BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I11

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008233771.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.0    2e-19   Prunus mume [ume]
ref|XP_007219265.1|  hypothetical protein PRUPE_ppa018219mg           93.2    3e-19   Prunus persica
emb|CDP14005.1|  unnamed protein product                              87.4    5e-17   Coffea canephora [robusta coffee]
ref|XP_010253767.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8      83.6    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_009782674.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1      83.2    1e-15   Nicotiana sylvestris
ref|XP_009627267.1|  PREDICTED: gibberellin 2-beta-dioxygenase 3      82.4    3e-15   Nicotiana tomentosiformis
ref|XP_008343626.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  82.0    3e-15   
ref|XP_007008940.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  82.0    4e-15   
ref|XP_003519400.1|  PREDICTED: uncharacterized protein LOC100785042  81.6    4e-15   Glycine max [soybeans]
gb|KHG25685.1|  Gibberellin 2-beta-dioxygenase 1 -like protein        82.0    4e-15   Gossypium arboreum [tree cotton]
ref|XP_008354176.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...  82.0    4e-15   
ref|XP_002311230.2|  hypothetical protein POPTR_0008s06980g           81.3    6e-15   
ref|XP_002528301.1|  conserved hypothetical protein                   81.3    1e-14   
ref|XP_011048612.1|  PREDICTED: gibberellin 2-beta-dioxygenase 2      80.1    2e-14   Populus euphratica
gb|KJB78765.1|  hypothetical protein B456_013G017500                  79.7    2e-14   Gossypium raimondii
emb|CBI25465.3|  unnamed protein product                              79.7    3e-14   Vitis vinifera
ref|XP_002272219.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1      79.0    5e-14   Vitis vinifera
ref|XP_009345066.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1      77.4    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_011076832.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  75.9    3e-13   Sesamum indicum [beniseed]
ref|XP_006338827.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  75.1    1e-12   Solanum tuberosum [potatoes]
ref|XP_006435756.1|  hypothetical protein CICLE_v10031789mg           75.1    1e-12   Citrus clementina [clementine]
gb|KDO68938.1|  hypothetical protein CISIN_1g016574mg                 74.7    1e-12   Citrus sinensis [apfelsine]
ref|XP_010101430.1|  hypothetical protein L484_007685                 74.7    1e-12   Morus notabilis
ref|XP_010031199.1|  PREDICTED: gibberellin 2-beta-dioxygenase 2      74.3    2e-12   Eucalyptus grandis [rose gum]
ref|XP_004308939.2|  PREDICTED: gibberellin 2-beta-dioxygenase 2      74.3    3e-12   Fragaria vesca subsp. vesca
gb|KGN50669.1|  hypothetical protein Csa_5G208470                     72.0    6e-12   Cucumis sativus [cucumbers]
ref|XP_004491028.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  71.6    1e-11   Cicer arietinum [garbanzo]
ref|XP_004165141.1|  PREDICTED: LOW QUALITY PROTEIN: 2'-deoxymugi...  71.6    2e-11   
ref|XP_004148203.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...  71.6    2e-11   
ref|XP_008465218.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  69.7    9e-11   Cucumis melo [Oriental melon]
ref|XP_009122356.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  69.3    1e-10   Brassica rapa
ref|XP_004240932.1|  PREDICTED: gibberellin 2-beta-dioxygenase 3      68.9    1e-10   Solanum lycopersicum
ref|XP_007141756.1|  hypothetical protein PHAVU_008G223100g           68.2    2e-10   Phaseolus vulgaris [French bean]
ref|XP_003616656.1|  Gibberellin 2-beta-dioxygenase                   67.0    7e-10   Medicago truncatula
gb|KDP44751.1|  hypothetical protein JCGZ_01251                       66.2    1e-09   Jatropha curcas
ref|XP_010552924.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1      63.9    7e-09   Tarenaya hassleriana [spider flower]
gb|EYU19996.1|  hypothetical protein MIMGU_mgv1a011036mg              63.5    7e-09   Erythranthe guttata [common monkey flower]
ref|XP_010689533.1|  PREDICTED: uncharacterized protein LOC104903226  61.2    6e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW50461.1|  hypothetical protein EUGRSUZ_J00197                   60.5    7e-08   Eucalyptus grandis [rose gum]
ref|XP_010488163.1|  PREDICTED: uncharacterized protein LOC104766019  59.7    2e-07   Camelina sativa [gold-of-pleasure]
gb|KFK38498.1|  hypothetical protein AALP_AA3G121000                  55.8    3e-06   Arabis alpina [alpine rockcress]
ref|XP_011085247.1|  PREDICTED: gibberellin 2-beta-dioxygenase-like   50.8    2e-04   Sesamum indicum [beniseed]
gb|EYU33365.1|  hypothetical protein MIMGU_mgv1a022731mg              50.4    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_006407469.1|  hypothetical protein EUTSA_v10020993mg           49.3    6e-04   
ref|XP_010464810.1|  PREDICTED: uncharacterized protein LOC104745308  48.9    8e-04   Camelina sativa [gold-of-pleasure]



>ref|XP_008233771.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Prunus 
mume]
Length=380

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 12/106 (11%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSE----HAEVLSACKHLGFFQLSRHSVESELANSAESLARSLF  439
            RRSP S      PSVSLS+     + + S+   LGFFQL+ HSV S+LANSAES A SLF
Sbjct  60   RRSPPST---CPPSVSLSDVQANPSTLFSSSSQLGFFQLTNHSVLSQLANSAESEALSLF  116

Query  440  DLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            DLPR +K+ +FPK WPLGF+ +           GESFCLDS+CS+E
Sbjct  117  DLPRHQKESFFPKCWPLGFEGD-----DDGDSLGESFCLDSSCSTE  157



>ref|XP_007219265.1| hypothetical protein PRUPE_ppa018219mg [Prunus persica]
 gb|EMJ20464.1| hypothetical protein PRUPE_ppa018219mg [Prunus persica]
Length=383

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 72/106 (68%), Gaps = 7/106 (7%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEH----AEVLSACKHLGFFQLSRHSVESELANSAESLARSLF  439
            RRSP        PSVSLS+     + + S+   LGFFQL+ HSV  +LANSAES A SLF
Sbjct  60   RRSP---PATCPPSVSLSDVQANLSTLFSSSSQLGFFQLTNHSVPFQLANSAESEALSLF  116

Query  440  DLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            DLPR +K+ +FPK WPLGF+ + DD+D      GESFCLDS+CS+E
Sbjct  117  DLPRHQKESFFPKCWPLGFEGDDDDEDDDGDALGESFCLDSSCSTE  162



>emb|CDP14005.1| unnamed protein product [Coffea canephora]
Length=389

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 5/95 (5%)
 Frame = +2

Query  308  PSVSLSEHAE-----VLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYF  472
            P +SLS+  E     +LSA    GFFQL+ HS+ S+LA SAES A SLF+L  + KQ++F
Sbjct  69   PLISLSDPPESLRSNLLSAGSQFGFFQLTNHSIPSQLATSAESDALSLFNLSPEEKQLHF  128

Query  473  PKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            P+NWPLG+D+  DDD+ +      S CLDSACSSE
Sbjct  129  PQNWPLGYDAGDDDDEESTISGESSVCLDSACSSE  163



>ref|XP_010253767.1| PREDICTED: gibberellin 2-beta-dioxygenase 8 [Nelumbo nucifera]
Length=390

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (63%), Gaps = 8/97 (8%)
 Frame = +2

Query  284  LSNKTAAVPSVSLSEH-----AEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLP  448
            LS  T + P +S+SE       ++LS+   LGFFQL+ HS+ S+LA SAE  + SLFDLP
Sbjct  58   LSPPTISPPVISISEQNLNLREDLLSSSSELGFFQLTNHSIPSQLAQSAELESLSLFDLP  117

Query  449  RDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLD  559
             D+KQ  FPKNWP GFD E   ++      GESFC D
Sbjct  118  HDKKQQSFPKNWPAGFDDE---EEDGDRSGGESFCFD  151



>ref|XP_009782674.1| PREDICTED: gibberellin 2-beta-dioxygenase 1 [Nicotiana sylvestris]
Length=379

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 7/108 (6%)
 Frame = +2

Query  269  GRRSPLSNKTAAVPSVSLSE-----HAEVLSACKHLGFFQLSRHSVESELANSAESLARS  433
            GRR    + T + P +SLS+     H+ + SA K  GFFQL+ HS+ S+LA SAES + S
Sbjct  61   GRRQSQPSTTTSPPLISLSDPKPTIHSNLFSAAKQHGFFQLTNHSISSQLATSAESESSS  120

Query  434  LFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            +F+LP D KQ YFPKNWPLGFD++  DDD      G+S CLDS+CS E
Sbjct  121  IFNLPHDEKQRYFPKNWPLGFDND--DDDDEDNVNGKSLCLDSSCSVE  166



>ref|XP_009627267.1| PREDICTED: gibberellin 2-beta-dioxygenase 3 [Nicotiana tomentosiformis]
Length=378

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 7/108 (6%)
 Frame = +2

Query  269  GRRSPLSNKTAAVPSVSLSE-----HAEVLSACKHLGFFQLSRHSVESELANSAESLARS  433
            GRR      T + P +SLS+     H+ +LSA K  G+FQL+ HS+ S+LA SAES + S
Sbjct  63   GRRQSPPLTTTSPPLISLSDPKPTLHSNLLSAAKQHGYFQLTNHSISSQLATSAESESSS  122

Query  434  LFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            +F+LP D KQ YFPKNWPLGFD++  DDD      G+S CLDS+CS E
Sbjct  123  IFNLPHDEKQRYFPKNWPLGFDND--DDDDDDNVNGKSLCLDSSCSVE  168



>ref|XP_008343626.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2-like [Malus 
domestica]
Length=369

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 3/102 (3%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPR  451
            RR P      ++    +  +  +LS    LGFFQL+ H + S+LAN AES A SLFDLP 
Sbjct  46   RRXPPKTCPQSISFSDVQANPTLLSCASQLGFFQLTNHPIPSQLANXAESEALSLFDLPT  105

Query  452  DRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
             +KQ   PK+WPLGF+ +   D+    G G+SFCLDS+CS+E
Sbjct  106  PQKQTSVPKSWPLGFEDD---DEDNGDGLGZSFCLDSSCSTE  144



>ref|XP_007008940.1| 2-oxoglutarate and Fe(II)-dependent oxygenase domain-containing 
protein, putative [Theobroma cacao]
 gb|EOY17750.1| 2-oxoglutarate and Fe(II)-dependent oxygenase domain-containing 
protein, putative [Theobroma cacao]
Length=371

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +2

Query  338  VLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGFDSEaddd  517
            +LS+   +GFFQL+ H V S+LANSAE+ + SLF+LP+++K+  FPKNWPLGFD++   +
Sbjct  83   LLSSGSKVGFFQLTSHDVSSQLANSAETESLSLFELPKEQKESCFPKNWPLGFDAD---E  139

Query  518  dhaaggagESFCLDSACSSE  577
            +      GESFCLD+ CS+E
Sbjct  140  EEGGDEKGESFCLDATCSTE  159



>ref|XP_003519400.1| PREDICTED: uncharacterized protein LOC100785042 [Glycine max]
Length=360

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = +2

Query  278  SPLSNKTAAVPSVSLSEHAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDR  457
            SP S      P +SL++   VLS    LG+ QL+ HSV SELANSAES A +LFDL +D+
Sbjct  54   SPSSAAATCPPCLSLND---VLSCVSKLGYAQLTDHSVPSELANSAESEALALFDLSQDQ  110

Query  458  KQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            KQ  FPKNWPLG+ ++   +D    G  +SF  DSACS+E
Sbjct  111  KQSLFPKNWPLGYGND---EDEDEDGVADSFRFDSACSTE  147



>gb|KHG25685.1| Gibberellin 2-beta-dioxygenase 1 -like protein [Gossypium arboreum]
Length=379

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 73/106 (69%), Gaps = 4/106 (4%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSE---HAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFD  442
            RRS  S  + A+P++S S+   +  ++S+   LGF QL+ H + S+LANSAE+ + SLF+
Sbjct  62   RRSSTSATSRALPTLSFSDPNFNHLLVSSGSELGFLQLTNHDIPSQLANSAETESLSLFE  121

Query  443  LPRDRKQVYFPKNWPLGF-DSEaddddhaaggagESFCLDSACSSE  577
            L RD+K+  FPKNWPLGF   + D+++    G GESFCLD+ CS+E
Sbjct  122  LTRDQKESCFPKNWPLGFDADDDDEEEEDGDGKGESFCLDTECSTE  167



>ref|XP_008354176.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase-like [Malus domestica]
Length=398

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 3/102 (3%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPR  451
            RR P      ++    +  +  +LS    LGFFQL+ H + S+LAN AES A SLFDLP 
Sbjct  75   RRXPPKTCPQSISFSDVQANPTLLSCASQLGFFQLTNHPIPSQLANXAESEALSLFDLPT  134

Query  452  DRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
             +KQ   PK+WPLGF+ +   D+    G G+SFCLDS+CS+E
Sbjct  135  PQKQTSVPKSWPLGFEDD---DEDNGDGLGZSFCLDSSCSTE  173



>ref|XP_002311230.2| hypothetical protein POPTR_0008s06980g [Populus trichocarpa]
 gb|EEE88597.2| hypothetical protein POPTR_0008s06980g [Populus trichocarpa]
Length=357

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (64%), Gaps = 10/99 (10%)
 Frame = +2

Query  287  SNKTAAVPSVSLSE---HAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDR  457
            S+   + P +SLS+      + SA    G+FQL+ H++ S+LA SAE  + SLFDLP+D+
Sbjct  48   SSPATSFPLISLSDPNLQDLIFSASSQRGYFQLTNHNIPSKLATSAELESVSLFDLPKDK  107

Query  458  KQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSS  574
            K+ YFPKNWPLGF+ +         G GESF LD+ CS+
Sbjct  108  KESYFPKNWPLGFEGD-------EDGNGESFWLDAECST  139



>ref|XP_002528301.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34059.1| conserved hypothetical protein [Ricinus communis]
Length=435

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 64/104 (62%), Gaps = 9/104 (9%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHA---EVLSACKHLGFFQLSRHSVESELANSAESLARSLFD  442
            RR   S  T + P +SLS+      +LSAC   GFFQL +H++ S LANSAE  + SLF 
Sbjct  111  RRGSSSLSTTSPPLISLSDQTSADHLLSACSQHGFFQLHKHNIPSHLANSAEVESLSLFK  170

Query  443  LPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSS  574
            L +D+K+ YFPKNWPLGF+ +         G GESF LD  CS+
Sbjct  171  LAKDKKESYFPKNWPLGFNDD------DEEGNGESFWLDGDCSA  208



>ref|XP_011048612.1| PREDICTED: gibberellin 2-beta-dioxygenase 2 [Populus euphratica]
Length=371

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 10/99 (10%)
 Frame = +2

Query  287  SNKTAAVPSVSLSE---HAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDR  457
            S      P +SLS+      + SA    G+FQL+ H++ S+LA SAE  + SLFDLP+D+
Sbjct  62   STPATPFPLISLSDPNLQDLLFSASSQRGYFQLTNHNIPSQLATSAELESVSLFDLPKDK  121

Query  458  KQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSS  574
            K+ YFPKNWPLGF+ +         G GESF LD+ CS+
Sbjct  122  KESYFPKNWPLGFEGD-------EDGNGESFWLDAECST  153



>gb|KJB78765.1| hypothetical protein B456_013G017500 [Gossypium raimondii]
Length=379

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSE---HAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFD  442
            RRS  S  +   P++S S+   +  +LS+   LGF QL+ H + S+LANSAE+ + SLF+
Sbjct  62   RRSSTSATSPPPPTLSFSDPNFNHLLLSSGSELGFLQLTNHDIPSQLANSAETESLSLFE  121

Query  443  LPRDRKQVYFPKNWPLGF-DSEaddddhaaggagESFCLDSACSSE  577
            L RD+K+  FPKNWPLGF   + D+++    G GESFCLD+ CS+E
Sbjct  122  LTRDQKESCFPKNWPLGFDADDDDEEEEDGDGKGESFCLDTECSTE  167



>emb|CBI25465.3| unnamed protein product [Vitis vinifera]
Length=380

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 4/72 (6%)
 Frame = +2

Query  362  GFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggag  541
            GFFQL  H + S+LA SAES + +LFDLPR +KQ  FPKNWPLGFD++    +    GAG
Sbjct  87   GFFQLIDHPIPSQLARSAESESLALFDLPRPQKQHSFPKNWPLGFDAD----EDEEDGAG  142

Query  542  ESFCLDSACSSE  577
            E+FCL+S+CS+E
Sbjct  143  EAFCLESSCSTE  154



>ref|XP_002272219.1| PREDICTED: gibberellin 2-beta-dioxygenase 1 [Vitis vinifera]
Length=382

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 4/72 (6%)
 Frame = +2

Query  362  GFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggag  541
            GFFQL  H + S+LA SAES + +LFDLPR +KQ  FPKNWPLGFD++    +    GAG
Sbjct  87   GFFQLIDHPIPSQLARSAESESLALFDLPRPQKQHSFPKNWPLGFDAD----EDEEDGAG  142

Query  542  ESFCLDSACSSE  577
            E+FCL+S+CS+E
Sbjct  143  EAFCLESSCSTE  154



>ref|XP_009345066.1| PREDICTED: gibberellin 2-beta-dioxygenase 1 [Pyrus x bretschneideri]
Length=364

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 3/102 (3%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPR  451
            RRSP +    ++    +  +  +L     LG FQL+ H + S+LANSAE  A SLFDLP 
Sbjct  41   RRSPPTTCPQSISFSDIQANPTLLFCASQLGLFQLTNHPIPSQLANSAELEALSLFDLPA  100

Query  452  DRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
             +KQ   PK+WPLGF+ +   D+    G GESFCLDS CS+E
Sbjct  101  HQKQSSVPKSWPLGFEDD---DEDNGDGLGESFCLDSLCSTE  139



>ref|XP_011076832.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2, partial 
[Sesamum indicum]
Length=299

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +2

Query  323  SEHAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGFDS  502
            S H+ +LSA    GFF L+ H++ S L  SAES+A SLF LP  +KQ+ FP NWPLG + 
Sbjct  16   SLHSSLLSAATQHGFFHLTHHTIPSHLPLSAESVAVSLFSLPNHQKQLLFPNNWPLGHEI  75

Query  503  EaddddhaaggagESFCLDSACSSE  577
            E DD+D AA    ESFCL S CS+E
Sbjct  76   E-DDEDSAASPGAESFCLGSLCSTE  99



>ref|XP_006338827.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Solanum 
tuberosum]
Length=387

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 68/108 (63%), Gaps = 10/108 (9%)
 Frame = +2

Query  269  GRRSPLSNKTAAVPSVSLSE-----HAEVLSACKHLGFFQLSRHSVESELANSAESLARS  433
            GRR    + T + P +SLS+     H+ +LSA K  GFFQL++HS+ S LA SAES + S
Sbjct  64   GRRQSPPSTTISPPLISLSDAKSILHSNLLSAAKQHGFFQLTQHSISSHLAQSAESESAS  123

Query  434  LFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            +F+   D KQ+ FPKNWPLGFD++  DDD      G S CLD + S E
Sbjct  124  IFN---DEKQLCFPKNWPLGFDND--DDDDDDFVCGRSLCLDESSSME  166



>ref|XP_006435756.1| hypothetical protein CICLE_v10031789mg [Citrus clementina]
 ref|XP_006486306.1| PREDICTED: gibberellin 2-beta-dioxygenase 2-like [Citrus sinensis]
 gb|ESR48996.1| hypothetical protein CICLE_v10031789mg [Citrus clementina]
Length=388

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +2

Query  275  RSPLSNKTAAVPSVSLSEHAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRD  454
            RSP + +   +   + + + ++LS+   LGFFQL+ H + S+LA+SAE  A SLF+L RD
Sbjct  66   RSPSATRPPLISLSNPNRNEQILSSASQLGFFQLTNHGISSQLAHSAELEALSLFELERD  125

Query  455  RKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            +K   FPKNWPL       +++    G GESFCLDSAC S+
Sbjct  126  KKLSCFPKNWPL---GYEAEEEEDEEGNGESFCLDSACYSD  163



>gb|KDO68938.1| hypothetical protein CISIN_1g016574mg [Citrus sinensis]
Length=387

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +2

Query  275  RSPLSNKTAAVPSVSLSEHAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRD  454
            RSP + +   +   + + + ++LS+   LGFFQL+ H + S+LA+SAE  A SLF+L RD
Sbjct  65   RSPSATRPPLISLSNPNRNEQILSSASQLGFFQLTNHGISSQLAHSAELEALSLFELERD  124

Query  455  RKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            +K   FPKNWPL       +++    G GESFCLDSAC S+
Sbjct  125  KKLSCFPKNWPL---GYEAEEEEDEEGNGESFCLDSACYSD  162



>ref|XP_010101430.1| hypothetical protein L484_007685 [Morus notabilis]
 gb|EXB88402.1| hypothetical protein L484_007685 [Morus notabilis]
Length=371

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  308  PSVSLSEHA---EVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPK  478
            PS+SLS      ++LS+   LGFFQ + HSV  +LA+SAES A ++ +L R++K+  FPK
Sbjct  68   PSISLSGDTILDDLLSSSSQLGFFQFTGHSVPPQLASSAESEALAILNLAREQKESCFPK  127

Query  479  NWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            NWPLG+++E   +D    G GE  CLDSACS+E
Sbjct  128  NWPLGYEAE---EDEEGDGQGEFLCLDSACSAE  157



>ref|XP_010031199.1| PREDICTED: gibberellin 2-beta-dioxygenase 2 [Eucalyptus grandis]
Length=413

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = +2

Query  335  EVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGFDSEadd  514
            E LS+   +GFFQ++ H +  ELA SAES + +LFDLP DRK+++FPKNWP G++ +   
Sbjct  100  ESLSSASSVGFFQMTGHPISPELARSAESESLALFDLPLDRKELHFPKNWPFGYERD---  156

Query  515  ddhaaggagESFCLDSACS  571
                    GE F LDS CS
Sbjct  157  --EDDDRHGEWFVLDSLCS  173



>ref|XP_004308939.2| PREDICTED: gibberellin 2-beta-dioxygenase 2 [Fragaria vesca subsp. 
vesca]
Length=440

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  305  VPSVSLSE---HAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFP  475
            VP VSLS+   +  +LS+   LGFFQL+ HS+   LA+SAE  A SL DLP+D+K+  FP
Sbjct  109  VPVVSLSQARSNPSLLSS--KLGFFQLTDHSIPPRLADSAELEALSLLDLPKDKKEACFP  166

Query  476  KNWPLGFDSEaddddhaagga--gESFCLDSACSSE  577
            +NWP+GF+   +  D        GESFCL+ +C +E
Sbjct  167  RNWPVGFEEGDEVVDDDDDVEGLGESFCLEESCYTE  202



>gb|KGN50669.1| hypothetical protein Csa_5G208470 [Cucumis sativus]
Length=310

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 12/103 (12%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHAE------VLSACKHLGFFQLSRHSVESELANSAESLARS  433
            RRSP        P++S SE         +LSA   LGFFQL+ H + S LA SAES +  
Sbjct  57   RRSP---SVIPPPTISFSESPNPDLLNRLLSAASELGFFQLTDHKISSHLALSAESESAP  113

Query  434  LFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDS  562
            LF+LP ++K+  FPKNWPLGF  +    D  + G+GES C DS
Sbjct  114  LFNLPAEKKESLFPKNWPLGFKGD---GDEESDGSGESLCFDS  153



>ref|XP_004491028.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2-like [Cicer 
arietinum]
Length=368

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHA--EVLSACKHLGFFQLSRHSVESELANSAESLARSLFDL  445
            RRS LS    + PS+S       ++LS+   LG+ QL+ HSV SELANSAES +  LF+L
Sbjct  60   RRSSLS--ATSPPSLSFPSLTPNQLLSSISKLGYVQLTGHSVSSELANSAESESLELFNL  117

Query  446  PRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
             R +K+  FP+NWP G+D      D       ESF  D +CS+E
Sbjct  118  SRHQKESLFPQNWPFGYDG----GDDEDETLAESFRFDPSCSTE  157



>ref|XP_004165141.1| PREDICTED: LOW QUALITY PROTEIN: 2'-deoxymugineic-acid 2'-dioxygenase-like 
[Cucumis sativus]
Length=377

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 12/103 (12%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHAE------VLSACKHLGFFQLSRHSVESELANSAESLARS  433
            RRSP        P++S SE         +LSA   LGFFQL+ H + S LA SAES +  
Sbjct  57   RRSP---SVIPPPTISFSESPNPDLLNRLLSAASELGFFQLTDHKISSHLALSAESESAP  113

Query  434  LFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDS  562
            LF+LP ++K+  FPKNWPLGF  +    D  + G+GES C DS
Sbjct  114  LFNLPAEKKESLFPKNWPLGFKGD---GDEESDGSGESLCFDS  153



>ref|XP_004148203.1| PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase-like [Cucumis 
sativus]
Length=384

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 12/103 (12%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHAE------VLSACKHLGFFQLSRHSVESELANSAESLARS  433
            RRSP        P++S SE         +LSA   LGFFQL+ H + S LA SAES +  
Sbjct  57   RRSP---SVIPPPTISFSESPNPDLLNRLLSAASELGFFQLTDHKISSHLALSAESESAP  113

Query  434  LFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDS  562
            LF+LP ++K+  FPKNWPLGF  +    D  + G+GES C DS
Sbjct  114  LFNLPAEKKESLFPKNWPLGFKGD---GDEESDGSGESLCFDS  153



>ref|XP_008465218.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Cucumis 
melo]
 ref|XP_008465219.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Cucumis 
melo]
Length=381

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 61/103 (59%), Gaps = 12/103 (12%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHAE------VLSACKHLGFFQLSRHSVESELANSAESLARS  433
            RRSP      A P++S SE         +LSA   LGFFQL+ H + S LA SAES + +
Sbjct  57   RRSP---SVIAPPTISFSESPNPDLLNHLLSAASELGFFQLTDHKISSHLALSAESESAA  113

Query  434  LFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDS  562
            LF+L  ++K+  FPKNWPLGF  +    D  + G+G+S C DS
Sbjct  114  LFNLSAEKKESLFPKNWPLGFKGD---GDEESDGSGDSLCFDS  153



>ref|XP_009122356.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103847069 
[Brassica rapa]
Length=373

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 62/106 (58%), Gaps = 13/106 (12%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEH--AEVLSACKHLGFFQL--SRHSVESELANSAESLARSLF  439
            R S LS+  A++P+V+ S     +++SA    G+FQL  S   + S LA +AES A SL 
Sbjct  64   RSSVLSSTVASLPTVTFSTESRGDLISAATEFGYFQLVDSDTILPSGLAEAAESEALSLI  123

Query  440  DLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            +L  + K+  FPKNWPLG++++             SFCLD+ C++E
Sbjct  124  ELSEEEKETTFPKNWPLGYEAD---------AETPSFCLDADCTTE  160



>ref|XP_004240932.1| PREDICTED: gibberellin 2-beta-dioxygenase 3 [Solanum lycopersicum]
Length=380

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 10/108 (9%)
 Frame = +2

Query  269  GRRSPLSNKTAAVPSVSLSE-----HAEVLSACKHLGFFQLSRHSVESELANSAESLARS  433
            GRR      T +   +SLS+     H+ +L A K  GFFQL++HS+ S LA SAES + S
Sbjct  62   GRRQSPPPTTVSPHLISLSDAKSILHSNLLFAAKQHGFFQLTQHSISSHLAQSAESESAS  121

Query  434  LFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            +F+   D KQ+ FPKNWPLGFD++  +DD     +G S CLD + S E
Sbjct  122  IFN---DEKQLCFPKNWPLGFDND--EDDDDDVVSGRSICLDESSSME  164



>ref|XP_007141756.1| hypothetical protein PHAVU_008G223100g [Phaseolus vulgaris]
 gb|ESW13750.1| hypothetical protein PHAVU_008G223100g [Phaseolus vulgaris]
Length=371

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +2

Query  317  SLSEHAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGF  496
            SLS   ++ S    LG+ QL+ HSV  ELAN AE  A +LFDLPRD+K+   P++WPL  
Sbjct  75   SLSSLKDIFSCVSQLGYAQLTDHSVPPELANVAEEEALALFDLPRDQKESLIPESWPL--  132

Query  497  DSEaddddhaaggagESFCLDSACSSE  577
                  D+    G GESF  DSACS+E
Sbjct  133  -GYGRGDEDDDDGLGESFRFDSACSTE  158



>ref|XP_003616656.1| Gibberellin 2-beta-dioxygenase [Medicago truncatula]
 gb|AES99614.1| 2-deoxymugineic-acid 2-dioxygenase-like protein, putative [Medicago 
truncatula]
Length=379

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +2

Query  335  EVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGFDSEadd  514
            +++S+   LGF QL+ HSV S+LAN AES +  LF+L  D+K+ +FP+NWP G++ + D+
Sbjct  85   KLISSISQLGFIQLTDHSVSSKLANLAESESLKLFNLSHDQKESFFPQNWPFGYEGDNDN  144

Query  515  ddhaaggagESFCLDSACSSE  577
            D+     +   F  DS CS+E
Sbjct  145  DEEKLVESFR-FQFDSLCSTE  164



>gb|KDP44751.1| hypothetical protein JCGZ_01251 [Jatropha curcas]
Length=370

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 7/80 (9%)
 Frame = +2

Query  338  VLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGFDSEaddd  517
            +LSA    GFFQL+ H++ S+L NS+ES + SLF L RD+K  YFPKNWPLGF+ +    
Sbjct  82   LLSASSQDGFFQLTDHNITSQLVNSSESESLSLFKLTRDQKGSYFPKNWPLGFEDD----  137

Query  518  dhaaggagESFCLDSACSSE  577
                 G GESF LD+  S+E
Sbjct  138  ---EDGNGESFWLDAEFSTE  154



>ref|XP_010552924.1| PREDICTED: gibberellin 2-beta-dioxygenase 1 [Tarenaya hassleriana]
Length=378

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 11/108 (10%)
 Frame = +2

Query  272  RRSPLSNKTAAVPSVSLSEHA----EVLSACKHLGFFQLSRHS--VESELANSAESLARS  433
            RR   +  +A++P+VSL+       ++LSA    G+F L+     + SELA+SAES + S
Sbjct  64   RRRSTAPSSASLPAVSLAGDGGSSDDLLSAATESGYFDLTDCGTMIPSELAHSAESDSLS  123

Query  434  LFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            LF L  ++K+ + PK WPLG+++              SFCLD+ CS+E
Sbjct  124  LFGLGEEQKETWLPKAWPLGYEA-----VDGEEAETGSFCLDADCSTE  166



>gb|EYU19996.1| hypothetical protein MIMGU_mgv1a011036mg [Erythranthe guttata]
Length=294

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +2

Query  329  HAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGFD-SE  505
            H+ +LSA   LGFF L++H+V S LA SAES A SLF+LP  +K+  FP NWPLG +  +
Sbjct  12   HSSLLSASTKLGFFHLTQHAVSSHLALSAESAAASLFNLPDHQKKHLFPNNWPLGHEIED  71

Query  506  addddhaaggagESFCLDSACSSE  577
             DDDD  +  A ESFCLDS+CS+E
Sbjct  72   DDDDDDESSSATESFCLDSSCSAE  95



>ref|XP_010689533.1| PREDICTED: uncharacterized protein LOC104903226 [Beta vulgaris 
subsp. vulgaris]
Length=394

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 8/77 (10%)
 Frame = +2

Query  359  LGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLG--FDSEaddddhaag  532
            LG+FQLS HS+  +LA SAES + SL +LP D K   FP+ WPLG  +D E    ++   
Sbjct  95   LGYFQLSNHSITHQLAESAESDSVSLLELPLDDKVNSFPREWPLGCFYDDE----ENDND  150

Query  533  gagESFCLDSA--CSSE  577
               ESFCLD    C  E
Sbjct  151  HKTESFCLDGTILCDEE  167



>gb|KCW50461.1| hypothetical protein EUGRSUZ_J00197 [Eucalyptus grandis]
Length=301

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = +2

Query  374  LSRHSVESELANSAESLARSLFDLPRDRKQVYFPKNWPLGFDSEaddddhaaggagESFC  553
            ++ H +  ELA SAES + +LFDLP DRK+++FPKNWP G++ +           GE F 
Sbjct  1    MTGHPISPELARSAESESLALFDLPLDRKELHFPKNWPFGYERD-----EDDDRHGEWFV  55

Query  554  LDSACS  571
            LDS CS
Sbjct  56   LDSLCS  61



>ref|XP_010488163.1| PREDICTED: uncharacterized protein LOC104766019 [Camelina sativa]
Length=376

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 18/101 (18%)
 Frame = +2

Query  302  AVPSVSLSEHA-----EVLSACKHLGFFQLSRHS----VESELANSAESLARSLFDLPRD  454
            ++P VSLS        +++SA    G+FQLS       + S LA +AE+ + SL DL  +
Sbjct  74   SLPMVSLSAGERESWDDLISAATDFGYFQLSIDDSDIVIPSALAEAAETDSLSLLDLSEE  133

Query  455  RKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            +K+  FPKNWPLG++++             S CLD  CS+E
Sbjct  134  KKETSFPKNWPLGYEAD---------AETPSLCLDVDCSNE  165



>gb|KFK38498.1| hypothetical protein AALP_AA3G121000 [Arabis alpina]
Length=344

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 61/98 (62%), Gaps = 11/98 (11%)
 Frame = +2

Query  287  SNKTAAVPSVSLS--EHAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRK  460
            S+  A++P+VSLS   + +++SA  + G+FQLS   + SELA +AES + SL +L  ++K
Sbjct  62   SSTVASLPTVSLSAGSNDDLISAATNFGYFQLSDTIITSELAKAAESDSLSLLELSEEKK  121

Query  461  QVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSS  574
            +  FPKNWPLG++++             S CLD  CS+
Sbjct  122  ESSFPKNWPLGYEAD---------AETPSLCLDGDCST  150



>ref|XP_011085247.1| PREDICTED: gibberellin 2-beta-dioxygenase-like [Sesamum indicum]
Length=331

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (53%), Gaps = 4/72 (6%)
 Frame = +2

Query  299  AAVPSVSLSE---HAEVLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQVY  469
              +P V LS     A V+ ACK LGFF+L  H V  EL N  E+ A   F LP+  K+  
Sbjct  26   TGIPVVDLSHPDAKARVVEACKELGFFKLINHGVSMELFNLLEAEAVKFFKLPQQEKEKS  85

Query  470  FPKNWPLGFDSE  505
             P N P G+ ++
Sbjct  86   GPPN-PFGYGNK  96



>gb|EYU33365.1| hypothetical protein MIMGU_mgv1a022731mg [Erythranthe guttata]
Length=319

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 39/71 (55%), Gaps = 5/71 (7%)
 Frame = +2

Query  296  TAAVPSVSLSEHAE----VLSACKHLGFFQLSRHSVESELANSAESLARSLFDLPRDRKQ  463
            T  +P V LS+H      +++ACK  GFF++  H +  +L+N  E+ +   F LP+  K+
Sbjct  30   TGNIPVVDLSDHTVAKTLIVNACKEFGFFKVINHGISMDLSNKLEAESVKFFKLPKQEKE  89

Query  464  VYFPKNWPLGF  496
               P N P G+
Sbjct  90   KSGPPN-PFGY  99



>ref|XP_006407469.1| hypothetical protein EUTSA_v10020993mg [Eutrema salsugineum]
 gb|ESQ48922.1| hypothetical protein EUTSA_v10020993mg [Eutrema salsugineum]
Length=364

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 59/104 (57%), Gaps = 16/104 (15%)
 Frame = +2

Query  287  SNKTAAVPSVSLSEHA--EVLSACKHLGFFQLSRHS-----VESELANSAESLARSLFDL  445
            S+  A++P+VS    +  +++SA    G+F L+ +      + S LA +AES + +L +L
Sbjct  64   SSVVASLPTVSFPAGSCDDLISAATEFGYFNLASNDDSDTIIPSGLAEAAESDSLALLEL  123

Query  446  PRDRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
              + K+  FPKNWPLG+++E             SFCLD+ CS+E
Sbjct  124  SEEEKESSFPKNWPLGYETE---------SETPSFCLDADCSTE  158



>ref|XP_010464810.1| PREDICTED: uncharacterized protein LOC104745308 [Camelina sativa]
Length=377

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 18/102 (18%)
 Frame = +2

Query  299  AAVPSVSLSEHA-----EVLSACKHLGFFQLSRHS----VESELANSAESLARSLFDLPR  451
            A++P VSLS        +++SA    G+FQLS       + S LA +AES + SL DL  
Sbjct  73   ASLPMVSLSAGERESWDDLISAAADFGYFQLSIDDSDIVIPSGLAEAAESDSLSLLDLSE  132

Query  452  DRKQVYFPKNWPLGFDSEaddddhaaggagESFCLDSACSSE  577
            ++K+  FPKNWPLG++++             S CLD+ CS+E
Sbjct  133  EKKETSFPKNWPLGYEAD---------AETPSLCLDADCSNE  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985