypothetical protein EUTSA_v10028641mg [Eutrema salsugineum]
Length=464

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+DL +I      
Sbjct  1    MIERCLGAYRCRKIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFHT  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVLEE +    T GD  +  D+G G  S  S +Y+ FD++
Sbjct  61   SRKRAEPHRVLEEIQ----TGGDSSSTGDTG-GANSGGSNNYETFDIN  103



>gb|EYU45549.1| hypothetical protein MIMGU_mgv1a027105mg [Erythranthe guttata]
Length=460

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 67/111 (60%), Gaps = 14/111 (13%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML R LS RR+ Q  R+  NGK+TLLCL LTVV +R +LGAG+ GTPEKDL +I DT S+
Sbjct  1    MLGRLLSPRRSRQFHRLASNGKITLLCLFLTVVTLREDLGAGKSGTPEKDLDEIRDTSSY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSG---SGVGSEDSRSYKEFDLS  543
             R+R EPRRVLE           DV  T  G          S SY +FD++
Sbjct  61   IRRRAEPRRVLE-----------DVPVTTQGRRSKDTYVSGSNSYADFDIT  100



>gb|KJB84424.1| hypothetical protein B456_N024600 [Gossypium raimondii]
Length=459

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 75/108 (69%), Gaps = 9/108 (8%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+D  L A+R+ +++R LR+ K+T+LCLVLTVVV+RG LGAG+FGTP +D  +I D L +
Sbjct  1    MIDNCLGAQRSRKIQRTLRHCKVTILCLVLTVVVLRGTLGAGKFGTPGQDFVEIRDHL-Y  59

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            YRK+ EP RVL+E   V  T  D+ +  D+ +G     + +Y EFD++
Sbjct  60   YRKQGEPHRVLKE---VQTTSSDNHDGADTNAG-----TNNYNEFDIN  99



>ref|XP_006291070.1| hypothetical protein CARUB_v10017185mg [Capsella rubella]
 gb|EOA23968.1| hypothetical protein CARUB_v10017185mg [Capsella rubella]
Length=465

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 72/108 (67%), Gaps = 11/108 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML++ L A R  +++RI+R GK+T+LCLVLTV+V+RG +GAG+FGTPEKD+++I +   +
Sbjct  1    MLEKCLGAYRFRRLQRIMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEKDIEEIREHFFY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVL E           V++  S S  G  +  SY+ FD++
Sbjct  61   TRKRGEPHRVLVE-----------VSSKTSSSKDGDGNGNSYETFDVN  97



>gb|KJB22531.1| hypothetical protein B456_004G052700 [Gossypium raimondii]
Length=459

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 75/108 (69%), Gaps = 9/108 (8%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+D  L A+R+ +++R LR+ K+T+LCLVLT+VV+RG +GAG+FGTP +DL +I D L +
Sbjct  1    MIDNCLGAQRSRKIQRALRHCKVTILCLVLTLVVLRGTIGAGKFGTPGQDLAEIRDHL-Y  59

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVLEE +  +L   D  +  D+ +G     + +Y EFD++
Sbjct  60   SRKRGEPHRVLEEVQTTSL---DKHDGADTNAG-----TNNYNEFDIN  99



>ref|XP_007224307.1| hypothetical protein PRUPE_ppa019851mg [Prunus persica]
 gb|EMJ25506.1| hypothetical protein PRUPE_ppa019851mg [Prunus persica]
Length=442

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%), Gaps = 11/108 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R L  RRA QV+R+LR+G  T LCL LTVVV+RG +GAG+FGTPE+D  +I +    
Sbjct  1    MLERCLGPRRARQVQRMLRHGTTTFLCLFLTVVVLRGTIGAGKFGTPEQDYNEIREHFYS  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
              +R EP RVL+EA     T   D    D         S +Y  FD+S
Sbjct  61   NNRRVEPHRVLQEA-----TTQPDQKEADPAQ------SNNYATFDIS  97



>ref|XP_010652172.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Vitis vinifera]
 emb|CAN59912.1| hypothetical protein VITISV_017033 [Vitis vinifera]
Length=452

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L ARRA Q+ R LR+ K+T+LCLV+T+VV+RG +GAG+FGTPE+D  +I D  S 
Sbjct  1    MIERCLGARRARQIHRALRHFKVTILCLVMTIVVLRGTIGAGKFGTPEQDFVEIRDHFS-  59

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  60   PRKRAEPHRVLEEVQ  74



>ref|XP_010259619.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nelumbo nucifera]
Length=449

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R L AR   Q+ R LR+GK+ LLCL +T++V+R  +GA + GTPE+D  +I D L F
Sbjct  1    MLERCLEARPVRQIHRALRHGKVALLCLFVTIIVLRSTIGAEKSGTPEQDFDEIRDHLHF  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSED  513
             R+R EPRRVLEEA+  + T  ++ N  D    +  E+
Sbjct  61   -RRRAEPRRVLEEAQTTDATNINNYNTFDPSKLMVDEE  97



>ref|XP_011006778.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Populus euphratica]
Length=459

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDR L   R  Q++R  R+GK+TLLCL +TVVV+RG +GAG+FGTPE+D  D+ + +  
Sbjct  1    MLDRCLGTHRVRQIQRATRHGKITLLCLFMTVVVLRGTIGAGKFGTPEQDFNDLRNHIYA  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDD  471
             RK  EP RVL E+ Q N    D+
Sbjct  61   SRKHAEPHRVLTESNQSNNNKNDE  84



>ref|XP_010269507.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nelumbo nucifera]
Length=455

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            +L+R L  RR  Q++R +R+ K+TLLCL LTV+V+RG +GAG+FGTPE+D  +I D   +
Sbjct  3    LLERCLGVRRVRQIQRGIRHAKVTLLCLFLTVIVLRGTIGAGKFGTPEQDFNEIRDHF-Y  61

Query  400  YRKRTEPRRVLEEAE  444
            +RKR EP RVLEEA+
Sbjct  62   FRKRAEPHRVLEEAQ  76



>emb|CAN77730.1| hypothetical protein VITISV_027412 [Vitis vinifera]
Length=450

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 65/108 (60%), Gaps = 17/108 (16%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLD    ARR  Q++R  R+GK+TL+CL++TVVV+RG +GAG+FGTPE+D  +I +    
Sbjct  1    MLDWCFGARRVRQMQRAFRHGKITLMCLLMTVVVLRGTIGAGKFGTPEQDFNEIREHFH-  59

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVLEEAE                    S +S +Y  FD+S
Sbjct  60   NRKRVEPHRVLEEAE----------------VSTESSESNNYATFDIS  91



>emb|CDY11441.1| BnaA09g40070D [Brassica napus]
Length=189

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+++ L   R  +++R+ R GK+TLLCLVLTV+V+RG +GAG+FGTPE+D+++I +   +
Sbjct  1    MIEKCLGTHRCRKLQRVWRQGKVTLLCLVLTVIVLRGTIGAGKFGTPEQDIEEIREHFFY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVL E         +  ++T+ G+G       +Y+ FD +
Sbjct  61   SRKRAEPHRVLVEIS------SETTSSTEDGNG------NNYETFDFN  96



>ref|XP_004296837.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Fragaria vesca 
subsp. vesca]
Length=452

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 60/108 (56%), Gaps = 17/108 (16%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R    RR  Q++R  R+G +T LCL +TVVV+RG +GAG+FGTPE+D  DI +    
Sbjct  1    MLERCFGVRRVRQIQRAARHGTVTFLCLFMTVVVLRGTIGAGKFGTPEQDFNDIRERFYS  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            + +R EP RVLEE E                    S D+ +Y  FD S
Sbjct  61   HNRRVEPHRVLEEVETTT-----------------SADANNYATFDFS  91



>ref|XP_002876686.1| hypothetical protein ARALYDRAFT_907847 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52945.1| hypothetical protein ARALYDRAFT_907847 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 71/108 (66%), Gaps = 11/108 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+++ + A R  +++R +R GK+T+LCLVLTV+V+RG +GAG+FGTPEKD+++I +   +
Sbjct  1    MIEKCIGAHRFRRLQRFMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEKDIEEIREHFFY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVL E           V++  + S  G  +  SY+ FD++
Sbjct  61   TRKRGEPHRVLVE-----------VSSKTTSSEDGDANGNSYETFDIN  97



>emb|CDX97271.1| BnaA02g20620D [Brassica napus]
Length=269

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR+ K+T+LCLVLT+VV+RG +GAG+FGTPE+DL +I   +  
Sbjct  1    MMERCLGANRCRRIQRALRHLKVTVLCLVLTIVVLRGTIGAGKFGTPEQDLDEIRQHIYT  60

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  61   SRKRAEPHRVLEEIQ  75



>ref|XP_006838788.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
 gb|ERN01357.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
Length=439

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+  + ARR  Q++R LR+GK+TLLCL +TV+V+RG +GAG+FGTPE+D  +I   LSF
Sbjct  1    MLECCIGARRMRQIQRALRHGKVTLLCLFITVLVLRGTIGAGKFGTPEQDFNEIRSHLSF  60

Query  400  YRKRTEPRRVLEEAE  444
              KR++P RVL EA+
Sbjct  61   -SKRSQPHRVLVEAK  74



>ref|XP_002516919.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
 gb|EEF45533.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Length=461

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 66/108 (61%), Gaps = 7/108 (6%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R L   R  +++R +R+GK+TL CL +TV+V+RG +GAG+FGTPE+D  D+ +    
Sbjct  1    MLERCLGTHRVVRIQRAIRHGKVTLFCLFMTVIVLRGTIGAGKFGTPEQDFNDLRERFYA  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RK  EP RVL EA+           +T + +   + D ++Y  FD++
Sbjct  61   SRKHAEPHRVLVEAQL-------STESTQNNNNNDNTDPKNYATFDIN  101



>ref|NP_191831.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 ref|NP_001030917.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 sp|Q9LZJ3.1|XXT1_ARATH RecName: Full=Xyloglucan 6-xylosyltransferase 1; Short=AtXT1 
[Arabidopsis thaliana]
 gb|AAL11581.1|AF424587_1 AT3g62720/F26K9_150 [Arabidopsis thaliana]
 emb|CAB83122.1| alpha galactosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN73295.1| At3g62720/F26K9_150 [Arabidopsis thaliana]
 dbj|BAH20193.1| AT3G62720 [Arabidopsis thaliana]
 gb|AEE80383.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AEE80384.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AHL38717.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=460

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 70/108 (65%), Gaps = 11/108 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+++ + A R  +++R +R GK+T+LCLVLTV+V+RG +GAG+FGTPEKD+++I +   +
Sbjct  1    MIEKCIGAHRFRRLQRFMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEKDIEEIREHFFY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVL E           V++  + S  G     SY+ FD++
Sbjct  61   TRKRGEPHRVLVE-----------VSSKTTSSEDGGNGGNSYETFDIN  97



>gb|KHG26935.1| Putative glycosyltransferase 2 -like protein [Gossypium arboreum]
Length=459

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 74/108 (69%), Gaps = 9/108 (8%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+D  L A+R+ +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTP +D  +I D L +
Sbjct  1    MIDNCLGAQRSRKIQRTLRHCKVTILCLVLTVVVLRGTIGAGKFGTPGQDFVEIRDHL-Y  59

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RK+ EP RVL+E   V  T  D+ +  D+ +G     + +Y EFD++
Sbjct  60   SRKQGEPHRVLKE---VQTTSSDNHDGADTNAG-----TNNYNEFDIN  99



>ref|NP_001268156.1| alpha-1,6-xylosyltransferase [Vitis vinifera]
 emb|CAI11449.1| alpha-1,6-xylosyltransferase [Vitis vinifera]
Length=450

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 17/108 (16%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLD    ARR  Q++R  R+GK+TL+CL++TVVV+RG +GAG+FGTP +D  +I +    
Sbjct  1    MLDWCFGARRVRQMQRAFRHGKITLMCLLMTVVVLRGTIGAGKFGTPGQDFNEIREHFH-  59

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVLEEAE                    S +S +Y  FD+S
Sbjct  60   NRKRVEPHRVLEEAE----------------VSTESSESNNYATFDIS  91



>ref|XP_006389383.1| glycosyltransferase 2 family protein [Populus trichocarpa]
 gb|ERP48297.1| glycosyltransferase 2 family protein [Populus trichocarpa]
Length=459

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            MLDR L   R  Q++R  R+GK+TLLCL +TVVV+RG +GAG+ GTPE+D  D+ + +  
Sbjct  1    MLDRCLGTHRVRQIQRATRHGKITLLCLFMTVVVLRGTIGAGKSGTPEQDFNDLRNHIYA  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDD  471
             RK  EP RVL E+ Q N    D+
Sbjct  61   SRKHAEPHRVLTESNQSNNNKNDE  84



>ref|XP_009144556.1| PREDICTED: putative glycosyltransferase 2 [Brassica rapa]
Length=462

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR+ K+T+LCLVLT+VV+RG +GAG+FGTPE+DL +I   +  
Sbjct  1    MMERCLGANRCRRIQRALRHLKVTVLCLVLTIVVLRGTIGAGKFGTPEQDLDEIRQHIYT  60

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  61   SRKRAEPHRVLEEIQ  75



>ref|XP_010468926.1| PREDICTED: xyloglucan 6-xylosyltransferase 1 [Camelina sativa]
Length=466

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 72/109 (66%), Gaps = 7/109 (6%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLS  396
            +M+++ L A R  +++RI+R GK+T+LCLVLTV+V+RG +GAG+FGTPE+D+++I +   
Sbjct  1    MMIEKCLGAYRFRRLQRIMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEQDIEEIREHFF  60

Query  397  FYRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            + RKR EP RVL E       V     ++ S  G     + SY+ FD++
Sbjct  61   YTRKRGEPHRVLVE-------VSSKTTSSSSEDGNNGNKNNSYETFDIN  102



>ref|XP_010413252.1| PREDICTED: xyloglucan 6-xylosyltransferase 1-like [Camelina sativa]
Length=464

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLS  396
            +M+++ L A R  +++RI+R GK+T+LCLVLTV+V+RG +GAG+FGTPE+D+++I +   
Sbjct  1    MMIEKCLGAYRFRRLQRIMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEQDIEEIREHFF  60

Query  397  FYRKRTEPRRVLEEA  441
            + RKR EP RVL E 
Sbjct  61   YTRKRGEPHRVLVEV  75



>ref|XP_010523942.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Tarenaya hassleriana]
Length=455

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 70/108 (65%), Gaps = 11/108 (10%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A+R  ++ R LR+GK+T+LCLVLTVVV+RG +GAG+FGTPE+DL +I +    
Sbjct  1    MIERCLGAQRCRRIHRALRHGKVTILCLVLTVVVLRGTIGAGKFGTPEQDLVEIREHFFH  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVL E       V     ++  G+G G+    +Y+  D++
Sbjct  61   PRKRAEPHRVLVE-------VSTQTTSSSDGNGNGN----NYETLDIN  97



>emb|CDY65940.1| BnaUnng01300D [Brassica napus]
Length=266

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR+ K+T++CLVLTVVV+R  +GAG+FGTPE+DL +I   +  
Sbjct  1    MMERCLGANRCRRIQRALRHLKVTVMCLVLTVVVLRCTIGAGKFGTPEQDLDEIRQHIYT  60

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  61   SRKRAEPHRVLEEIQ  75



>gb|KDP27794.1| hypothetical protein JCGZ_18874 [Jatropha curcas]
Length=463

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R L   R  +++R +R+ K+TL CL +TVVV+RG +GAG+FGTPE+D  D+ D    
Sbjct  1    MLERCLGTHRVLRIQRAIRHAKVTLFCLFMTVVVLRGTIGAGKFGTPEQDFNDLRDRFYA  60

Query  400  YRKRTEPRRVLEEAE  444
             RK  EP RVL EA+
Sbjct  61   SRKHAEPHRVLVEAQ  75



>emb|CDY70090.1| BnaCnng66640D, partial [Brassica napus]
Length=354

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR+ K+T++CLVLTVVV+R  +GAG+FGTPE+DL +I   +  
Sbjct  1    MMERCLGANRCRRIQRALRHLKVTVMCLVLTVVVLRCTIGAGKFGTPEQDLDEIRQHIYT  60

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  61   SRKRVEPHRVLEEIQ  75



>ref|XP_009116931.1| PREDICTED: xyloglucan 6-xylosyltransferase [Brassica rapa]
Length=456

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+++ L   R  +++R+ R GK+TLLCLVLTVVV+RG +GAG+FGTPE+D+++I +   +
Sbjct  1    MIEKCLGTHRCRKLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVL E             ++++ S  G  +  +Y+ FD +
Sbjct  61   SRKRAEPHRVLVEI------------SSETTSSTGDGNGNNYETFDFN  96



>emb|CDY18017.1| BnaC03g30890D [Brassica napus]
Length=335

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+DL +I      
Sbjct  1    MIERCLGAYRCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFQT  60

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  61   SRKRAEPHRVLEEIQ  75



>ref|XP_009134428.1| PREDICTED: putative glycosyltransferase 2 [Brassica rapa]
Length=463

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+DL +I      
Sbjct  1    MIERCLGAHRCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFQT  60

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  61   SRKRAEPHRVLEEIQ  75



>ref|XP_007201035.1| hypothetical protein PRUPE_ppa005690mg [Prunus persica]
 gb|EMJ02234.1| hypothetical protein PRUPE_ppa005690mg [Prunus persica]
Length=448

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M  + L A+R  ++ R LR+GK+T+LCLVLTVVV+RG +GAG+FGTPE+D  +I D   F
Sbjct  1    MFQKCLGAQRTRRIHRALRHGKVTILCLVLTVVVLRGTIGAGKFGTPEQDFIEIRD--HF  58

Query  400  Y-RKRTEPRRVLEEAE  444
            Y RKR EP RVLEE +
Sbjct  59   YSRKRAEPHRVLEEVQ  74



>ref|XP_003609672.1| Xyloglucan 6-xylosyltransferase [Medicago truncatula]
 gb|AES91869.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=454

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R L +RR  Q++R  R G LT LCL LTV+V+RG +GAG+FGTPE+DL +I   L  
Sbjct  1    MLERCLGSRRLRQMQRAFRRGTLTFLCLFLTVIVLRGTIGAGKFGTPEQDLNEIRQQLYS  60

Query  400  YRKRTEPRRVLEEAE  444
              +R EP RVLEE +
Sbjct  61   RGRRVEPHRVLEEVQ  75



>emb|CDY50378.1| BnaCnng19100D [Brassica napus]
Length=469

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L   R  +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+DL +I      
Sbjct  24   MIERCLGPHRCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIHQHFQP  83

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  84   SRKRAEPHRVLEEIQ  98



>gb|KFK30846.1| hypothetical protein AALP_AA6G033100 [Arabis alpina]
Length=1524

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  211   ETIMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDT  390
             E  M++R L A R  +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+D  +I   
Sbjct  1058  EKKMIERCLGAYRCRRIQRALRHLKVTILCLVLTVVVLRGTIGAGKFGTPEQDFDEIRQL  1117

Query  391   LSFYRKRTEPRRVLEEAE  444
             +   RKR EP RVLEE +
Sbjct  1118  VHTSRKRGEPHRVLEEIQ  1135



>ref|XP_008235042.1| PREDICTED: putative glycosyltransferase 2 [Prunus mume]
Length=449

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLS  396
            ++L++ L  +R  ++ R LR+GK+T+LCLVLTVVV+RG +GAG+FGTPE+D  +I D   
Sbjct  1    MILEKCLGPQRTRRIHRALRHGKVTILCLVLTVVVLRGTIGAGKFGTPEQDFIEIRD--H  58

Query  397  FY-RKRTEPRRVLEEAE  444
            FY RKR EP RVLEE +
Sbjct  59   FYSRKRAEPHRVLEEVQ  75



>ref|XP_004290777.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Fragaria vesca 
subsp. vesca]
Length=450

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 67/91 (74%), Gaps = 4/91 (4%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLS  396
            ++L++ + A+R+ +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+D  +I D   
Sbjct  1    MVLEKCIGAQRSRRIQRALRHSKVTILCLVLTVVVLRGTIGAGKFGTPEQDFLEIRD--H  58

Query  397  FY-RKRTEPRRVLEEAEQVNLTVGDDVNATD  486
            FY RKR EP RVLEE  Q   +  ++ NA D
Sbjct  59   FYSRKRAEPHRVLEEV-QTTPSDPNNYNAFD  88



>ref|XP_009342118.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
 ref|XP_009342138.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
Length=449

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 67/92 (73%), Gaps = 6/92 (7%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLS  396
            ++L++ L A+R+ +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+D  +I D   
Sbjct  1    MILEKCLGAQRSRRIQRALRHSKVTILCLVLTVVVLRGTIGAGKFGTPEQDFLEIRDHF-  59

Query  397  FYRKRTEPRRVLEEAEQVNLTVGD--DVNATD  486
            + RKR EP RVLEE   V+ T  D  + NA D
Sbjct  60   YSRKRAEPHRVLEE---VHATPSDPNNYNALD  88



>ref|XP_008368989.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=448

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLS  396
            ++L++ L A+R+ +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+D  +I D   
Sbjct  1    MILEKCLGAQRSRRIQRALRHSKVTILCLVLTVVVLRGTIGAGKFGTPEQDFLEIRDHF-  59

Query  397  FYRKRTEPRRVLEEAE  444
            + RKR EP RVLEE  
Sbjct  60   YSRKRAEPHRVLEEVH  75



>ref|XP_009111280.1| PREDICTED: putative glycosyltransferase 2 [Brassica rapa]
Length=462

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L   R  +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+DL +I      
Sbjct  1    MIERCLGPHRCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFQP  60

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  61   SRKRAEPHRVLEEIQ  75



>emb|CDY22055.1| BnaA09g00840D [Brassica napus]
Length=449

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L   R  +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+DL +I      
Sbjct  1    MIERCLGPHRCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFQP  60

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  61   SRKRAEPHRVLEEIQ  75



>ref|XP_004508217.1| PREDICTED: putative glycosyltransferase 2-like [Cicer arietinum]
Length=452

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R L +RR  Q++R  R G LT LCL LTV+V+RG +GAG+FGTPE+DL +I      
Sbjct  1    MLERCLGSRRLRQMQRACRRGSLTFLCLFLTVIVLRGTIGAGKFGTPEQDLNEIRQQFYS  60

Query  400  YRKRTEPRRVLEEAEQVN  453
              +R EP RVLEE +  +
Sbjct  61   RGRRVEPHRVLEEVQSTD  78



>ref|XP_008438884.1| PREDICTED: putative glycosyltransferase 2 [Cucumis melo]
Length=456

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 63/108 (58%), Gaps = 13/108 (12%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L   R  +++R  R+  +T+LCL LTVVV+RG +GAG+FGTPE+D  +I    S 
Sbjct  1    MIERILGPTRLRRIQRAFRHSAVTVLCLFLTVVVLRGTVGAGKFGTPEQDFNEIRHHFSS  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
              +R EPRRVLEEA+                +   +E S +Y  FD+S
Sbjct  61   RGRRVEPRRVLEEAQP-------------ETTNKPAEQSNNYATFDIS  95



>ref|XP_010512668.1| PREDICTED: xyloglucan 6-xylosyltransferase 1-like [Camelina sativa]
Length=466

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLS  396
            +M+++ L A R  +++RI+R  K+T+LCLVLTV+V+RG +GAG+FGTPE+D+++I +   
Sbjct  1    MMIEKCLGAYRFRRLQRIMRQSKVTILCLVLTVIVLRGTIGAGKFGTPEQDIEEIREHFF  60

Query  397  FYRKRTEPRRVLEEA  441
            + RK  EP RVL E 
Sbjct  61   YSRKHGEPHRVLVEV  75



>gb|KJB41948.1| hypothetical protein B456_007G128800 [Gossypium raimondii]
Length=459

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 69/108 (64%), Gaps = 9/108 (8%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+ + L A+R  ++ R LR  K+T+ C VLTVVV+RG +GAG+FGTPE+D  +I D   +
Sbjct  1    MIGKCLGAQRCRKIHRTLRRCKVTVFCFVLTVVVLRGTIGAGKFGTPEQDFVEIRDHF-Y  59

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
            +R+R    RVLEE   V  T  D+  A+D+ +     ++ +Y +F+L+
Sbjct  60   FRRRAGTHRVLEE---VQTTSSDNEVASDTNA-----ETNNYNDFELN  99



>ref|XP_004134208.1| PREDICTED: putative glycosyltransferase 2-like [Cucumis sativus]
 ref|XP_004164306.1| PREDICTED: putative glycosyltransferase 2-like [Cucumis sativus]
 gb|KGN57106.1| hypothetical protein Csa_3G154300 [Cucumis sativus]
Length=456

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 63/108 (58%), Gaps = 13/108 (12%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L   R  +++R  R+  +T+LCL LTVVV+RG +GAG+FGTPE+D  +I    S 
Sbjct  1    MIERILGPTRFRRIQRAFRHSAVTVLCLFLTVVVLRGTVGAGKFGTPEQDFNEIRSHFSS  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
              +R EPRRVLEEA+                +   +E S +Y  FD+S
Sbjct  61   RGRRVEPRRVLEEAQP-------------ETTNKPAEQSNNYATFDIS  95



>ref|XP_006402349.1| hypothetical protein EUTSA_v10005949mg [Eutrema salsugineum]
 gb|ESQ43802.1| hypothetical protein EUTSA_v10005949mg [Eutrema salsugineum]
Length=468

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 67/108 (62%), Gaps = 10/108 (9%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++  +   R  +++R+ R GK+TLLCLVLTVVV+RG +GAG+FGTPE+D+++I +   +
Sbjct  1    MIENCIGTHRFRRLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             RKR EP RVL E              T S S  G  +  +Y+ FD++
Sbjct  61   TRKRAEPHRVLVEVS----------TKTTSSSEDGDGNGNNYESFDIN  98



>ref|XP_008235045.1| PREDICTED: putative glycosyltransferase 2 [Prunus mume]
Length=448

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLS  396
            ++L++ L A+R  ++   LR+GK+T+LCLVLTVVV+RG +GAG+FGTPE+D  +I D   
Sbjct  1    MILEKCLGAQRTRRIHSALRHGKVTILCLVLTVVVLRGTVGAGKFGTPEQDFIEIRD--H  58

Query  397  FY-RKRTEPRRVLEEAE  444
            FY RKR EP RVL+E +
Sbjct  59   FYSRKRAEPHRVLQEVQ  75



>ref|XP_008386651.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=449

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 70/109 (64%), Gaps = 21/109 (19%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLS  396
            ++L++ L A+R+ +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+D  +I D   
Sbjct  1    MLLEKCLGAQRSRRIQRALRHSKVTILCLVLTVVVLRGTIGAGKFGTPEQDFLEIRD--H  58

Query  397  FY-RKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDL  540
            FY RKR E  RVLEE           V+AT S       D  +Y  FD+
Sbjct  59   FYSRKRAEAHRVLEE-----------VHATPS-------DPNNYNAFDI  89



>gb|KEH24376.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=466

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+++L A+RA + +R L + K+T+LCL LT+VV+RG +GAG+FGTPE+D  DI +  S 
Sbjct  1    MLEKYLGAQRARKFQRFLNHCKVTILCLFLTIVVLRGTIGAGKFGTPEQDFVDIRNRFS-  59

Query  400  YRKRTEPRRVLEEAE  444
             RK +EP R+L E  
Sbjct  60   SRKLSEPHRILGEIH  74



>ref|XP_010522780.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Tarenaya hassleriana]
 ref|XP_010522781.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Tarenaya hassleriana]
Length=463

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 3/76 (4%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+D+ +I +   F
Sbjct  1    MIERCLGAHRCRKIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDIAEIRE--HF  58

Query  400  Y-RKRTEPRRVLEEAE  444
            Y RKR EP RVL E +
Sbjct  59   YTRKRAEPHRVLVEVQ  74



>gb|KEH19400.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=538

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+++L A+RA + +R L + K+T+LCL LT+VV+RG +GAG+FGTPE+D  DI +  S 
Sbjct  1    MLEKYLGAQRARKFQRFLNHCKVTILCLFLTIVVLRGTIGAGKFGTPEQDFVDIRNRFS-  59

Query  400  YRKRTEPRRVLEEAE  444
             RK +EP R+L E  
Sbjct  60   SRKLSEPHRILGEIH  74



>ref|XP_003554517.1| PREDICTED: putative glycosyltransferase 2-like [Glycine max]
Length=455

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML++ L A+RA +  R LR+ K+T+LCLVLT+VV+RG +GAG+FGTPE+DL DI +   +
Sbjct  1    MLEKCLGAQRARRFHRALRHCKVTILCLVLTIVVLRGTIGAGKFGTPEQDLVDIRNRF-Y  59

Query  400  YRKRTEPRRVLEEAE  444
             RK  EP R+L E  
Sbjct  60   TRKLPEPHRLLAELH  74



>ref|XP_003628458.1| Alpha-1 6-xylosyltransferase [Medicago truncatula]
Length=763

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+++L A+RA + +R L + K+T+LCL LT+VV+RG +GAG+FGTPE+D  DI +  S 
Sbjct  1    MLEKYLGAQRARKFQRFLNHCKVTILCLFLTIVVLRGTIGAGKFGTPEQDFVDIRNRFS-  59

Query  400  YRKRTEPRRVLEEAE  444
             RK +EP R+L E  
Sbjct  60   SRKLSEPHRILGEIH  74



>emb|CDX93965.1| BnaC04g21240D [Brassica napus]
Length=458

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (64%), Gaps = 9/107 (8%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+++ +  +R  +++R+ R GK+TLLCLVLTVVV+RG +GAG+FGTPE+D+++I +   +
Sbjct  1    MIEKCIGTQRLRRLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFY  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDL  540
             RKR E  RVL E      T      +T  G+G  + +   Y+ FD 
Sbjct  61   SRKRAETHRVLVELSSSKTT------STKDGAGTSNNN---YETFDF  98



>gb|KHN43518.1| Xyloglucan 6-xylosyltransferase [Glycine soja]
Length=430

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML++ L A+RA +  R LR+ K+T+LCLVLT+VV+RG +GAG+FGTPE+DL DI +   F
Sbjct  1    MLEKCLGAQRARRFHRALRHCKVTILCLVLTIVVLRGTIGAGKFGTPEQDLVDIRN--RF  58

Query  400  YR-KRTEPRRVLEE  438
            Y  K  EP R+L E
Sbjct  59   YSLKLPEPHRLLAE  72



>ref|XP_007138911.1| hypothetical protein PHAVU_009G248100g [Phaseolus vulgaris]
 gb|ESW10905.1| hypothetical protein PHAVU_009G248100g [Phaseolus vulgaris]
Length=452

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 17/108 (16%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+R L  RR  Q++R  R+  +T LCL LTVVV+RG +GAG+FGTPE+D  +I   +S 
Sbjct  1    MLERCLGTRRVRQIQRACRHSTVTFLCLFLTVVVLRGTIGAGKFGTPEQDFDEIRYHISA  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSEDSRSYKEFDLS  543
             R     RRVLEE +             D+GS   S +  +Y  FDLS
Sbjct  61   ARA----RRVLEETK------------PDAGSNADS-NPNNYATFDLS  91



>ref|XP_002874911.1| hypothetical protein ARALYDRAFT_490316 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51170.1| hypothetical protein ARALYDRAFT_490316 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR  K+T+LCLVLTVVV+R  +GAG+FGTPE+DL +I      
Sbjct  1    MIERCLGAYRCRRIQRALRQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQHFH-  59

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  60   ARKRGEPHRVLEEIQ  74



>ref|NP_567241.1| UDP-xylosyltransferase 2 [Arabidopsis thaliana]
 sp|O22775.1|XXT2_ARATH RecName: Full=Xyloglucan 6-xylosyltransferase 2; Short=AtXT2; 
AltName: Full=Putative glycosyltransferase 2; Short=AtGT2 [Arabidopsis 
thaliana]
 gb|AAC19271.1| T14P8.23 [Arabidopsis thaliana]
 emb|CAC01674.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAL14393.1| AT4g02500/T10P11_20 [Arabidopsis thaliana]
 gb|AAM98170.1| putative glycosyltransferase [Arabidopsis thaliana]
 gb|AAP31945.1| At4g02500 [Arabidopsis thaliana]
 gb|AEE82181.1| UDP-xylosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38708.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=461

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR  K+T+LCL+LTVVV+R  +GAG+FGTPE+DL +I      
Sbjct  1    MIERCLGAYRCRRIQRALRQLKVTILCLLLTVVVLRSTIGAGKFGTPEQDLDEIRQHFH-  59

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  60   ARKRGEPHRVLEEIQ  74



>gb|AAC78266.1| putative glycosyltransferase [Arabidopsis thaliana]
 emb|CAB80743.1| putative glycosyltransferase [Arabidopsis thaliana]
Length=459

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR  K+T+LCL+LTVVV+R  +GAG+FGTPE+DL +I      
Sbjct  1    MIERCLGAYRCRRIQRALRQLKVTILCLLLTVVVLRSTIGAGKFGTPEQDLDEIRQHFH-  59

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  60   ARKRGEPHRVLEEIQ  74



>ref|XP_010456020.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Camelina sativa]
 ref|XP_010456021.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Camelina sativa]
Length=463

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 3/76 (4%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R  R  K+T+LCLVLTVVV+R  +GAG+FGTPE+DL +I     F
Sbjct  1    MIERCLGAYRCRRIQRAFRQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQ--HF  58

Query  400  Y-RKRTEPRRVLEEAE  444
            Y RKR EP RVLEE +
Sbjct  59   YTRKRGEPHRVLEEIQ  74



>emb|CDY70418.1| BnaA04g27220D [Brassica napus]
Length=460

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+++ +  +R  +++R+ R GK+TLLCLVLTVVV+RG +GAG+FGTPE+D+++I +   +
Sbjct  1    MIEKCIGTQRLRRLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFY  60

Query  400  YRKRTEPRRVLEE  438
             RKR E  RVL E
Sbjct  61   SRKRAETHRVLVE  73



>ref|XP_009138722.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Brassica rapa]
Length=459

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M+++ +  +R  +++R+ R GK+TLLCLVLTVVV+RG +GAG+FGTPE+D+++I +   +
Sbjct  1    MIEKCIGTQRLRRLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFY  60

Query  400  YRKRTEPRRVLEE  438
             RKR E  RVL E
Sbjct  61   SRKRAETHRVLVE  73



>ref|XP_010938345.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Elaeis guineensis]
Length=449

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML R L  RR  Q++R LR GKLTLLCL LTV+V+RG +GAG+FGTPE+D  +I   L  
Sbjct  1    MLGRCLGERRVRQIQRALRRGKLTLLCLFLTVIVLRGTIGAGKFGTPEQDFNEIRQRLRH  60

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSG  492
            +R       V  +A   + T      A D G
Sbjct  61   HRSLPHRALVENQAGHSSATTAGKTFAADEG  91



>ref|XP_006287708.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 ref|XP_006287709.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 gb|EOA20606.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 gb|EOA20607.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
Length=460

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M +R L A R  +++R LR  K+T+LCLVLTVVV+R  +GAG+FGTPE+DL +I      
Sbjct  1    MFERCLGAYRCRRIQRALRQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQHFH-  59

Query  400  YRKRTEPRRVLEEAE  444
             RKR EP RVLEE +
Sbjct  60   ARKRGEPHRVLEEIQ  74



>gb|ABK24302.1| unknown [Picea sitchensis]
 gb|ACN41079.1| unknown [Picea sitchensis]
Length=444

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +1

Query  235  LSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSFYRKRT  414
            L ARR  Q+++ ++N K+TLLCL +TV+V+RG +GAG+FGTPE+D  +I + L   R R 
Sbjct  9    LGARRVRQIQKAMQNAKVTLLCLFVTVLVLRGTIGAGKFGTPEQDFAEIREHLIVGR-RG  67

Query  415  EPRRVLEEAEQVN  453
            EP RVL E    N
Sbjct  68   EPHRVLTEVVAEN  80



>emb|CDX90935.1| BnaA03g26150D [Brassica napus]
Length=449

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R LR+ K+T+LCLVLTVVV+RG +GAG+FGTPE+DL +I      
Sbjct  1    MIERCLGAHRCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFQT  60

Query  400  YRKRTEPRR  426
             RKR EP  
Sbjct  61   SRKRAEPHH  69



>ref|XP_010422579.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Camelina sativa]
Length=463

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 3/76 (4%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A R  +++R     K+T+LCLVLTVVV+R  +GAG+FGTPE+DL +I     F
Sbjct  1    MIERCLGAYRCRRIQRAFHQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQ--HF  58

Query  400  Y-RKRTEPRRVLEEAE  444
            Y RKR EP RVLEE +
Sbjct  59   YTRKRGEPHRVLEEIQ  74



>ref|XP_009414141.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=441

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDI  381
            +L R L  RR  Q+ R LRNG+LTLLCLV+T+VV+RG +GAGRFGTPE+DL DI
Sbjct  3    VLGRCLGERRVRQLHRALRNGRLTLLCLVMTIVVLRGTIGAGRFGTPEQDLHDI  56



>ref|XP_006444290.1| hypothetical protein CICLE_v10020012mg [Citrus clementina]
 gb|ESR57530.1| hypothetical protein CICLE_v10020012mg [Citrus clementina]
Length=471

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A+R+ +  R LR  K+T LCLVLTVVV+RG +GAG FGTPEKD  +I + L F
Sbjct  1    MIERCLGAQRSRKFHRALRQCKVTALCLVLTVVVLRGIIGAGEFGTPEKDFYEIRNRLYF  60

Query  400  -YRKR-TEPRRVLEE  438
              RKR  +P RVLEE
Sbjct  61   PSRKRGGDPHRVLEE  75



>ref|XP_006479923.1| PREDICTED: putative glycosyltransferase 2-like isoform X3 [Citrus 
sinensis]
Length=460

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A+R+ +  R LR  K+T LCLVLTVVV+RG +GAG FGTPEKD  +I + L F
Sbjct  1    MIERCLGAQRSRKFHRALRQCKVTALCLVLTVVVLRGIIGAGEFGTPEKDFYEIRNRLYF  60

Query  400  -YRKR-TEPRRVLEE  438
              RKR  +P RVLEE
Sbjct  61   PSRKRGGDPHRVLEE  75



>emb|CAI11450.1| alpha-1,6-xylosyltransferase [Pinus taeda]
 gb|AHC98116.1| xyloglucan alpha-1,6-xylosyltransferase [Pinus radiata]
 tpg|DAA64591.1| TPA_inf: xyloglucan alpha-1,6-xylosyltransferase [Pinus taeda]
Length=444

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query  235  LSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSFYRKRT  414
            L  RR  Q++R ++N K+TLLCL +TV+V+RG +GAG+FGTPE+D  +I + L   R R 
Sbjct  9    LGGRRIRQIQRAMQNAKVTLLCLFVTVLVLRGTIGAGKFGTPEQDFNEIREHLIVGR-RG  67

Query  415  EPRRVLEEA  441
            EP RVL E 
Sbjct  68   EPHRVLTEV  76



>ref|XP_006479922.1| PREDICTED: putative glycosyltransferase 2-like isoform X2 [Citrus 
sinensis]
 gb|KDO87293.1| hypothetical protein CISIN_1g012077mg [Citrus sinensis]
Length=471

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A+R+ +  R LR  K+T LCLVLTVVV+RG +GAG FGTPEKD  +I + L F
Sbjct  1    MIERCLGAQRSRKFHRALRQCKVTALCLVLTVVVLRGIIGAGEFGTPEKDFYEIRNRLYF  60

Query  400  -YRKR-TEPRRVLEE  438
              RKR  +P RVLEE
Sbjct  61   PSRKRGGDPHRVLEE  75



>ref|XP_006479921.1| PREDICTED: putative glycosyltransferase 2-like isoform X1 [Citrus 
sinensis]
Length=479

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M++R L A+R+ +  R LR  K+T LCLVLTVVV+RG +GAG FGTPEKD  +I + L F
Sbjct  1    MIERCLGAQRSRKFHRALRQCKVTALCLVLTVVVLRGIIGAGEFGTPEKDFYEIRNRLYF  60

Query  400  -YRKR-TEPRRVLEE  438
              RKR  +P RVLEE
Sbjct  61   PSRKRGGDPHRVLEE  75



>ref|XP_010922270.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Elaeis guineensis]
Length=454

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML R L  RR  Q++R L+ GKLTLLCL LTV+V+RG +GAG+FGTPE+D  +I   L  
Sbjct  1    MLVRCLGERRVRQIQRALQRGKLTLLCLFLTVIVLRGTIGAGKFGTPEQDFNEIRHHL--  58

Query  400  YRKRTEPRRVLEEAE  444
               R+ P R L E +
Sbjct  59   LSHRSLPHRALVEQQ  73



>ref|XP_009416128.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009416136.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=432

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  217  IMLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDI  381
            + L R +  RR W +RR LR+ KLTLLCL LTV+V+RG +GAGRFGTPE+DL  I
Sbjct  1    MWLGRCVGERRVWHLRRALRSAKLTLLCLALTVLVLRGTVGAGRFGTPEQDLNQI  55



>ref|XP_008790864.1| PREDICTED: putative glycosyltransferase 2 [Phoenix dactylifera]
Length=449

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 52/97 (54%), Gaps = 7/97 (7%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML R L  RR  Q+RR LR GKLT LCL +TV+V+RG +GAG+FGTPE+D  +I      
Sbjct  1    MLCRCLGERRVRQIRRALRRGKLTFLCLFVTVIVLRGTIGAGKFGTPEQDFNEI------  54

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSGSGVGSE  510
             R+R  P   L     V         AT   + V  E
Sbjct  55   -RQRLRPHGSLPHRALVEQQADHSSAATAGKAFVADE  90



>ref|XP_008795804.1| PREDICTED: putative glycosyltransferase 2 [Phoenix dactylifera]
Length=452

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML   L  RR  Q++R LR GK+TLLCL LTV+V+RG +GAG+FGTPE+D  +I   L  
Sbjct  1    MLVWCLGERRVRQIQRALRQGKITLLCLFLTVIVLRGTIGAGKFGTPEQDFNEIRHRL--  58

Query  400  YRKRTEPRRVLEEAEQVNLTVGDDVNATDSG-SGVGSEDS  516
               R+ P R L E +  + +      AT +  +G G +D 
Sbjct  59   LPHRSLPHRALVEQQTDHTSSSATAGATKAFIAGEGDDDP  98



>ref|XP_003533377.1| PREDICTED: putative glycosyltransferase 2-like isoform 3 [Glycine 
max]
Length=450

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            ML+  L  RR  Q+ R  R+  +T LCL LT+VV+RG +GAG+FGTPE+D  +I   LS 
Sbjct  1    MLECCLGTRRVRQIHRACRHSTVTFLCLFLTLVVLRGTIGAGKFGTPEQDFNEIRHHLSA  60

Query  400  YRKRTEPRRVLEEAE  444
             R     RRVLEE +
Sbjct  61   ARA----RRVLEEVK  71



>ref|XP_010429788.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Camelina sativa]
Length=464

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 3/76 (4%)
 Frame = +1

Query  220  MLDRFLSARRAWQVRRILRNGKltllclvltvvvIRGNLGAGRFGTPEKDLKDISDTLSF  399
            M +R L A R  +++R     K+T+LCLVLTVVV+R  +GAG+FGTPE+DL +I     F
Sbjct  1    MNERCLGAYRCRRIQRAFHQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQ--HF  58

Query  400  Y-RKRTEPRRVLEEAE  444
            Y RKR EP RVLEE +
Sbjct  59   YTRKRGEPHRVLEEIQ  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490