BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I10

Length=338
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010909100.1|  PREDICTED: glutathione S-transferase T1 isof...    180   6e-54   Elaeis guineensis
ref|XP_009600810.1|  PREDICTED: glutathione S-transferase T1-like       178   3e-53   Nicotiana tomentosiformis
ref|XP_010053279.1|  PREDICTED: glutathione S-transferase T1            177   1e-52   Eucalyptus grandis [rose gum]
ref|XP_004245615.1|  PREDICTED: glutathione S-transferase T1-like       176   2e-52   Solanum lycopersicum
ref|XP_006343997.1|  PREDICTED: glutathione S-transferase T1-like       175   5e-52   Solanum tuberosum [potatoes]
ref|XP_008794197.1|  PREDICTED: glutathione S-transferase T1 isof...    174   9e-52   Phoenix dactylifera
ref|XP_011463848.1|  PREDICTED: glutathione S-transferase T1            173   3e-51   Fragaria vesca subsp. vesca
ref|XP_009386058.1|  PREDICTED: glutathione S-transferase T1-like       173   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010255416.1|  PREDICTED: glutathione S-transferase T1            172   7e-51   Nelumbo nucifera [Indian lotus]
ref|XP_011072471.1|  PREDICTED: glutathione S-transferase T1            172   1e-50   Sesamum indicum [beniseed]
gb|ACC93946.1|  glutathione S-transferase                               172   1e-50   Panax ginseng [Asiatic ginseng]
ref|XP_008238862.1|  PREDICTED: glutathione S-transferase T1            171   3e-50   Prunus mume [ume]
ref|XP_007209508.1|  hypothetical protein PRUPE_ppa010414mg             170   4e-50   Prunus persica
ref|XP_009339919.1|  PREDICTED: glutathione S-transferase T1            170   8e-50   Pyrus x bretschneideri [bai li]
ref|XP_002298040.2|  glutathione S-transferase family protein           169   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011029250.1|  PREDICTED: glutathione S-transferase T1-like       169   1e-49   Populus euphratica
ref|XP_007040202.1|  Glutathione S-transferase THETA 1                  165   3e-49   
ref|XP_008651869.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    164   4e-49   
tpg|DAA43810.1|  TPA: hypothetical protein ZEAMMB73_384133              164   5e-49   
gb|KDP36315.1|  hypothetical protein JCGZ_09530                         167   6e-49   Jatropha curcas
gb|AFK36240.1|  unknown                                                 167   7e-49   Lotus japonicus
gb|KJB52086.1|  hypothetical protein B456_008G246300                    166   9e-49   Gossypium raimondii
emb|CDP09756.1|  unnamed protein product                                167   9e-49   Coffea canephora [robusta coffee]
ref|XP_008452024.1|  PREDICTED: glutathione S-transferase T1            166   1e-48   Cucumis melo [Oriental melon]
gb|KHG19174.1|  Glutathione S-transferase T1 -like protein              167   1e-48   Gossypium arboreum [tree cotton]
gb|KJB52087.1|  hypothetical protein B456_008G246300                    166   1e-48   Gossypium raimondii
ref|XP_009599399.1|  PREDICTED: glutathione S-transferase T1-like       166   1e-48   Nicotiana tomentosiformis
ref|XP_007160052.1|  hypothetical protein PHAVU_002G288600g             166   1e-48   Phaseolus vulgaris [French bean]
gb|KJB52089.1|  hypothetical protein B456_008G246300                    166   2e-48   Gossypium raimondii
ref|XP_006439583.1|  hypothetical protein CICLE_v10021831mg             166   3e-48   Citrus clementina [clementine]
ref|XP_006476596.1|  PREDICTED: glutathione S-transferase T1-like       166   3e-48   Citrus sinensis [apfelsine]
ref|XP_004146527.1|  PREDICTED: glutathione S-transferase T1-like       165   3e-48   Cucumis sativus [cucumbers]
ref|XP_006439582.1|  hypothetical protein CICLE_v10021879mg             165   4e-48   Citrus clementina [clementine]
ref|NP_001152125.1|  glutathione S-transferase theta-1                  165   4e-48   Zea mays [maize]
emb|CDP09752.1|  unnamed protein product                                165   5e-48   Coffea canephora [robusta coffee]
ref|XP_002272455.1|  PREDICTED: glutathione S-transferase T1            165   7e-48   
emb|CBI34681.3|  unnamed protein product                                165   7e-48   Vitis vinifera
gb|ADB11337.1|  theta class glutathione transferase GSTT1               164   1e-47   Populus trichocarpa [western balsam poplar]
gb|KDP25451.1|  hypothetical protein JCGZ_20607                         164   2e-47   Jatropha curcas
ref|XP_002509785.1|  glutathione-s-transferase theta, gst, putative     164   2e-47   Ricinus communis
gb|EYU38357.1|  hypothetical protein MIMGU_mgv1a012529mg                163   2e-47   Erythranthe guttata [common monkey flower]
ref|XP_009796155.1|  PREDICTED: glutathione S-transferase T1-like       163   2e-47   Nicotiana sylvestris
ref|XP_004503735.1|  PREDICTED: tRNA 2'-phosphotransferase 1-like...    163   3e-47   Cicer arietinum [garbanzo]
gb|KJB25823.1|  hypothetical protein B456_004G211100                    164   4e-47   Gossypium raimondii
gb|AEB77874.1|  glutathione S-transferase protein                       162   9e-47   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010553511.1|  PREDICTED: glutathione S-transferase T1            162   9e-47   Tarenaya hassleriana [spider flower]
gb|EMS35634.1|  Glutathione S-transferase theta-1                       160   2e-46   Triticum urartu
gb|KHG21896.1|  Glutathione S-transferase T1 -like protein              161   2e-46   Gossypium arboreum [tree cotton]
gb|KHN23652.1|  Glutathione S-transferase T1                            160   2e-46   Glycine soja [wild soybean]
ref|NP_001236903.1|  glutathione S-transferase GST 23                   160   3e-46   
ref|XP_004980948.1|  PREDICTED: glutathione S-transferase T1-like       160   3e-46   Setaria italica
gb|EYU23489.1|  hypothetical protein MIMGU_mgv1a012760mg                160   4e-46   Erythranthe guttata [common monkey flower]
ref|NP_001068175.1|  Os11g0588300                                       160   4e-46   
ref|XP_003630526.1|  Glutathione transferase                            156   4e-46   
gb|KJB25822.1|  hypothetical protein B456_004G211100                    160   4e-46   Gossypium raimondii
gb|KJB25824.1|  hypothetical protein B456_004G211100                    159   5e-46   Gossypium raimondii
ref|XP_003630525.1|  Glutathione transferase                            158   5e-46   
gb|EPS65585.1|  hypothetical protein M569_09192                         159   5e-46   Genlisea aurea
ref|XP_006343999.1|  PREDICTED: glutathione S-transferase T1-like...    157   1e-45   
gb|AFK47457.1|  unknown                                                 158   2e-45   Medicago truncatula
ref|XP_003630524.1|  Glutathione transferase                            158   3e-45   Medicago truncatula
ref|XP_006827675.1|  hypothetical protein AMTR_s00009p00255220          157   3e-45   Amborella trichopoda
ref|XP_002304489.1|  glutathione S-transferase family protein           157   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009769998.1|  PREDICTED: glutathione S-transferase T1-like       152   3e-45   Nicotiana sylvestris
ref|XP_004503770.1|  PREDICTED: glutathione S-transferase T1-like       158   3e-45   Cicer arietinum [garbanzo]
ref|XP_004245614.1|  PREDICTED: glutathione S-transferase T1            157   4e-45   Solanum lycopersicum
gb|ADB11338.1|  theta class glutathione transferase GSTT2               157   4e-45   Populus trichocarpa [western balsam poplar]
gb|KDP25450.1|  hypothetical protein JCGZ_20606                         156   6e-45   Jatropha curcas
ref|XP_006343998.1|  PREDICTED: glutathione S-transferase T1-like...    157   6e-45   Solanum tuberosum [potatoes]
emb|CDP09754.1|  unnamed protein product                                156   1e-44   Coffea canephora [robusta coffee]
gb|KJB39646.1|  hypothetical protein B456_007G023300                    156   1e-44   Gossypium raimondii
emb|CDY71891.1|  BnaC06g42280D                                          155   2e-44   Brassica napus [oilseed rape]
ref|XP_002868607.1|  hypothetical protein ARALYDRAFT_916086             155   4e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_011022714.1|  PREDICTED: glutathione S-transferase T1            154   5e-44   Populus euphratica
ref|XP_002449793.1|  hypothetical protein SORBIDRAFT_05g023450          155   5e-44   Sorghum bicolor [broomcorn]
ref|XP_010676473.1|  PREDICTED: glutathione S-transferase T1            154   5e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009125179.1|  PREDICTED: glutathione S-transferase T1-like       154   6e-44   Brassica rapa
gb|KHG14410.1|  Glutathione S-transferase T1 -like protein              159   7e-44   Gossypium arboreum [tree cotton]
emb|CDX67492.1|  BnaA07g15320D                                          154   8e-44   
ref|NP_198937.1|  glutathione S-transferase THETA 1                     154   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003563992.1|  PREDICTED: glutathione S-transferase T1            154   2e-43   Brachypodium distachyon [annual false brome]
gb|EMT22242.1|  hypothetical protein F775_32578                         153   2e-43   
emb|CDP09755.1|  unnamed protein product                                152   2e-43   Coffea canephora [robusta coffee]
emb|CDY46386.1|  BnaC04g33050D                                          153   2e-43   Brassica napus [oilseed rape]
ref|XP_011080977.1|  PREDICTED: glutathione S-transferase T1-like       152   3e-43   Sesamum indicum [beniseed]
ref|XP_009140078.1|  PREDICTED: glutathione S-transferase T1-like       153   3e-43   Brassica rapa
gb|AGC13145.1|  theta class glutathione S-transferase                   153   3e-43   Pinus tabuliformis [southern Chinese pine]
emb|CDY39752.1|  BnaA04g11010D                                          152   3e-43   Brassica napus [oilseed rape]
ref|XP_011072506.1|  PREDICTED: glutathione S-transferase T1-like       152   4e-43   Sesamum indicum [beniseed]
ref|XP_004252589.1|  PREDICTED: glutathione S-transferase T1            152   5e-43   Solanum lycopersicum
ref|XP_006405381.1|  hypothetical protein EUTSA_v10027900mg             152   5e-43   Eutrema salsugineum [saltwater cress]
emb|CDP09753.1|  unnamed protein product                                148   8e-43   Coffea canephora [robusta coffee]
gb|KFK33026.1|  hypothetical protein AALP_AA6G320800                    151   8e-43   Arabis alpina [alpine rockcress]
ref|XP_003532409.1|  PREDICTED: glutathione S-transferase T2-like...    151   9e-43   
ref|XP_006579426.1|  PREDICTED: uncharacterized protein LOC100799...    151   1e-42   
ref|XP_009777222.1|  PREDICTED: glutathione S-transferase T1-like       151   1e-42   Nicotiana sylvestris
gb|AET05003.2|  glutathione S-transferase, amino-terminal domain ...    151   1e-42   Medicago truncatula
ref|XP_003630527.1|  Glutathione S-transferase theta                    151   1e-42   
gb|KHN23653.1|  Glutathione S-transferase T1                            151   2e-42   Glycine soja [wild soybean]
ref|XP_006579425.1|  PREDICTED: uncharacterized protein LOC100799...    151   2e-42   
ref|XP_006360687.1|  PREDICTED: glutathione S-transferase T1-like       150   2e-42   Solanum tuberosum [potatoes]
ref|XP_010447179.1|  PREDICTED: glutathione S-transferase T1-like       149   5e-42   Camelina sativa [gold-of-pleasure]
gb|AHA46533.1|  theta class glutathione S-transferase                   149   5e-42   Larix kaempferi [karamatsu]
ref|NP_001242886.1|  uncharacterized protein LOC100799229               149   5e-42   
gb|ADE75690.1|  unknown                                                 149   7e-42   Picea sitchensis
ref|XP_010441287.1|  PREDICTED: glutathione S-transferase T1-like       147   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002509786.1|  glutathione-s-transferase theta, gst, putative     147   3e-41   Ricinus communis
ref|XP_010436071.1|  PREDICTED: glutathione S-transferase T1            147   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006282694.1|  hypothetical protein CARUB_v10005614mg             145   1e-40   Capsella rubella
dbj|BAB11100.1|  glutathione transferase                                145   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160051.1|  hypothetical protein PHAVU_002G288500g             145   2e-40   Phaseolus vulgaris [French bean]
ref|XP_009386057.1|  PREDICTED: glutathione S-transferase T1-like       144   3e-40   
emb|CDP22238.1|  unnamed protein product                                140   4e-40   Coffea canephora [robusta coffee]
emb|CAA10662.1|  glutathione transferase, GST 10b                       144   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002967178.1|  hypothetical protein SELMODRAFT_144252             145   4e-40   Selaginella moellendorffii
ref|XP_002960542.1|  hypothetical protein SELMODRAFT_74927              143   2e-39   
gb|AAF64449.1|AF239927_1  glutathione S-transferase                     141   5e-39   Euphorbia esula [wolf's milk]
ref|XP_001778018.1|  predicted protein                                  142   6e-39   
ref|NP_198940.3|  glutathione S-transferase THETA 2                     147   6e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AFV96155.1|  glutathion-S-transferase theta                          137   8e-38   Brassica oleracea
ref|NP_198938.1|  glutathione S-transferase THETA 3                     142   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966830.1|  hypothetical protein SELMODRAFT_144283             136   5e-37   Selaginella moellendorffii
ref|XP_002961176.1|  hypothetical protein SELMODRAFT_270213             135   8e-37   Selaginella moellendorffii
ref|XP_009774395.1|  PREDICTED: glutathione S-transferase T1-like       128   1e-34   Nicotiana sylvestris
gb|KJB52085.1|  hypothetical protein B456_008G246200                    125   1e-34   Gossypium raimondii
ref|XP_002960536.1|  hypothetical protein SELMODRAFT_402877             124   2e-32   
ref|XP_002967183.1|  hypothetical protein SELMODRAFT_407994             124   2e-32   
ref|XP_008794198.1|  PREDICTED: glutathione S-transferase T1 isof...    124   3e-32   
ref|XP_010676472.1|  PREDICTED: glutathione S-transferase T1-like       121   2e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|ACI16511.1|  glutathione S-transferase                               118   1e-30   Cucumis sativus [cucumbers]
gb|KJB52088.1|  hypothetical protein B456_008G246300                    119   2e-30   Gossypium raimondii
ref|XP_006822345.1|  PREDICTED: glutathione S-transferase theta-1...    118   4e-30   Saccoglossus kowalevskii
ref|XP_002509787.1|  glutathione-s-transferase theta, gst, putative     115   5e-29   
ref|XP_004503732.1|  PREDICTED: tRNA 2'-phosphotransferase 1-like...    114   6e-28   
ref|XP_010573725.1|  PREDICTED: glutathione S-transferase theta-1...    112   8e-28   Haliaeetus leucocephalus
ref|XP_001767888.1|  predicted protein                                  112   9e-28   
gb|AFZ39143.1|  theta class glutathione S-transferase                   112   1e-27   Physcomitrella patens
gb|KJB25825.1|  hypothetical protein B456_004G211100                    111   2e-27   Gossypium raimondii
ref|XP_008678005.1|  PREDICTED: glutathione S-transferase T1-like       110   3e-27   Zea mays [maize]
ref|XP_005054826.1|  PREDICTED: glutathione S-transferase theta-1...    111   3e-27   Ficedula albicollis
ref|XP_010396446.1|  PREDICTED: glutathione S-transferase theta-1...    110   4e-27   Corvus cornix cornix
ref|XP_002200008.1|  PREDICTED: glutathione S-transferase theta-1...    110   6e-27   Taeniopygia guttata
ref|XP_005524538.1|  PREDICTED: glutathione S-transferase theta-1...    110   7e-27   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005023587.1|  PREDICTED: glutathione S-transferase theta-1...    108   2e-26   Anas platyrhynchos [duck]
ref|XP_009090481.1|  PREDICTED: glutathione S-transferase theta-1...    108   3e-26   Serinus canaria [canary]
ref|XP_010718625.1|  PREDICTED: glutathione S-transferase theta-1...    108   4e-26   Meleagris gallopavo [common turkey]
ref|XP_008500992.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    108   4e-26   Calypte anna
ref|XP_005848771.1|  hypothetical protein CHLNCDRAFT_57549              107   6e-26   Chlorella variabilis
ref|XP_007973333.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    106   1e-25   Chlorocebus sabaeus
gb|EWS75951.1|  glutathione S-transferase, amine-terminal domain ...    105   2e-25   Tetrahymena thermophila SB210
ref|XP_005147828.1|  PREDICTED: glutathione S-transferase theta-1...    106   2e-25   Melopsittacus undulatus
gb|KFO57915.1|  Glutathione S-transferase theta-1                       105   3e-25   Corvus brachyrhynchos
gb|ABQ82132.1|  glutathione S-transferase theta                         105   3e-25   Alitta succinea
ref|XP_008630325.1|  PREDICTED: glutathione S-transferase theta-1...    105   3e-25   Corvus brachyrhynchos
ref|XP_006584714.1|  PREDICTED: glutathione S-transferase T2-like...    105   4e-25   Glycine max [soybeans]
ref|XP_003919135.1|  PREDICTED: glutathione S-transferase theta-2B      105   5e-25   Papio anubis [baboon]
ref|XP_007451118.1|  PREDICTED: glutathione S-transferase theta-1...    105   6e-25   Lipotes vexillifer [baiji]
ref|XP_004742534.1|  PREDICTED: glutathione S-transferase theta-1...    104   8e-25   Mustela putorius furo [black ferret]
ref|XP_005503935.1|  PREDICTED: glutathione S-transferase theta-1...    104   9e-25   Columba livia [carrier pigeon]
ref|XP_001231971.3|  PREDICTED: glutathione S-transferase theta-1...    105   1e-24   
gb|AHC08064.1|  theta glutathione S-transferase                         103   1e-24   Locusta migratoria
ref|XP_001106693.1|  PREDICTED: glutathione S-transferase theta-2...    103   2e-24   Macaca mulatta [rhesus macaque]
gb|EHH62577.1|  hypothetical protein EGM_20970                          103   2e-24   Macaca fascicularis [crab eating macaque]
ref|XP_001106578.1|  PREDICTED: glutathione S-transferase theta-2...    103   2e-24   
ref|NP_001244563.1|  glutathione S-transferase theta 2                  103   2e-24   Macaca mulatta [rhesus macaque]
gb|EHH16568.1|  hypothetical protein EGK_11862                          103   2e-24   Macaca mulatta [rhesus macaque]
ref|XP_007957332.1|  PREDICTED: glutathione S-transferase theta-1...    103   2e-24   Orycteropus afer afer
ref|XP_004742533.1|  PREDICTED: glutathione S-transferase theta-1...    103   4e-24   
gb|KGL79187.1|  Glutathione S-transferase theta-1                       102   4e-24   Tinamus guttatus
ref|XP_004636372.1|  PREDICTED: glutathione S-transferase theta-1...    102   4e-24   Octodon degus
ref|XP_007092374.1|  PREDICTED: glutathione S-transferase theta-1...    102   5e-24   Panthera tigris altaica
ref|XP_003994893.1|  PREDICTED: glutathione S-transferase theta-1...    102   5e-24   Felis catus [cat]
ref|XP_004680982.1|  PREDICTED: glutathione S-transferase theta-1...    102   6e-24   
ref|XP_004346352.1|  glutathione S-transferase domain-containing ...    102   6e-24   Capsaspora owczarzaki ATCC 30864
ref|XP_004607625.1|  PREDICTED: glutathione S-transferase theta-1...    102   6e-24   Sorex araneus [Eurasian shrew]
ref|XP_790223.2|  PREDICTED: glutathione S-transferase theta-1-like     102   6e-24   Strongylocentrotus purpuratus [purple urchin]
ref|XP_005334523.1|  PREDICTED: glutathione S-transferase theta-2...    102   7e-24   Ictidomys tridecemlineatus
ref|XP_006746108.1|  PREDICTED: glutathione S-transferase theta-1...    102   7e-24   Leptonychotes weddellii
ref|XP_003639976.1|  PREDICTED: glutathione S-transferase theta-1...    102   7e-24   Canis lupus familiaris [dogs]
ref|XP_010953752.1|  PREDICTED: glutathione S-transferase theta-2...    100   1e-23   Camelus bactrianus [camel]
ref|XP_004400592.1|  PREDICTED: glutathione S-transferase theta-1...    101   1e-23   Odobenus rosmarus divergens
ref|XP_010215724.1|  PREDICTED: glutathione S-transferase theta-1...    102   1e-23   Tinamus guttatus
gb|ELK15601.1|  Glutathione S-transferase theta-1                       101   1e-23   Pteropus alecto
ref|XP_004063210.1|  PREDICTED: glutathione S-transferase theta-2...    101   1e-23   
gb|AFW60455.1|  hypothetical protein ZEAMMB73_761144                    102   1e-23   
ref|XP_004063211.1|  PREDICTED: glutathione S-transferase theta-2...    101   1e-23   Gorilla gorilla gorilla [lowland gorilla]
pdb|4MPG|A  Chain A, Crystal Structure Of Human Glutathione Trans...    101   1e-23   Homo sapiens [man]
ref|XP_006908737.1|  PREDICTED: glutathione S-transferase theta-1...    101   2e-23   Pteropus alecto
ref|XP_003730181.1|  PREDICTED: glutathione S-transferase theta-1...    100   2e-23   Strongylocentrotus purpuratus [purple urchin]
pdb|4MPF|A  Chain A, Crystal Structure Of Human Glutathione Trans...    101   2e-23   Homo sapiens [man]
ref|XP_002834662.1|  PREDICTED: glutathione S-transferase theta-2B      101   2e-23   Pongo abelii [orang utan]
ref|NP_000845.2|  glutathione S-transferase theta-2 isoform a           100   2e-23   Homo sapiens [man]
ref|NP_001074312.1|  glutathione S-transferase theta-2B                 100   2e-23   Homo sapiens [man]
ref|XP_005261772.1|  PREDICTED: glutathione S-transferase theta-2...    100   2e-23   
gb|AEW26632.1|  GSTT2                                                   100   2e-23   Homo sapiens [man]
ref|XP_010953754.1|  PREDICTED: glutathione S-transferase theta-2...    100   2e-23   Camelus bactrianus [camel]
gb|AAV38755.1|  glutathione S-transferase theta 2                       100   2e-23   synthetic construct
gb|AAC13317.1|  glutathione S-transferase theta 2                       100   2e-23   Homo sapiens [man]
ref|XP_008825395.1|  PREDICTED: glutathione S-transferase theta-1...  98.2    2e-23   
ref|NP_001289599.1|  glutathione S-transferase theta-2 isoform b        100   2e-23   Homo sapiens [man]
ref|XP_010985617.1|  PREDICTED: glutathione S-transferase theta-1...    100   2e-23   Camelus dromedarius [camel]
ref|XP_004466458.1|  PREDICTED: glutathione S-transferase theta-1...    100   2e-23   Dasypus novemcinctus
ref|XP_006106312.1|  PREDICTED: glutathione S-transferase theta-1...    100   2e-23   Myotis lucifugus
gb|EHH25431.1|  hypothetical protein EGK_21202                          100   3e-23   Macaca mulatta [rhesus macaque]
ref|XP_004443156.1|  PREDICTED: glutathione S-transferase theta-1...    100   3e-23   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005987168.1|  PREDICTED: glutathione S-transferase theta-1...    100   3e-23   
ref|XP_003811115.1|  PREDICTED: glutathione S-transferase theta-2...    100   3e-23   Pan paniscus [bonobo]
ref|XP_515243.2|  PREDICTED: glutathione S-transferase theta-2          100   3e-23   
ref|XP_009006212.1|  PREDICTED: glutathione S-transferase theta-1...    100   3e-23   Callithrix jacchus [common marmoset]
gb|AEW26633.1|  GSTT2B                                                  100   3e-23   Pan troglodytes
gb|AEW26637.1|  GSTT2B                                                  100   3e-23   Pan troglodytes
ref|XP_003727085.1|  PREDICTED: glutathione S-transferase theta-1...    100   3e-23   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003811116.1|  PREDICTED: glutathione S-transferase theta-2...    100   3e-23   Pan paniscus [bonobo]
ref|XP_001929409.1|  PREDICTED: glutathione S-transferase theta-1...    100   3e-23   
ref|XP_005396465.1|  PREDICTED: glutathione S-transferase theta-1...    100   3e-23   Chinchilla lanigera
ref|XP_006130307.1|  PREDICTED: glutathione S-transferase theta-1...    100   3e-23   
ref|XP_005987166.1|  PREDICTED: glutathione S-transferase theta-1...    100   3e-23   Latimeria chalumnae
emb|CAA66665.1|  glutathione S-transferase theta                        100   3e-23   Mus musculus [mouse]
ref|XP_007127246.1|  PREDICTED: glutathione S-transferase theta-1...    100   3e-23   Physeter catodon
ref|XP_007196373.1|  PREDICTED: glutathione S-transferase theta-1...    100   4e-23   Balaenoptera acutorostrata scammoni
dbj|BAB22023.1|  unnamed protein product                                100   4e-23   Mus musculus [mouse]
ref|XP_006277068.1|  PREDICTED: glutathione S-transferase theta-1...    100   4e-23   Alligator mississippiensis
ref|NP_032211.3|  glutathione S-transferase theta-1                     100   4e-23   Mus musculus [mouse]
emb|CAG33210.1|  GSTT2                                                  100   4e-23   Homo sapiens [man]
ref|XP_006019954.1|  PREDICTED: glutathione S-transferase theta-1...    100   4e-23   Alligator sinensis
ref|XP_004318777.1|  PREDICTED: glutathione S-transferase theta-1...    100   4e-23   
dbj|BAG34980.1|  unnamed protein product                                100   4e-23   Homo sapiens [man]
gb|ADO27893.1|  glutathione S-transferase theta-1                       100   4e-23   Ictalurus furcatus
ref|XP_008248398.1|  PREDICTED: glutathione S-transferase theta-1...  99.4    4e-23   
ref|XP_006640254.1|  PREDICTED: glutathione S-transferase theta-1...  99.8    4e-23   Lepisosteus oculatus
ref|XP_008248399.1|  PREDICTED: glutathione S-transferase theta-1...  99.0    5e-23   
gb|AAB03534.1|  glutathione transferase theta class type 2            99.8    6e-23   Mus musculus [mouse]
ref|XP_005886352.1|  PREDICTED: glutathione S-transferase theta-1...  99.8    6e-23   Myotis brandtii
ref|XP_006157221.1|  PREDICTED: glutathione S-transferase theta-1...  99.4    7e-23   Tupaia chinensis
ref|XP_005334521.1|  PREDICTED: glutathione S-transferase theta-1...  99.4    7e-23   Ictidomys tridecemlineatus
ref|NP_034491.2|  glutathione S-transferase theta-2                   99.4    7e-23   Mus musculus [mouse]
ref|XP_797684.3|  PREDICTED: glutathione S-transferase theta-1-like   99.0    8e-23   Strongylocentrotus purpuratus [purple urchin]
gb|EMP32140.1|  Glutathione S-transferase theta-1                       100   9e-23   Chelonia mydas [green seaturtle]
ref|NP_001131115.1|  glutathione S-transferase, theta 3               98.6    9e-23   Rattus norvegicus [brown rat]
ref|XP_797671.3|  PREDICTED: glutathione S-transferase theta-1-like   99.0    9e-23   Strongylocentrotus purpuratus [purple urchin]
ref|XP_001489453.1|  PREDICTED: glutathione S-transferase theta-1...  99.0    1e-22   Equus caballus [domestic horse]
gb|KFV63272.1|  Glutathione S-transferase theta-1                     98.6    1e-22   Picoides pubescens
ref|XP_006874993.1|  PREDICTED: glutathione S-transferase theta-1...  98.6    1e-22   Chrysochloris asiatica
ref|NP_036928.1|  glutathione S-transferase theta-2                   98.6    1e-22   Rattus norvegicus [brown rat]
gb|AEB91980.1|  glutathione S-transferase theta 1                     98.6    1e-22   Locusta migratoria
ref|NP_445745.1|  glutathione S-transferase theta-1                   98.6    2e-22   Rattus norvegicus [brown rat]
ref|XP_008838833.1|  PREDICTED: glutathione S-transferase theta-1...  98.6    2e-22   Nannospalax galili
ref|XP_003803344.1|  PREDICTED: glutathione S-transferase theta-1...  98.6    2e-22   Otolemur garnettii
ref|NP_001279515.1|  glutathione S-transferase theta-1-like           98.2    2e-22   Callorhinchus milii [Australian ghost shark]
ref|XP_006213357.1|  PREDICTED: glutathione S-transferase theta-1...  98.2    2e-22   Vicugna pacos
ref|XP_780137.3|  PREDICTED: glutathione S-transferase theta-1-like   98.2    2e-22   Strongylocentrotus purpuratus [purple urchin]
ref|XP_008566801.1|  PREDICTED: glutathione S-transferase theta-1...  98.2    2e-22   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006600192.1|  PREDICTED: uncharacterized protein LOC100795...  99.0    2e-22   Glycine max [soybeans]
ref|XP_003485831.1|  PREDICTED: glutathione S-transferase theta-1...  98.2    2e-22   
ref|XP_004085257.1|  PREDICTED: glutathione S-transferase theta-1...  97.8    3e-22   Oryzias latipes [Japanese rice fish]
ref|XP_008066996.1|  PREDICTED: glutathione S-transferase theta-2...  97.8    3e-22   Carlito syrichta
ref|XP_007063803.1|  PREDICTED: glutathione S-transferase theta-1...  97.8    3e-22   Chelonia mydas [green seaturtle]
ref|XP_005288627.1|  PREDICTED: glutathione S-transferase theta-1...  97.8    3e-22   Chrysemys picta bellii
ref|XP_007520872.1|  PREDICTED: glutathione S-transferase theta-1...  97.8    3e-22   Erinaceus europaeus [common hedgehog]
ref|XP_003282572.1|  PREDICTED: glutathione S-transferase theta-2...  97.8    3e-22   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004742539.1|  PREDICTED: glutathione S-transferase theta-1...  96.7    3e-22   Mustela putorius furo [black ferret]
ref|NP_001187546.1|  glutathione S-transferase theta-1                97.8    3e-22   Ictalurus punctatus
gb|AEW26630.1|  GSTT2                                                 97.8    3e-22   Homo sapiens [man]
ref|XP_008794199.1|  PREDICTED: glutathione S-transferase T1 isof...  97.1    3e-22   
ref|XP_010368118.1|  PREDICTED: glutathione S-transferase theta-1...  97.8    3e-22   Rhinopithecus roxellana
ref|XP_003282573.1|  PREDICTED: glutathione S-transferase theta-2...  97.4    3e-22   Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001241038.1|  uncharacterized protein LOC100795797             98.6    3e-22   Glycine max [soybeans]
ref|XP_006768810.1|  PREDICTED: glutathione S-transferase theta-1...  97.8    3e-22   Myotis davidii
ref|XP_005595439.1|  PREDICTED: glutathione S-transferase theta-1...  97.4    4e-22   
ref|XP_005334522.1|  PREDICTED: glutathione S-transferase theta-1...  97.4    4e-22   Ictidomys tridecemlineatus
gb|AFO69981.1|  GST_theta-like protein                                97.4    4e-22   Strongylocentrotus droebachiensis
ref|XP_005070806.1|  PREDICTED: glutathione S-transferase theta-1...  97.4    4e-22   Mesocricetus auratus [Syrian golden hamster]
ref|XP_001089367.1|  PREDICTED: glutathione S-transferase theta-1...  97.4    4e-22   
gb|AHH29313.1|  glutathione S-transferase T1                          97.4    4e-22   Macaca fascicularis [crab eating macaque]
ref|XP_003919137.1|  PREDICTED: glutathione S-transferase theta-1...  97.4    4e-22   Papio anubis [baboon]
ref|XP_003419175.1|  PREDICTED: glutathione S-transferase theta-1...  97.4    4e-22   Loxodonta africana [African bush elephant]
ref|XP_006513055.1|  PREDICTED: glutathione S-transferase, theta ...  96.7    4e-22   
ref|XP_007973334.1|  PREDICTED: glutathione S-transferase theta-1     97.4    4e-22   Chlorocebus sabaeus
ref|NP_956815.1|  glutathione S-transferase theta-like                97.4    4e-22   
gb|EFB19466.1|  hypothetical protein PANDA_014538                     94.4    4e-22   
ref|XP_002605845.1|  hypothetical protein BRAFLDRAFT_123804           97.1    4e-22   
ref|XP_006140270.1|  PREDICTED: glutathione S-transferase theta-1...  94.4    4e-22   
ref|XP_001864150.1|  glutathione-s-transferase theta, gst             97.1    5e-22   
ref|XP_004276138.1|  PREDICTED: glutathione S-transferase theta-1...  97.1    5e-22   
ref|XP_002931957.2|  PREDICTED: glutathione S-transferase theta-1     97.1    5e-22   
ref|XP_008155438.1|  PREDICTED: glutathione S-transferase theta-1     97.1    5e-22   
ref|NP_001290604.1|  glutathione S-transferase theta-1                97.1    6e-22   
ref|XP_008566800.1|  PREDICTED: glutathione S-transferase theta-1...  98.2    6e-22   
ref|XP_003508143.1|  PREDICTED: glutathione S-transferase theta-1     97.1    6e-22   
gb|AII00841.1|  glutathione S-transferase theta 1                     97.1    6e-22   
ref|XP_006874994.1|  PREDICTED: glutathione S-transferase theta-1...  97.1    6e-22   
ref|XP_010602224.1|  PREDICTED: glutathione S-transferase theta-1...  97.1    6e-22   
ref|XP_005360258.1|  PREDICTED: glutathione S-transferase theta-1...  97.1    6e-22   
ref|XP_004742538.1|  PREDICTED: glutathione S-transferase theta-1...  97.1    6e-22   
ref|XP_534751.3|  PREDICTED: glutathione S-transferase theta-1        97.1    6e-22   
ref|XP_797660.1|  PREDICTED: glutathione S-transferase theta-1-like   96.7    6e-22   
gb|AAH87825.1|  gstt1-prov protein                                    97.1    6e-22   
ref|XP_005288626.1|  PREDICTED: glutathione S-transferase theta-1...  97.1    7e-22   
ref|XP_003397510.1|  PREDICTED: glutathione S-transferase theta-1...  96.7    7e-22   
gb|ELR52175.1|  Glutathione S-transferase theta-1                     96.7    7e-22   
gb|AEW26636.1|  GSTT2B                                                97.1    7e-22   
ref|XP_780216.3|  PREDICTED: glutathione S-transferase theta-1-like   96.7    7e-22   
ref|XP_006048173.1|  PREDICTED: glutathione S-transferase theta-1...  96.7    8e-22   
ref|XP_002830963.1|  PREDICTED: glutathione S-transferase theta-1...  96.7    8e-22   
ref|XP_009062390.1|  hypothetical protein LOTGIDRAFT_207042           96.3    8e-22   
ref|XP_007092375.1|  PREDICTED: glutathione S-transferase theta-1...  96.7    9e-22   
ref|XP_003994894.3|  PREDICTED: glutathione S-transferase theta-1     96.7    9e-22   
ref|XP_005360257.1|  PREDICTED: glutathione S-transferase theta-1...  97.1    9e-22   
ref|XP_003478005.2|  PREDICTED: glutathione S-transferase theta-1...  96.3    9e-22   
ref|NP_598755.1|  glutathione S-transferase, theta 3                  96.3    9e-22   
ref|XP_005901647.1|  PREDICTED: glutathione S-transferase theta-1...  96.3    1e-21   
gb|AAH62201.1|  Glutathione S-transferase, theta 3                    96.3    1e-21   
ref|XP_010909099.1|  PREDICTED: glutathione S-transferase T1 isof...  95.5    1e-21   
ref|NP_001069206.1|  glutathione S-transferase theta-2                96.3    1e-21   
ref|XP_008066997.1|  PREDICTED: glutathione S-transferase theta-1     96.3    1e-21   
ref|XP_003938575.1|  PREDICTED: glutathione S-transferase theta-1...  96.3    1e-21   
ref|XP_008122745.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...  96.7    1e-21   
ref|XP_004681155.1|  PREDICTED: glutathione S-transferase theta-1...  96.3    1e-21   
ref|XP_006979147.1|  PREDICTED: glutathione S-transferase theta-1...  96.3    1e-21   
ref|XP_008566796.1|  PREDICTED: glutathione S-transferase theta-2...  96.3    1e-21   
ref|XP_004887553.1|  PREDICTED: glutathione S-transferase theta-1...  95.9    1e-21   
ref|XP_004843627.1|  PREDICTED: glutathione S-transferase theta-1...  95.9    1e-21   
ref|XP_007646923.1|  PREDICTED: glutathione S-transferase theta-1     95.9    1e-21   
gb|AFJ75807.1|  glutathione s-transferase T1                          95.9    1e-21   
gb|EHH61703.1|  hypothetical protein EGM_19746                        95.9    1e-21   
ref|XP_004017553.1|  PREDICTED: glutathione S-transferase theta-1...  95.9    2e-21   
ref|XP_005360260.1|  PREDICTED: glutathione S-transferase theta-2...  95.9    2e-21   
emb|CDW81275.1|  glutathione s-transferase theta-1                    95.5    2e-21   
ref|XP_005959724.1|  PREDICTED: glutathione S-transferase theta-1...  95.5    2e-21   
ref|XP_003508145.1|  PREDICTED: glutathione S-transferase theta-2     95.9    2e-21   
ref|XP_005691800.1|  PREDICTED: glutathione S-transferase theta-1...  95.5    2e-21   
ref|XP_005396466.1|  PREDICTED: glutathione S-transferase theta-1...  95.5    2e-21   
ref|XP_003803343.1|  PREDICTED: glutathione S-transferase theta-1...  95.5    2e-21   
ref|XP_004607626.1|  PREDICTED: glutathione S-transferase theta-1...  95.5    2e-21   
ref|XP_007657957.1|  PREDICTED: glutathione S-transferase theta-1...  95.5    2e-21   
ref|XP_007063835.1|  PREDICTED: glutathione S-transferase theta-1...  95.5    2e-21   
ref|XP_008248397.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...  95.5    2e-21   
emb|CDQ72597.1|  unnamed protein product                              95.1    3e-21   
ref|XP_006213356.1|  PREDICTED: glutathione S-transferase theta-1...  95.1    3e-21   
emb|CDQ65962.1|  unnamed protein product                              94.7    3e-21   
gb|AHH29314.1|  glutathione S-transferase T1                          95.1    3e-21   
ref|XP_007906035.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...  95.1    3e-21   
gb|EJY66553.1|  hypothetical protein OXYTRI_13160                     95.1    3e-21   
ref|XP_006746107.1|  PREDICTED: glutathione S-transferase theta-1...  95.1    3e-21   
ref|XP_780057.1|  PREDICTED: glutathione S-transferase theta-1-like   94.7    3e-21   
ref|XP_006997739.1|  PREDICTED: glutathione S-transferase theta-2...  94.7    4e-21   
ref|XP_003478006.2|  PREDICTED: glutathione S-transferase theta-1...  95.1    4e-21   
ref|XP_004466461.1|  PREDICTED: glutathione S-transferase theta-1...  94.7    4e-21   
ref|XP_004670993.1|  PREDICTED: glutathione S-transferase theta-2...  94.7    4e-21   
ref|XP_002925113.1|  PREDICTED: glutathione S-transferase theta-1...  94.7    4e-21   
gb|ACE81253.1|  glutathione S-transferase theta 1                     94.4    4e-21   
ref|XP_011354287.1|  PREDICTED: glutathione S-transferase theta-1...  94.7    4e-21   
ref|XP_006908738.1|  PREDICTED: glutathione S-transferase theta-1...  94.7    4e-21   
ref|XP_004400589.1|  PREDICTED: glutathione S-transferase theta-1...  94.7    4e-21   
ref|XP_004063215.1|  PREDICTED: glutathione S-transferase theta-1     94.7    4e-21   
ref|NP_000844.2|  glutathione S-transferase theta-1 isoform a         94.7    4e-21   
ref|NP_001085203.1|  glutathione S-transferase theta 1                94.7    5e-21   
ref|XP_008695752.1|  PREDICTED: glutathione S-transferase theta-1...  94.7    5e-21   
gb|AAV38754.1|  glutathione S-transferase theta 1                     94.7    5e-21   
ref|XP_008961689.1|  PREDICTED: glutathione S-transferase theta-1...  94.7    5e-21   
pdb|2C3Q|A  Chain A, Human Glutathione-S-Transferase T1-1 W234r M...  94.7    5e-21   
ref|XP_002722606.1|  PREDICTED: glutathione S-transferase theta-2...  94.7    5e-21   
pdb|2C3N|A  Chain A, Human Glutathione-S-Transferase T1-1, Apo Form   94.7    5e-21   
emb|CAA55935.1|  glutathione transferase T1                           94.4    5e-21   
ref|XP_005815453.1|  PREDICTED: glutathione S-transferase theta-1...  92.0    5e-21   
gb|KCW77543.1|  hypothetical protein EUGRSUZ_D01861                   94.0    6e-21   
ref|XP_004466459.1|  PREDICTED: glutathione S-transferase theta-1...  94.4    6e-21   
ref|XP_010985616.1|  PREDICTED: glutathione S-transferase theta-1     94.4    6e-21   
gb|ACI34093.1|  Glutathione S-transferase theta-1                     94.0    7e-21   
ref|XP_004592181.1|  PREDICTED: glutathione S-transferase theta-1...  94.4    7e-21   
gb|EPQ20308.1|  Glutathione S-transferase theta-1                     91.3    7e-21   
gb|ACO09513.1|  Glutathione S-transferase theta-1                     93.6    8e-21   
ref|XP_004887549.1|  PREDICTED: glutathione S-transferase theta-1...  94.0    8e-21   
gb|ACI66391.1|  Glutathione S-transferase theta-1                     94.0    8e-21   
ref|XP_004887550.1|  PREDICTED: glutathione S-transferase theta-1...  93.6    8e-21   
ref|XP_005070805.1|  PREDICTED: glutathione S-transferase theta-1...  94.0    9e-21   
ref|XP_001929405.1|  PREDICTED: glutathione S-transferase theta-1     94.0    9e-21   
gb|EHB04747.1|  Glutathione S-transferase theta-1                     93.6    9e-21   
ref|XP_008831398.1|  PREDICTED: glutathione S-transferase theta-4     93.6    9e-21   
ref|XP_004887554.1|  PREDICTED: glutathione S-transferase theta-1...  93.6    1e-20   
ref|XP_006640322.1|  PREDICTED: glutathione S-transferase theta-1...  93.6    1e-20   
ref|XP_002157119.2|  PREDICTED: glutathione S-transferase T1-like     93.2    1e-20   
ref|XP_010953749.1|  PREDICTED: glutathione S-transferase theta-1...  94.0    1e-20   
ref|XP_006640321.1|  PREDICTED: glutathione S-transferase theta-1...  93.6    1e-20   
ref|XP_004716394.1|  PREDICTED: glutathione S-transferase theta-1...  93.2    1e-20   
ref|XP_004670992.1|  PREDICTED: glutathione S-transferase theta-1...  93.2    1e-20   
ref|NP_001006811.1|  glutathione S-transferase theta 1                93.2    2e-20   
gb|ABY83769.1|  glutathione S-transferase theta                       93.2    2e-20   
ref|XP_004742536.1|  PREDICTED: glutathione S-transferase theta-1...  92.0    2e-20   
ref|XP_004607499.1|  PREDICTED: glutathione S-transferase theta-2...  93.2    2e-20   
ref|XP_010602226.1|  PREDICTED: glutathione S-transferase theta-1...  92.8    2e-20   
ref|XP_007092376.1|  PREDICTED: glutathione S-transferase theta-1...  92.8    2e-20   
ref|XP_010003090.1|  PREDICTED: glutathione S-transferase theta-1...  92.8    2e-20   
gb|KFO23710.1|  Calcineurin-binding protein cabin-1                   97.1    2e-20   
ref|XP_006938700.1|  PREDICTED: glutathione S-transferase theta-1...  92.8    2e-20   
ref|XP_011332867.1|  PREDICTED: glutathione S-transferase theta-1...  92.4    2e-20   
ref|XP_011241675.1|  PREDICTED: glutathione S-transferase theta-2...  92.8    3e-20   
ref|NP_001103145.1|  glutathione S-transferase theta-4                92.4    3e-20   
ref|XP_010858349.1|  PREDICTED: glutathione S-transferase theta-1...  92.4    3e-20   
ref|XP_004337203.1|  glutathione Stransferase, C-terminal domain ...  92.8    3e-20   
ref|XP_004386220.1|  PREDICTED: glutathione S-transferase theta-4...  92.4    3e-20   
ref|XP_006048174.1|  PREDICTED: glutathione S-transferase theta-1...  92.4    3e-20   
ref|XP_008695753.1|  PREDICTED: glutathione S-transferase theta-1...  92.4    3e-20   
ref|XP_006106314.1|  PREDICTED: glutathione S-transferase theta-2...  92.4    3e-20   
ref|XP_004742535.1|  PREDICTED: glutathione S-transferase theta-1...  92.0    4e-20   
ref|XP_006901485.1|  PREDICTED: glutathione S-transferase theta-4...  92.0    4e-20   
ref|XP_001195869.2|  PREDICTED: glutathione S-transferase theta-1...  91.7    4e-20   
ref|XP_002463456.1|  hypothetical protein SORBIDRAFT_01g000230        91.3    4e-20   
ref|XP_008695826.1|  PREDICTED: glutathione S-transferase theta-1...  92.0    4e-20   
ref|NP_001039697.1|  glutathione S-transferase theta-1                92.0    5e-20   
ref|XP_006514334.1|  PREDICTED: glutathione S-transferase theta-4...  91.3    5e-20   
ref|XP_003419170.1|  PREDICTED: glutathione S-transferase theta-4     91.7    5e-20   
gb|KJB25826.1|  hypothetical protein B456_004G211200                  88.6    6e-20   
gb|KFM78123.1|  Glutathione S-transferase theta-1                     91.3    6e-20   
ref|XP_006822361.1|  PREDICTED: glutathione S-transferase theta-1...  90.9    6e-20   
ref|XP_006140272.1|  PREDICTED: glutathione S-transferase theta-1...  91.7    6e-20   
ref|XP_003508144.1|  PREDICTED: glutathione S-transferase theta-4     91.3    7e-20   
ref|XP_003281783.1|  PREDICTED: glutathione S-transferase theta-1...  91.3    7e-20   
ref|XP_007578350.1|  PREDICTED: glutathione S-transferase theta-1...  91.3    7e-20   
ref|XP_004817175.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...  91.3    7e-20   
ref|XP_006140271.1|  PREDICTED: glutathione S-transferase theta-4...  91.3    7e-20   
gb|AAX29474.1|  glutathione S-transferase theta 1                     91.3    7e-20   
ref|XP_006997738.1|  PREDICTED: glutathione S-transferase theta-4...  91.3    7e-20   
ref|XP_011430263.1|  PREDICTED: glutathione S-transferase theta-1...  91.3    8e-20   
ref|XP_006663010.1|  PREDICTED: glutathione S-transferase T1-like     90.5    8e-20   
gb|AAH07065.1|  Glutathione S-transferase theta 1                     91.3    8e-20   
ref|XP_005360259.1|  PREDICTED: glutathione S-transferase theta-4...  91.3    8e-20   
ref|XP_003478004.2|  PREDICTED: glutathione S-transferase theta-2     91.3    8e-20   
ref|XP_006901484.1|  PREDICTED: glutathione S-transferase theta-2...  91.3    9e-20   
ref|NP_083748.3|  glutathione S-transferase theta-4                   91.3    9e-20   
ref|XP_003433484.1|  PREDICTED: glutathione S-transferase theta-2...  90.9    1e-19   
ref|XP_010858265.1|  PREDICTED: glutathione S-transferase theta-4...  90.9    1e-19   
ref|XP_004400591.1|  PREDICTED: glutathione S-transferase theta-1...  90.9    1e-19   
ref|XP_004443158.1|  PREDICTED: glutathione S-transferase theta-2...  90.9    1e-19   
ref|NP_956878.1|  glutathione S-transferase theta 1b                  90.9    1e-19   
ref|XP_006768808.1|  PREDICTED: glutathione S-transferase theta-2...  90.9    1e-19   
ref|XP_005886381.1|  PREDICTED: glutathione S-transferase theta-1...  91.3    1e-19   
ref|XP_002925099.1|  PREDICTED: glutathione S-transferase theta-1     90.5    1e-19   
ref|XP_011400420.1|  Glutathione S-transferase theta-2B               94.0    1e-19   
ref|XP_005070804.1|  PREDICTED: glutathione S-transferase theta-4...  90.5    2e-19   
ref|XP_008400753.1|  PREDICTED: glutathione S-transferase theta-1...  90.1    2e-19   
gb|AAB03533.1|  theta class glutathione transferase type 2            90.5    2e-19   
ref|XP_006874995.1|  PREDICTED: glutathione S-transferase theta-4...  90.1    2e-19   
gb|EHB04748.1|  Glutathione S-transferase theta-1                     90.5    2e-19   
ref|XP_002115679.1|  hypothetical protein TRIADDRAFT_59619            90.1    2e-19   
ref|XP_011354281.1|  PREDICTED: glutathione S-transferase theta-4...  90.5    2e-19   
ref|XP_006901483.1|  PREDICTED: glutathione S-transferase theta-2...  90.1    2e-19   
ref|XP_004742540.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...  90.9    2e-19   
ref|XP_006121722.1|  PREDICTED: glutathione S-transferase theta-1...  90.1    2e-19   
ref|XP_007533707.1|  PREDICTED: glutathione S-transferase theta-2...  90.1    2e-19   
ref|XP_002115221.1|  expressed hypothetical protein                   89.7    2e-19   
ref|XP_011354285.1|  PREDICTED: glutathione S-transferase theta-4...  90.1    2e-19   
ref|XP_006908736.1|  PREDICTED: glutathione S-transferase theta-4...  90.1    2e-19   
gb|ABD67512.1|  glutathione S-transferase theta                       88.6    2e-19   
ref|XP_316865.2|  AGAP000888-PA                                       89.7    2e-19   
gb|ELT90456.1|  hypothetical protein CAPTEDRAFT_173236                89.7    2e-19   
ref|XP_008248403.1|  PREDICTED: glutathione S-transferase theta-4...  89.4    3e-19   
gb|KDR15740.1|  Glutathione S-transferase theta-1                     89.7    3e-19   
ref|XP_006768844.1|  PREDICTED: glutathione S-transferase theta-1...  89.7    3e-19   
ref|XP_005167246.1|  PREDICTED: glutathione S-transferase theta-1...  88.6    3e-19   
emb|CDW75647.1|  glutathione s-transferase domain-containing protein  89.7    3e-19   
ref|XP_002925112.1|  PREDICTED: glutathione S-transferase theta-1     89.4    4e-19   
ref|XP_008695757.1|  PREDICTED: glutathione S-transferase theta-2...  89.4    4e-19   
ref|XP_004592081.1|  PREDICTED: glutathione S-transferase theta-4...  89.4    4e-19   
ref|XP_001659668.2|  AAEL009016-PA                                    89.0    4e-19   
gb|ELK26410.1|  Glutathione S-transferase theta-1                     90.1    4e-19   
ref|XP_856971.3|  PREDICTED: glutathione S-transferase theta-1-li...  89.4    4e-19   
ref|XP_001369983.1|  PREDICTED: glutathione S-transferase theta-2...  89.4    5e-19   
ref|XP_008566799.1|  PREDICTED: glutathione S-transferase theta-4     89.0    5e-19   
ref|XP_003994895.1|  PREDICTED: glutathione S-transferase theta-4...  89.0    5e-19   
ref|XP_007490766.1|  PREDICTED: glutathione S-transferase theta-2...  89.4    5e-19   
ref|XP_003974574.1|  PREDICTED: glutathione S-transferase theta-1...  89.0    5e-19   
ref|XP_007092377.1|  PREDICTED: glutathione S-transferase theta-4...  89.0    5e-19   
gb|AAV68400.1|  glutathione S-transferase theta 2                     89.0    5e-19   
ref|XP_007127247.1|  PREDICTED: glutathione S-transferase theta-4...  89.0    6e-19   
ref|XP_007451117.1|  PREDICTED: glutathione S-transferase theta-4...  89.0    6e-19   
ref|XP_002722614.1|  PREDICTED: glutathione S-transferase theta-4...  89.0    6e-19   
ref|XP_010785251.1|  PREDICTED: glutathione S-transferase theta-1...  86.7    6e-19   
sp|A8MPT4.2|GSTT4_HUMAN  RecName: Full=Glutathione S-transferase ...  89.0    6e-19   
emb|CDW86738.1|  glutathione transferase 10                           89.0    6e-19   
ref|XP_007256601.1|  PREDICTED: glutathione S-transferase theta-1...  89.0    6e-19   
ref|XP_010875032.1|  PREDICTED: glutathione S-transferase theta-1...  88.6    6e-19   
ref|XP_006746430.1|  PREDICTED: glutathione S-transferase theta-4...  89.0    6e-19   
ref|XP_692427.1|  PREDICTED: glutathione S-transferase theta-1 is...  88.6    6e-19   
ref|XP_002113711.1|  expressed hypothetical protein                   88.6    6e-19   
ref|XP_008155437.1|  PREDICTED: glutathione S-transferase theta-1...  88.6    7e-19   
ref|XP_003230207.2|  PREDICTED: glutathione S-transferase theta-1...  89.0    8e-19   
ref|XP_003803342.1|  PREDICTED: glutathione S-transferase theta-4...  88.6    8e-19   
ref|XP_010748941.1|  PREDICTED: glutathione S-transferase theta-1...  88.6    8e-19   
gb|EJY80586.1|  Glutathione S-transferase                             88.6    8e-19   
ref|XP_005886350.1|  PREDICTED: glutathione S-transferase theta-2...  88.6    9e-19   
ref|XP_002925097.1|  PREDICTED: glutathione S-transferase theta-2B    88.2    9e-19   
ref|XP_005334617.1|  PREDICTED: glutathione S-transferase theta-4...  88.2    9e-19   
ref|XP_004400590.1|  PREDICTED: glutathione S-transferase theta-4...  88.2    9e-19   
ref|XP_002925098.1|  PREDICTED: glutathione S-transferase theta-4...  88.2    9e-19   
ref|XP_003387291.1|  PREDICTED: glutathione S-transferase T1-like     88.2    1e-18   
ref|XP_008831399.1|  PREDICTED: glutathione S-transferase theta-2...  88.6    1e-18   
ref|NP_001165927.1|  glutathione S-transferase T3                     87.8    1e-18   
ref|XP_004636371.1|  PREDICTED: glutathione S-transferase theta-1...  88.2    1e-18   
gb|AFB83399.1|  theta class glutathione S-transferase                 87.8    1e-18   



>ref|XP_010909100.1| PREDICTED: glutathione S-transferase T1 isoform X2 [Elaeis guineensis]
Length=250

 Score =   180 bits (457),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DR+SQPSRA++IFC++NGIDFEEV++ LAKGQH+SPEFK+INPM +VPAIVDG
Sbjct  1    MKLKVYADRLSQPSRAIVIFCKLNGIDFEEVRIDLAKGQHRSPEFKRINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL+YLAC+FPGV+DHWYP+DLF RAKIDS
Sbjct  61   RFKLFESHAILRYLACAFPGVSDHWYPADLFSRAKIDS  98



>ref|XP_009600810.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana tomentosiformis]
Length=250

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL +YVDRMSQPSRA+LIFC++NGIDFEEV + L+K QH SPEFK++NPM QVPAI+DG
Sbjct  1    MTLKLYVDRMSQPSRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPMKQVPAIMDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL+YLAC+FPGVADHWYP+DL+KRAK+DS
Sbjct  61   RFKLFESHAILRYLACAFPGVADHWYPADLYKRAKVDS  98



>ref|XP_010053279.1| PREDICTED: glutathione S-transferase T1 [Eucalyptus grandis]
 gb|KCW77542.1| hypothetical protein EUGRSUZ_D01861 [Eucalyptus grandis]
Length=248

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL VY DRMSQPSRAV+IFC+VNGIDFEEV++ LAK QH+SPEFK +NPM QVPAIVDG
Sbjct  1    MTLKVYADRMSQPSRAVIIFCKVNGIDFEEVKIDLAKRQHRSPEFKDVNPMGQVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YL+CSFPGVADHWYP+DL +RAKI S
Sbjct  61   RFKLFESHAILIYLSCSFPGVADHWYPADLSRRAKIHS  98



>ref|XP_004245615.1| PREDICTED: glutathione S-transferase T1-like [Solanum lycopersicum]
Length=250

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL +YVDRMSQPSRAV+IFC++NGIDFEE+ + L+K Q  SPEFK+INPM QVPAI+DG
Sbjct  1    MTLKLYVDRMSQPSRAVIIFCKLNGIDFEEIHINLSKRQQLSPEFKEINPMKQVPAIIDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL+YLAC+FPG+ADHWYP+DL+KRAK+DS
Sbjct  61   RFKLFESHAILRYLACAFPGIADHWYPADLYKRAKVDS  98



>ref|XP_006343997.1| PREDICTED: glutathione S-transferase T1-like [Solanum tuberosum]
Length=250

 Score =   175 bits (444),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL +YVDRMSQPSRAV+IFC++NGIDFEE+ + L+K Q  SPEFK+INPM QVPAI+DG
Sbjct  1    MTLKLYVDRMSQPSRAVIIFCKLNGIDFEEIHINLSKRQQLSPEFKEINPMKQVPAIMDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL+YLAC+FPG+ADHWYP+DL+KRAK+DS
Sbjct  61   RFKLFESHAILRYLACAFPGIADHWYPADLYKRAKVDS  98



>ref|XP_008794197.1| PREDICTED: glutathione S-transferase T1 isoform X1 [Phoenix dactylifera]
Length=250

 Score =   174 bits (442),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DR+SQPSRA++IFC++NGIDFEEV + L K QH+SPEFK+INPM QVPAIVDG
Sbjct  1    MKLKVYADRLSQPSRAIVIFCKLNGIDFEEVPIDLTKRQHRSPEFKEINPMGQVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL+YLAC+FPGV+DHWYP+DLF RAKIDS
Sbjct  61   RFKLFESHAILRYLACAFPGVSDHWYPADLFNRAKIDS  98



>ref|XP_011463848.1| PREDICTED: glutathione S-transferase T1 [Fragaria vesca subsp. 
vesca]
Length=249

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA+LIFC+VNGI+FEEVQ+ LAK Q  SPEFKKINPM QVPAI DG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIEFEEVQMNLAKRQQLSPEFKKINPMGQVPAIADG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            +F LFESHAIL YLAC+FPG+ADHWYP+DLF+RAKI+S
Sbjct  61   KFNLFESHAILVYLACAFPGIADHWYPADLFRRAKINS  98



>ref|XP_009386058.1| PREDICTED: glutathione S-transferase T1-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   173 bits (438),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL VY DRMSQPSRA++IFC+VNGIDFEEV++ L K QH+SPEFK+INPM QVPA+VDG
Sbjct  1    MTLKVYADRMSQPSRAIIIFCKVNGIDFEEVRIDLVKRQHRSPEFKEINPMGQVPAVVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R+KLFESHAIL YL+C+FPG+ DHWYP+DLF RAKI S
Sbjct  61   RYKLFESHAILSYLSCAFPGIPDHWYPADLFTRAKIQS  98



>ref|XP_010255416.1| PREDICTED: glutathione S-transferase T1 [Nelumbo nucifera]
Length=250

 Score =   172 bits (436),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DRMSQPSRAV+IFC+VNGI+FEE+++ L+K QH SPEFK+INPM QVPAI+DGRF
Sbjct  2    LKVYADRMSQPSRAVIIFCKVNGIEFEEIKVDLSKRQHISPEFKEINPMRQVPAIIDGRF  61

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KLFESHAIL YLAC+FPGVADHWYP+DLF+RAKI+S
Sbjct  62   KLFESHAILSYLACAFPGVADHWYPTDLFRRAKINS  97



>ref|XP_011072471.1| PREDICTED: glutathione S-transferase T1 [Sesamum indicum]
Length=250

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL VY DRMSQPSRAV+IFC++NGIDFEEV++ L+K QH +PEF++INPM ++PAIVDG
Sbjct  1    MTLKVYADRMSQPSRAVIIFCKLNGIDFEEVRVDLSKRQHLTPEFREINPMKKLPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC FPGVADHWYP+DLFKRAKI S
Sbjct  61   RFKLFESHAILIYLACVFPGVADHWYPADLFKRAKIHS  98



>gb|ACC93946.1| glutathione S-transferase [Panax ginseng]
Length=250

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VNGI+F+E++ +++K Q KSPE+K+INPM  VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNGIEFDEIKTEISKKQQKSPEYKEINPMGNVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            +FKLFESHAIL YLAC+FPGVADHWYP+DLFKRAKIDS
Sbjct  61   KFKLFESHAILVYLACAFPGVADHWYPADLFKRAKIDS  98



>ref|XP_008238862.1| PREDICTED: glutathione S-transferase T1 [Prunus mume]
Length=250

 Score =   171 bits (433),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VYVDR+SQPSRA+LIF + NGI+FEEV++ +AK QHKSPEFKKINPM QVPAI DG
Sbjct  1    MKLKVYVDRLSQPSRAILIFLKANGIEFEEVKIDIAKRQHKSPEFKKINPMGQVPAISDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGVAD WYPSDLF RAKI+S
Sbjct  61   RFKLFESHAILTYLACAFPGVADSWYPSDLFARAKINS  98



>ref|XP_007209508.1| hypothetical protein PRUPE_ppa010414mg [Prunus persica]
 gb|EMJ10707.1| hypothetical protein PRUPE_ppa010414mg [Prunus persica]
Length=250

 Score =   170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VYVDRMSQPSRA+LIF + NGI+FEEV++ +AK QHKSPEFKKINPM QVPAI DG
Sbjct  1    MKLKVYVDRMSQPSRAILIFLKANGIEFEEVKIDIAKRQHKSPEFKKINPMGQVPAISDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RF LFESHAIL YLAC+FPGVAD WYPSDLF RAKI+S
Sbjct  61   RFNLFESHAILTYLACAFPGVADSWYPSDLFARAKINS  98



>ref|XP_009339919.1| PREDICTED: glutathione S-transferase T1 [Pyrus x bretschneideri]
Length=263

 Score =   170 bits (430),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  35   RKGMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI  214
            ++ M L VYVDR+SQPSRA+LIF +VNGI+FEE+++ ++K QH SPEFKKINPM QVPAI
Sbjct  11   KEEMKLKVYVDRLSQPSRAILIFLKVNGIEFEEIKMDISKRQHLSPEFKKINPMGQVPAI  70

Query  215  VDGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             DGRF LFESHAIL YLAC+FPGVADHWYP+DLF+RAKI+S
Sbjct  71   ADGRFNLFESHAILVYLACAFPGVADHWYPADLFRRAKINS  111



>ref|XP_002298040.2| glutathione S-transferase family protein [Populus trichocarpa]
 gb|EEE82845.2| glutathione S-transferase family protein [Populus trichocarpa]
Length=247

 Score =   169 bits (429),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VN IDFEEV++ ++K QH +PEFK+INPM ++PAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNRIDFEEVRVDISKRQHLTPEFKEINPMRKLPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC FPGVADHWYP+DLFKRAKI+S
Sbjct  61   RFKLFESHAILIYLACVFPGVADHWYPADLFKRAKINS  98



>ref|XP_011029250.1| PREDICTED: glutathione S-transferase T1-like [Populus euphratica]
Length=247

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VN IDFEEV++ ++K QH +PEFK+INPM +VP IVDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNRIDFEEVRVDISKRQHLTPEFKEINPMRKVPTIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC FPGVADHWYP+DLFKRAKI+S
Sbjct  61   RFKLFESHAILIYLACVFPGVADHWYPADLFKRAKINS  98



>ref|XP_007040202.1| Glutathione S-transferase THETA 1 [Theobroma cacao]
 gb|EOY24703.1| Glutathione S-transferase THETA 1 [Theobroma cacao]
Length=165

 Score =   165 bits (418),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY +RMSQPSRAV+IFC+VNGID+EE+++ ++K QH +PEF  INPM +VPAIVDG
Sbjct  1    MKLKVYAERMSQPSRAVIIFCKVNGIDYEEIKVDISKRQHLTPEFADINPMKKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGVADHWYP+DLFKR+KI S
Sbjct  61   RFKLFESHAILIYLACAFPGVADHWYPADLFKRSKIHS  98



>ref|XP_008651869.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase T1-like 
[Zea mays]
Length=140

 Score =   164 bits (416),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   VYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKL  235
            VY DR SQPSRAV+IFCRVN IDFEEV + L K QH +PEFKKINPM QVPAIVDGRFKL
Sbjct  6    VYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFKKINPMGQVPAIVDGRFKL  65

Query  236  FESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            FESHAIL+YLA  FPGVADHWYPSDLF RAKI+S
Sbjct  66   FESHAILRYLASVFPGVADHWYPSDLFTRAKIES  99



>tpg|DAA43810.1| TPA: hypothetical protein ZEAMMB73_384133 [Zea mays]
Length=130

 Score =   164 bits (414),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   VYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKL  235
            VY DR SQPSRAV+IFCRVN IDFEEV + L K QH +PEFKKINPM QVPAIVDGRFKL
Sbjct  6    VYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFKKINPMGQVPAIVDGRFKL  65

Query  236  FESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            FESHAIL+YLA  FPGVADHWYPSDLF RAKI+S
Sbjct  66   FESHAILRYLASVFPGVADHWYPSDLFTRAKIES  99



>gb|KDP36315.1| hypothetical protein JCGZ_09530 [Jatropha curcas]
Length=250

 Score =   167 bits (424),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y DR SQP+RAVLIFC+VNGIDFEE+ + L K Q  SPEFK+INP+ +VPAIVDG
Sbjct  1    MKLKIYADRRSQPARAVLIFCKVNGIDFEEINIDLTKRQQLSPEFKEINPIGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGVADHWYP+DLFKRAKI S
Sbjct  61   RFKLFESHAILSYLACAFPGVADHWYPADLFKRAKIQS  98



>gb|AFK36240.1| unknown [Lotus japonicus]
Length=251

 Score =   167 bits (423),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VNGIDFEE++++L+K QH SPEF  INP  +VPAIVDG
Sbjct  2    MKLKVYADRMSQPSRAVLIFCKVNGIDFEEIKIELSKRQHLSPEFHAINPFKKVPAIVDG  61

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGVADHWYPSD+ +RA+I S
Sbjct  62   RFKLFESHAILIYLACAFPGVADHWYPSDISRRARIQS  99



>gb|KJB52086.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=214

 Score =   166 bits (420),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGID+EE+++ ++KGQH +PEF +INPM Q+PAI DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGVAD WYP+D+FKR+KI S
Sbjct  61   RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHS  98



>emb|CDP09756.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   167 bits (422),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y DRMSQPSRAVLIFCRVNGIDF+EV++ ++K Q  +PEF +INPM +VPAIVDG
Sbjct  1    MKLKLYADRMSQPSRAVLIFCRVNGIDFDEVKVDISKRQQLTPEFAEINPMKKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL+YLA +FPGVADHWYP+DLFKRAKI+S
Sbjct  61   RFKLFESHAILQYLASAFPGVADHWYPADLFKRAKINS  98



>ref|XP_008452024.1| PREDICTED: glutathione S-transferase T1 [Cucumis melo]
Length=238

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DR+SQPSRAVLIFC+VNGI FEEV++ L+K +H +PEFK+INPM +VP IVDG
Sbjct  1    MALKVYADRLSQPSRAVLIFCKVNGIAFEEVKVALSKFEHLTPEFKEINPMVKVPVIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YL+C+FPGVADHWYPSDLF+RAKI S
Sbjct  61   RFKLFESHAILIYLSCAFPGVADHWYPSDLFRRAKIHS  98



>gb|KHG19174.1| Glutathione S-transferase T1 -like protein [Gossypium arboreum]
Length=250

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQP RAV+IFC+VNGID+EE+++ ++KGQH +PEF +INPM Q+PAI DG
Sbjct  1    MKLKVYADRMSQPCRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGVADHWYP+D+FKR+KI S
Sbjct  61   RFKLFESHAILIYLACAFPGVADHWYPADVFKRSKIHS  98



>gb|KJB52087.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=225

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGID+EE+++ ++KGQH +PEF +INPM Q+PAI DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGVAD WYP+D+FKR+KI S
Sbjct  61   RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHS  98



>ref|XP_009599399.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana tomentosiformis]
Length=236

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M+L +YVDR+SQPSRA+LIFC++NGI+FEEV ++L+KGQH+SPEF +INPM QVPAIV G
Sbjct  1    MSLKLYVDRLSQPSRAILIFCKLNGIEFEEVPIELSKGQHRSPEFAEINPMKQVPAIVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKLFESHAIL+YLA +FP VADHWYPSDL KRAKI+S
Sbjct  61   SFKLFESHAILRYLASAFPEVADHWYPSDLQKRAKIES  98



>ref|XP_007160052.1| hypothetical protein PHAVU_002G288600g [Phaseolus vulgaris]
 gb|ESW32046.1| hypothetical protein PHAVU_002G288600g [Phaseolus vulgaris]
Length=250

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA+LIFC+VNGIDFEE++++L+K QH SPEF+ INP+ QVPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIKVELSKRQHLSPEFRAINPLGQVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FPGVADHWYP+DL +RA+I S
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADLSRRARIHS  98



>gb|KJB52089.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=250

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGID+EE+++ ++KGQH +PEF +INPM Q+PAI DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGVAD WYP+D+FKR+KI S
Sbjct  61   RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHS  98



>ref|XP_006439583.1| hypothetical protein CICLE_v10021831mg [Citrus clementina]
 gb|ESR52823.1| hypothetical protein CICLE_v10021831mg [Citrus clementina]
Length=252

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNG+DFEE++++LAK +  SPEFK+INPM +VPAI+DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGLDFEEIEVRLAKREQYSPEFKEINPMAKVPAIIDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YLAC+FPGVADHWYP+DL KRA+I S
Sbjct  61   RLKLFESHAILIYLACAFPGVADHWYPNDLSKRARIHS  98



>ref|XP_006476596.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis]
Length=252

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNG+DFEE++++LAK +  SPEFK+INPM +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGLDFEEIEVRLAKREQYSPEFKEINPMAKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YLAC+FPG+ADHWYP+DL KRA+I S
Sbjct  61   RLKLFESHAILIYLACAFPGIADHWYPNDLSKRARIHS  98



>ref|XP_004146527.1| PREDICTED: glutathione S-transferase T1-like [Cucumis sativus]
 ref|XP_004165234.1| PREDICTED: glutathione S-transferase T1-like [Cucumis sativus]
 gb|KGN53344.1| Glutathione S-transferase [Cucumis sativus]
Length=238

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VNGI FEEV++ L+K +H +PEFK+INPM +VP IVDG
Sbjct  1    MALKVYADRMSQPSRAVLIFCKVNGIAFEEVKVTLSKFEHLTPEFKEINPMGKVPVIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL Y++C+FPGVADHWYP+DLF+RAKI S
Sbjct  61   RFKLFESHAILIYISCAFPGVADHWYPADLFRRAKIHS  98



>ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citrus clementina]
 ref|XP_006476593.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis]
 gb|ESR52822.1| hypothetical protein CICLE_v10021879mg [Citrus clementina]
Length=247

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DR+SQPSRAV+IFC+VNGIDFEE++++LA  +  SPEFK INPM +VPAIVDG
Sbjct  1    MKLKVYADRLSQPSRAVIIFCKVNGIDFEEIEVKLANREQHSPEFKDINPMAKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+C+FPGVADHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILTYLSCAFPGVADHWYPNDLLKRAKIHS  98



>ref|NP_001152125.1| glutathione S-transferase theta-1 [Zea mays]
 gb|ACG45968.1| glutathione S-transferase theta-1 [Zea mays]
 gb|ACN25412.1| unknown [Zea mays]
 tpg|DAA52620.1| TPA: glutathione S-transferase theta-1 [Zea mays]
Length=249

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   VYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKL  235
            VY DR SQPSRAV+IFCRVN IDFEEV + L K QH +PEFKKINPM QVPAIVDGRFKL
Sbjct  6    VYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFKKINPMGQVPAIVDGRFKL  65

Query  236  FESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            FESHAIL+YLA  FPGVADHWYPSDLF RAKI+S
Sbjct  66   FESHAILRYLASVFPGVADHWYPSDLFTRAKIES  99



>emb|CDP09752.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI-VD  220
            M L V+ DR SQPSRAVLIFC+ NGI+FEEVQ+QLAKG+HKSPE++ INPM QVPAI VD
Sbjct  1    MKLKVFADRGSQPSRAVLIFCKANGIEFEEVQIQLAKGEHKSPEYEAINPMKQVPAIEVD  60

Query  221  GRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            G+F+LFESHAIL++LA +FPG+A+HWYP+D+FKRA+IDS
Sbjct  61   GKFRLFESHAILRFLATAFPGIAEHWYPADVFKRAQIDS  99



>ref|XP_002272455.1| PREDICTED: glutathione S-transferase T1 [Vitis vinifera]
Length=248

 Score =   165 bits (417),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y DRMSQPSRA++IFC+VN IDFEEV++ LAK QH SP+FK +NPM QVPAIVDG
Sbjct  1    MKLKIYADRMSQPSRAIIIFCKVNRIDFEEVRVDLAKRQHLSPDFKVVNPMGQVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RF+LFESHAIL YLAC+FPG+AD+WYP+DLFKRAKI S
Sbjct  61   RFQLFESHAILIYLACAFPGIADNWYPNDLFKRAKIHS  98



>emb|CBI34681.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   165 bits (417),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y DRMSQPSRA++IFC+VN IDFEEV++ LAK QH SP+FK +NPM QVPAIVDG
Sbjct  1    MKLKIYADRMSQPSRAIIIFCKVNRIDFEEVRVDLAKRQHLSPDFKVVNPMGQVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RF+LFESHAIL YLAC+FPG+AD+WYP+DLFKRAKI S
Sbjct  61   RFQLFESHAILIYLACAFPGIADNWYPNDLFKRAKIHS  98



>gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populus trichocarpa]
Length=247

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VN IDFEEV++ ++K QH +PEFK+INPM ++PAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNRIDFEEVRVDISKRQHLTPEFKEINPMRKLPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC FPGVADH YP+DLFKRAKI+S
Sbjct  61   RFKLFESHAILIYLACVFPGVADHRYPADLFKRAKINS  98



>gb|KDP25451.1| hypothetical protein JCGZ_20607 [Jatropha curcas]
Length=250

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y DRMSQPSRAVLIFC+VNGIDFEEV++ ++K Q  S EFK+INPM +VPAIVDG
Sbjct  1    MKLKIYADRMSQPSRAVLIFCKVNGIDFEEVKIDISKRQQLSHEFKEINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+F GVADHWYP+DL KRAKI S
Sbjct  61   RFKLFESHAILTYLACAFRGVADHWYPADLSKRAKIQS  98



>ref|XP_002509785.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF51172.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=250

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VN IDFEEV++ +A  Q  SPEFK INPM +VPAIVDG
Sbjct  1    MKLKVYGDRMSQPSRAVLIFCKVNRIDFEEVRIDIANRQQLSPEFKDINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGV DHWYP+DLFKRAKI S
Sbjct  61   RFKLFESHAILIYLACAFPGVPDHWYPADLFKRAKIHS  98



>gb|EYU38357.1| hypothetical protein MIMGU_mgv1a012529mg [Erythranthe guttata]
Length=248

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL +Y DRMSQPSRA++IFC++NGIDFEEV++ L++ QH +PEF++INPM +VPA+VDG
Sbjct  1    MTLKLYADRMSQPSRAIIIFCKLNGIDFEEVKIDLSRRQHLTPEFREINPMKKVPAMVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKL ESHAIL YLAC FPGVADHWYP+D+F RAKI S
Sbjct  61   RFKLSESHAILMYLACVFPGVADHWYPADVFTRAKIHS  98



>ref|XP_009796155.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana sylvestris]
Length=236

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M+L +YVDR+SQPSRA+LIFC++NGI+FEEV ++L+KGQH+SPEF +INPM QVPAIV G
Sbjct  1    MSLKLYVDRLSQPSRALLIFCKLNGIEFEEVPIELSKGQHRSPEFAEINPMKQVPAIVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F LFESHAIL+YLA +FP VADHWYPSDL KRAKI+S
Sbjct  61   SFTLFESHAILRYLASAFPEVADHWYPSDLQKRAKIES  98



>ref|XP_004503735.1| PREDICTED: tRNA 2'-phosphotransferase 1-like isoform X4 [Cicer 
arietinum]
Length=250

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA+LIFC+VNGIDFEE+Q++L+K QH SPEF+ INP  +VPAIVDG
Sbjct  1    MKLKVYTDRMSQPSRAILIFCKVNGIDFEEIQIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FPGVADHWYP+D+ +RAKI +
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADVSRRAKIHA  98



>gb|KJB25823.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=278

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  23   ESEGRKG-MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMT  199
            E++ R G M L VY DRMSQPSRAV+IFC+VNGID+ E+++ ++K +H +PEF +INPM 
Sbjct  21   EAQSRTGKMKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMK  80

Query  200  QVPAIVDGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            Q+PAIVDG+FKLFESH+IL YLAC+FPGVADHWYP++LFKR+KI S
Sbjct  81   QLPAIVDGKFKLFESHSILIYLACAFPGVADHWYPANLFKRSKIHS  126



>gb|AEB77874.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=250

 Score =   162 bits (409),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L V+ DR SQPSRAV++FC+VNGIDFEE+++ L + +  SPEFK+INPM +VPAIVDG
Sbjct  1    MKLKVFADRKSQPSRAVILFCKVNGIDFEEIKVDLMQKKQFSPEFKEINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLAC+FPGVADHWYP+DLFKRAKI S
Sbjct  61   RFKLFESHAILIYLACAFPGVADHWYPADLFKRAKIHS  98



>ref|XP_010553511.1| PREDICTED: glutathione S-transferase T1 [Tarenaya hassleriana]
Length=245

 Score =   162 bits (409),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI+FEEV L LAK +H SPEFK+INPM +VPAIVDG
Sbjct  1    MKLKVYSDRMSQPSRAVIIFCKVNGIEFEEVVLSLAKRKHLSPEFKEINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YL+ +FPG+ DHWYP+DL KRAKI S
Sbjct  61   RFKLFESHAILIYLSSAFPGIPDHWYPNDLSKRAKIHS  98



>gb|EMS35634.1| Glutathione S-transferase theta-1 [Triticum urartu]
Length=233

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DR+SQPSRA++I C+VN IDF+E+ + LAKGQH++PEF KINPM QVP IVDGRF
Sbjct  4    LKVYADRLSQPSRAIIILCKVNRIDFQELTVDLAKGQHRAPEFTKINPMAQVPTIVDGRF  63

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KLFESHAIL+YLA  FPGV DHWYP+DLF RAK++S
Sbjct  64   KLFESHAILRYLATVFPGVPDHWYPADLFTRAKLES  99



>gb|KHG21896.1| Glutathione S-transferase T1 -like protein [Gossypium arboreum]
Length=250

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGID+ E+++ ++K +H +PEF +INPM Q+PAIVDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            +FKLFESH+IL YLAC+FPGVADHWYP+DLFKR+KI S
Sbjct  61   KFKLFESHSILIYLACAFPGVADHWYPADLFKRSKIHS  98



>gb|KHN23652.1| Glutathione S-transferase T1 [Glycine soja]
 gb|AJE59641.1| theta class glutathione S-transferase [Glycine max]
Length=250

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VNGIDFEE+++ L+K Q  SPEF+ +NP+ +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNGIDFEEIKVDLSKRQQLSPEFRAVNPLRKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FPGVADHWYP+DL +RA+I S
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADLSRRARIHS  98



>ref|NP_001236903.1| glutathione S-transferase GST 23 [Glycine max]
 gb|AAG34813.1|AF243378_1 glutathione S-transferase GST 23 [Glycine max]
Length=250

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VNGIDFEE+++ L+K Q  SPEF+ +NP+ +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNGIDFEEIKVDLSKRQQLSPEFRAVNPLRKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FPGVADHWYP+DL +RA+I S
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADLSRRARIHS  98



>ref|XP_004980948.1| PREDICTED: glutathione S-transferase T1-like [Setaria italica]
Length=250

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            + VY DR SQPSRAV+IFCRVN IDFEEV + L K QH +P+F+KINP+ QVPAIVDGRF
Sbjct  4    IKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPQFRKINPLGQVPAIVDGRF  63

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KLFESHAIL+YLA  FPGVADHWYP+DLF RAKI+S
Sbjct  64   KLFESHAILRYLASVFPGVADHWYPADLFTRAKIES  99



>gb|EYU23489.1| hypothetical protein MIMGU_mgv1a012760mg [Erythranthe guttata]
Length=241

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA+LIFC+ NG++FEEV +QLAK QH SPEF +INPM QVPAIV G
Sbjct  1    MELKVYADRMSQPSRAILIFCKANGLEFEEVPIQLAKKQHHSPEFAEINPMKQVPAIVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKLFESHAIL YLA +FPGVADHWYP+D  KRAKI S
Sbjct  61   DFKLFESHAILIYLASAFPGVADHWYPADARKRAKIHS  98



>ref|NP_001068175.1| Os11g0588300 [Oryza sativa Japonica Group]
 gb|AAK98534.1|AF402793_1 putative glutathione S-transferase OsGSTT1 [Oryza sativa Japonica 
Group]
 gb|ABA94506.1| Glutathione S-transferase, N-terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28538.1| Os11g0588300 [Oryza sativa Japonica Group]
 gb|EAY81560.1| hypothetical protein OsI_36725 [Oryza sativa Indica Group]
 gb|EAZ18961.1| hypothetical protein OsJ_34497 [Oryza sativa Japonica Group]
 dbj|BAG96917.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87358.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   160 bits (405),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DR SQPSRA++IFCRVN IDFEEV + L K +H SPEFKKINPM QVPAIVDGRF
Sbjct  5    LKVYADRRSQPSRAIIIFCRVNRIDFEEVTVDLFKREHLSPEFKKINPMGQVPAIVDGRF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            +LFESHAIL+YLA  FPGVADHWYP+DLF RAK+++
Sbjct  65   RLFESHAILRYLATVFPGVADHWYPADLFTRAKLEA  100



>ref|XP_003630526.1| Glutathione transferase [Medicago truncatula]
Length=126

 Score =   156 bits (395),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA+LIFC+VNGIDFEE+ ++L+K QH SPEF+ INP  +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FPGVA HWYP+D+ +RA+I +
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQA  98



>gb|KJB25822.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=250

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGID+ E+++ ++K +H +PEF +INPM Q+PAIVDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            +FKLFESH+IL YLAC+FPGVADHWYP++LFKR+KI S
Sbjct  61   KFKLFESHSILIYLACAFPGVADHWYPANLFKRSKIHS  98



>gb|KJB25824.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=229

 Score =   159 bits (403),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGID+ E+++ ++K +H +PEF +INPM Q+PAIVDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            +FKLFESH+IL YLAC+FPGVADHWYP++LFKR+KI S
Sbjct  61   KFKLFESHSILIYLACAFPGVADHWYPANLFKRSKIHS  98



>ref|XP_003630525.1| Glutathione transferase [Medicago truncatula]
 gb|AET05001.1| glutathione S-transferase theta [Medicago truncatula]
Length=188

 Score =   158 bits (399),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA+LIFC+VNGIDFEE+ ++L+K QH SPEF+ INP  +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FPGVA HWYP+D+ +RA+I +
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQA  98



>gb|EPS65585.1| hypothetical protein M569_09192 [Genlisea aurea]
Length=237

 Score =   159 bits (403),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y DRMSQPSRAV+IFC++NGI+FEEV++ L+K Q+ +PEF +INPM +VPA+VDG
Sbjct  1    MCLKLYADRMSQPSRAVIIFCKMNGIEFEEVRIDLSKRQNLTPEFIEINPMKKVPALVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA  FPGVADHWYP+DLFKRAKI S
Sbjct  61   RFKLFESHAILIYLASVFPGVADHWYPADLFKRAKIHS  98



>ref|XP_006343999.1| PREDICTED: glutathione S-transferase T1-like isoform X2 [Solanum 
tuberosum]
Length=181

 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL +YVDRMSQ  R V+IFC++NGIDFEEV + L+K Q  SPE+++INP+ Q+PAI+DG
Sbjct  1    MTLKLYVDRMSQACREVIIFCKLNGIDFEEVHIDLSKRQQLSPEYREINPIRQIPAIMDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKL ESHAIL+YLAC+FP +ADHWYP+DL+KRAK++S
Sbjct  61   RFKLSESHAILRYLACAFPRIADHWYPADLYKRAKVES  98



>gb|AFK47457.1| unknown [Medicago truncatula]
Length=250

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA+LIFC+VNGIDFEE+ ++L+K QH SPEF+ INP  +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FPGVA HWYP+D+ +RA+I +
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQA  98



>ref|XP_003630524.1| Glutathione transferase [Medicago truncatula]
 gb|AET05000.1| glutathione S-transferase theta [Medicago truncatula]
Length=250

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA+LIFC+VNGIDFEE+ ++L+K QH SPEF+ INP  +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FPGVA HWYP+D+ +RA+I +
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQA  98



>ref|XP_006827675.1| hypothetical protein AMTR_s00009p00255220 [Amborella trichopoda]
 gb|ERM95091.1| hypothetical protein AMTR_s00009p00255220 [Amborella trichopoda]
Length=233

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+ NGIDFEEV++ ++K QH  PEFK INPM QVPA+VDG
Sbjct  1    MKLRVYTDRMSQPSRAVIIFCKTNGIDFEEVRIDISKRQHLQPEFKAINPMGQVPALVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            + KLFESHAIL+YL+ +FPG+ DHWYP DL +RAKI+S
Sbjct  61   KLKLFESHAILRYLSYAFPGIPDHWYPGDLSRRAKIES  98



>ref|XP_002304489.1| glutathione S-transferase family protein [Populus trichocarpa]
 gb|EEE79468.1| glutathione S-transferase family protein [Populus trichocarpa]
Length=232

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI-VD  220
            M L VYVDR+SQPSRA++IFC+VN IDFEEV ++L KGQH +PEFK+INPM +VPAI VD
Sbjct  1    MELKVYVDRLSQPSRAIVIFCKVNKIDFEEVGIELLKGQHLTPEFKEINPMGKVPAIVVD  60

Query  221  GRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            G+FKLFESHAIL +LA +FPGVADHWYP+DL++RA+I S
Sbjct  61   GKFKLFESHAILIFLASAFPGVADHWYPADLYRRAEIHS  99



>ref|XP_009769998.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana sylvestris]
Length=85

 Score =   152 bits (385),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL +YVDRMSQPSRA+LIFC++NGIDFEEV + L+K QH SPEFK++NP+ QVPAI+DG
Sbjct  1    MTLKLYVDRMSQPSRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPLKQVPAIMDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHW  298
            RFKLFESHAIL+YLAC+FPGVADHW
Sbjct  61   RFKLFESHAILRYLACAFPGVADHW  85



>ref|XP_004503770.1| PREDICTED: glutathione S-transferase T1-like [Cicer arietinum]
Length=252

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VYVDRMSQPSRA+LIFCR+NGIDFEEVQ+ L+K  H SP+F ++NP+ +VPAI+ G F
Sbjct  5    LKVYVDRMSQPSRAILIFCRLNGIDFEEVQIDLSKRHHLSPQFTEVNPLQKVPAILHGNF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             LFESHAIL YLA +FPG+ADHWYP+D+F+RAKI+S
Sbjct  65   NLFESHAILAYLASAFPGIADHWYPTDVFRRAKINS  100



>ref|XP_004245614.1| PREDICTED: glutathione S-transferase T1 [Solanum lycopersicum]
Length=250

 Score =   157 bits (398),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL +YVDRMSQ  R V+IFC++NGIDFEEV + L+K Q  SPE+++INP+ Q+PAI+DG
Sbjct  1    MTLKLYVDRMSQACREVIIFCKLNGIDFEEVHIDLSKRQQLSPEYREINPIRQIPAIMDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKL ESHAILKYLAC+FP +ADHWYP+DL+KRAK++S
Sbjct  61   RFKLSESHAILKYLACAFPRIADHWYPADLYKRAKVES  98



>gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populus trichocarpa]
Length=232

 Score =   157 bits (397),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI-VD  220
            M L VYVDR+SQPSRA++IFC+VN IDFEEV ++L KGQH +PEFK+INPM +VPAI VD
Sbjct  1    MELKVYVDRLSQPSRAIVIFCKVNKIDFEEVGIELLKGQHLTPEFKEINPMGKVPAIVVD  60

Query  221  GRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            G+FKLFESHAIL +LA +FPGVADHWYP+DL++RA+I S
Sbjct  61   GKFKLFESHAILIFLASAFPGVADHWYPADLYRRAEIHS  99



>gb|KDP25450.1| hypothetical protein JCGZ_20606 [Jatropha curcas]
Length=230

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY  R+SQPSRAV+IFC+VNGI+FEE+ + L+K QHK+PEFK+INPM QVPAIV  
Sbjct  1    MALKVYGHRVSQPSRAVMIFCKVNGIEFEEITIDLSKKQHKTPEFKEINPMGQVPAIVHD  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKLFESHA+L YLAC+FPGV DHWYP+DL KRAK+ S
Sbjct  61   DFKLFESHAVLTYLACAFPGVTDHWYPADLRKRAKVQS  98



>ref|XP_006343998.1| PREDICTED: glutathione S-transferase T1-like isoform X1 [Solanum 
tuberosum]
Length=250

 Score =   157 bits (397),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL +YVDRMSQ  R V+IFC++NGIDFEEV + L+K Q  SPE+++INP+ Q+PAI+DG
Sbjct  1    MTLKLYVDRMSQACREVIIFCKLNGIDFEEVHIDLSKRQQLSPEYREINPIRQIPAIMDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKL ESHAIL+YLAC+FP +ADHWYP+DL+KRAK++S
Sbjct  61   RFKLSESHAILRYLACAFPRIADHWYPADLYKRAKVES  98



>emb|CDP09754.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI-VD  220
            M L ++V R+SQPSRAVLIFC++N I+FEEVQ+ L+KG+H SPEFK+INPM +VPA+ VD
Sbjct  1    MKLKLFVHRLSQPSRAVLIFCKLNKIEFEEVQIDLSKGEHLSPEFKEINPMHKVPAMEVD  60

Query  221  GRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            G FKLFESHAIL++LAC+ PGVADHWYP+DLFKRA+I+S
Sbjct  61   GGFKLFESHAILRFLACASPGVADHWYPADLFKRAEINS  99



>gb|KJB39646.1| hypothetical protein B456_007G023300 [Gossypium raimondii]
Length=251

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y DRMSQP RAV+IFC+ NGIDFEE+++ +AK Q+ +PE+ +INPM Q+PAIVDG
Sbjct  1    MKLKLYADRMSQPVRAVIIFCKKNGIDFEEIRVDIAKRQNLTPEYAEINPMKQLPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
            RFKLFESHAIL YLA SFPGVADHWYP+D+FKR+KI
Sbjct  61   RFKLFESHAILVYLASSFPGVADHWYPADVFKRSKI  96



>emb|CDY71891.1| BnaC06g42280D [Brassica napus]
Length=241

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI+F+EV + LAK Q  SPEFK+INP+ +VP IVDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FP VADHWYP+DL KRAKI S
Sbjct  61   RFKLFESHAILIYLASAFPSVADHWYPNDLSKRAKIHS  98



>ref|XP_002868607.1| hypothetical protein ARALYDRAFT_916086 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44866.1| hypothetical protein ARALYDRAFT_916086 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI F+EV + LAK Q  SPEFK INPM +VPAIVDG
Sbjct  2    MKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPMGKVPAIVDG  61

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP VADHWYP+DL KRAKI S
Sbjct  62   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHS  99



>ref|XP_011022714.1| PREDICTED: glutathione S-transferase T1 [Populus euphratica]
Length=232

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI-VD  220
            M L VYVDR+SQPSRA++IFC+ N IDFEEV ++L KGQH +PEFK+INPM +VPAI VD
Sbjct  1    MELKVYVDRLSQPSRAIVIFCKANKIDFEEVGIELLKGQHLTPEFKEINPMGKVPAIVVD  60

Query  221  GRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            G+FKLFESH IL +LA +FPGVADHWYP+DL++RA+I S
Sbjct  61   GKFKLFESHTILIFLASAFPGVADHWYPADLYRRAEIHS  99



>ref|XP_002449793.1| hypothetical protein SORBIDRAFT_05g023450 [Sorghum bicolor]
 gb|EES08781.1| hypothetical protein SORBIDRAFT_05g023450 [Sorghum bicolor]
Length=252

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            + VY  R SQP RAV+IFCR N IDFEEV + L K Q+ +PEF+KINPM QVPAIVDGRF
Sbjct  4    IKVYAHRWSQPCRAVIIFCRANKIDFEEVTVDLFKSQNLTPEFRKINPMAQVPAIVDGRF  63

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KLFESHAIL+YLA  FPGVADHWYP+DLF RAKI+S
Sbjct  64   KLFESHAILRYLATVFPGVADHWYPADLFTRAKIES  99



>ref|XP_010676473.1| PREDICTED: glutathione S-transferase T1 [Beta vulgaris subsp. 
vulgaris]
Length=247

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL V+ DRMSQPSRAV++FC++N I+FEEV++ L K QH S EF +INP+ QVPAIVDG
Sbjct  1    MTLKVFADRMSQPSRAVILFCKLNKINFEEVRIVLFKRQHFSQEFAEINPLRQVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKL+ESHAIL YL+C+FPGVADHWYP+D+ KRAKI S
Sbjct  61   RFKLYESHAILIYLSCAFPGVADHWYPADVSKRAKIHS  98



>ref|XP_009125179.1| PREDICTED: glutathione S-transferase T1-like [Brassica rapa]
Length=241

 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA++IFC+VNGI+F+EV + LAK Q  SPEFK+INP+ +VP+IVDG
Sbjct  1    MKLKVYADRMSQPSRAIIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPSIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESHAIL YLA +FP VADHWYP+D+ KRAKI S
Sbjct  61   RFKLFESHAILIYLASAFPSVADHWYPNDVSKRAKIHS  98



>gb|KHG14410.1| Glutathione S-transferase T1 -like protein [Gossypium arboreum]
Length=485

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +2

Query  23   ESEGRKG--MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPM  196
            E E  KG  M L +Y DRMSQP RAV+IFC+ NGIDFEE+++ +AK QH +PE+ +INPM
Sbjct  226  EIERSKGINMKLKLYADRMSQPVRAVIIFCKKNGIDFEEIRVDIAKRQHLTPEYAEINPM  285

Query  197  TQVPAIVDGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             Q+PAIVDGRF+LFESHAIL YLA SFPGVADHWYP+D+FKR+KI S
Sbjct  286  KQLPAIVDGRFELFESHAILVYLASSFPGVADHWYPADVFKRSKIHS  332


 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DR+SQP RAV+IFC VNGI++EE+++ LA  +H +PEF +INPM Q+PAIV G
Sbjct  1    MKLKVYADRLSQPVRAVIIFCEVNGIEYEEIKVDLANREHLTPEFSEINPMQQLPAIVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKLFESHAIL YLA SFPGVADHWYP+D++KR+KI S
Sbjct  61   TFKLFESHAILIYLASSFPGVADHWYPADVYKRSKIHS  98



>emb|CDX67492.1| BnaA07g15320D [Brassica napus]
Length=241

 Score =   154 bits (389),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI+F+EV + LAK Q  SPEFK+INP+ +VP+IVDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQFSPEFKEINPLGKVPSIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFESH IL YLA +FP VADHWYP+DL KRAKI S
Sbjct  61   RFKLFESHTILIYLASAFPSVADHWYPNDLSKRAKIHS  98



>ref|NP_198937.1| glutathione S-transferase THETA 1 [Arabidopsis thaliana]
 sp|Q9ZRT5.1|GSTT1_ARATH RecName: Full=Glutathione S-transferase T1; Short=AtGSTT1; AltName: 
Full=GST class-theta member 1; AltName: Full=Glutathione 
S-transferase 10 [Arabidopsis thaliana]
 emb|CAA10457.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 dbj|BAB09723.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 gb|AAK96850.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 gb|AAL66881.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 gb|AED94654.1| glutathione S-transferase THETA 1 [Arabidopsis thaliana]
Length=245

 Score =   154 bits (389),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI F+EV + LAK Q  SPEFK INP+ +VPAIVDG
Sbjct  2    MKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDG  61

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP VADHWYP+DL KRAKI S
Sbjct  62   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHS  99



>ref|XP_003563992.1| PREDICTED: glutathione S-transferase T1 [Brachypodium distachyon]
Length=274

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFK-KINPMTQVPAIVDGR  226
            L VY DR SQPSRA++IFCR N IDF+EV + L K QH +PEFK KINPM QVPAIVDGR
Sbjct  38   LKVYADRRSQPSRAIIIFCRANRIDFDEVTVDLFKAQHLTPEFKSKINPMGQVPAIVDGR  97

Query  227  FKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            FKLFESHAIL+YLA  FPGV DHWYP+DLF RAKI+S
Sbjct  98   FKLFESHAILRYLASVFPGVPDHWYPADLFTRAKIES  134



>gb|EMT22242.1| hypothetical protein F775_32578 [Aegilops tauschii]
Length=242

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 7/103 (7%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DR+SQPSRA++I C+VN IDF+E+ + LA+GQH++PEF KINPM QVP IVDGRF
Sbjct  5    LKVYADRLSQPSRAIIILCKVNRIDFQELTVDLARGQHRAPEFTKINPMAQVPTIVDGRF  64

Query  230  KLFE-------SHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KLFE       SHAIL+YLA  FPGV DHWYP+DLF RAK++S
Sbjct  65   KLFESMFLLPVSHAILRYLATVFPGVPDHWYPADLFTRAKLES  107



>emb|CDP09755.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI-VD  220
            M L ++VDR+SQP RA+LIFC++N I+FEEV+++L+KG+  SPEFK+INPM +VPA+ VD
Sbjct  1    MKLKLFVDRLSQPCRAILIFCKMNEIEFEEVRIELSKGEQLSPEFKEINPMQKVPAMKVD  60

Query  221  GRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             RF+LFESHAIL++LA +FPGVADHWYP+DLFKRA+IDS
Sbjct  61   ERFRLFESHAILRFLAGAFPGVADHWYPADLFKRAEIDS  99



>emb|CDY46386.1| BnaC04g33050D [Brassica napus]
Length=245

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI+F+EV + LAK Q  SPEFK+INP+ +VP IVDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP VADHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHS  98



>ref|XP_011080977.1| PREDICTED: glutathione S-transferase T1-like [Sesamum indicum]
Length=236

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +YVDR+SQPSRA+LIFC+ NGI+FEEV++ LAK QH  PEF ++NPM QVPAIV G
Sbjct  1    MELKLYVDRISQPSRAILIFCKANGIEFEEVKIDLAKKQHHFPEFAEVNPMKQVPAIVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKLFESHAIL YLA +FPGVA HWYP+D+ KRAKI S
Sbjct  61   DFKLFESHAILIYLASAFPGVAHHWYPADVQKRAKIHS  98



>ref|XP_009140078.1| PREDICTED: glutathione S-transferase T1-like [Brassica rapa]
Length=246

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI+F+EV + LAK Q  SPEFK+INP+ +VP IVDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP VADHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHS  98



>gb|AGC13145.1| theta class glutathione S-transferase [Pinus tabuliformis]
Length=249

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VYVDRMSQPSRAVLIFC+VN I+FEE  + L K +HK PEF+ INP+  VPAI DG F
Sbjct  4    LRVYVDRMSQPSRAVLIFCKVNKIEFEEHLVNLGKKEHKQPEFRAINPLGLVPAIHDGGF  63

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KLFESHAILKYLAC++P V DHWYP+DL KRAKIDS
Sbjct  64   KLFESHAILKYLACAYPSVPDHWYPADLSKRAKIDS  99



>emb|CDY39752.1| BnaA04g11010D [Brassica napus]
Length=246

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI+F+EV + LAK Q  SPEFK+INP+ +VP IVDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP VADHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHS  98



>ref|XP_011072506.1| PREDICTED: glutathione S-transferase T1-like [Sesamum indicum]
Length=236

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +YVDR+SQPSRAVLIFC+ N I+FEEV ++L K QH+SPE+ +INPM QVPAIV G
Sbjct  1    MELKLYVDRLSQPSRAVLIFCKANEIEFEEVSIKLGKLQHRSPEYAEINPMKQVPAIVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKL ESHAIL YLA +FPGVADHWYP+D+ KRAKI S
Sbjct  61   DFKLSESHAILIYLASAFPGVADHWYPADVHKRAKIHS  98



>ref|XP_004252589.1| PREDICTED: glutathione S-transferase T1 [Solanum lycopersicum]
Length=236

 Score =   152 bits (383),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M+L VYVDR+SQPSRA+LIFC++NGI+FEEV + LAKGQH++PE++++N M QVPAIV  
Sbjct  1    MSLKVYVDRLSQPSRAILIFCKLNGIEFEEVNIDLAKGQHRTPEYQEVNIMKQVPAIVHD  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             FKLFESHAIL+YLA +FP  ADHWYP DL KRA ++
Sbjct  61   TFKLFESHAILRYLASAFPETADHWYPKDLQKRANVE  97



>ref|XP_006405381.1| hypothetical protein EUTSA_v10027900mg [Eutrema salsugineum]
 dbj|BAJ34350.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46834.1| hypothetical protein EUTSA_v10027900mg [Eutrema salsugineum]
Length=244

 Score =   152 bits (383),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI F+E+ + LAK Q  +PEFK INP+ +VPAIVDG
Sbjct  1    MKLKVYTDRMSQPSRAVIIFCKVNGIQFDEILISLAKRQQLAPEFKDINPLGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP VADHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHS  98



>emb|CDP09753.1| unnamed protein product [Coffea canephora]
Length=131

 Score =   148 bits (373),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI-VD  220
            M L ++VDR+SQP RA+LIFC++NGI+FEEV +   K ++ SPE++KINPM  VPAI VD
Sbjct  1    MKLKLFVDRLSQPCRAILIFCKLNGIEFEEVTIDFCKRENISPEYQKINPMQLVPAIEVD  60

Query  221  GRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            G FKLFESHAIL++LA +FPGVADHWYP+DLF+RA+IDS
Sbjct  61   GEFKLFESHAILRFLASAFPGVADHWYPADLFERAQIDS  99



>gb|KFK33026.1| hypothetical protein AALP_AA6G320800 [Arabis alpina]
Length=244

 Score =   151 bits (382),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA++IFC+VNGI F+E+ + L+K Q  SPEFK+INP+ +VPAIVDG
Sbjct  1    MKLKVYTDRMSQPSRAIIIFCKVNGIQFDEISIILSKRQQLSPEFKEINPLGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YLA +FP V DHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLASAFPSVLDHWYPNDLSKRAKIHS  98



>ref|XP_003532409.1| PREDICTED: glutathione S-transferase T2-like isoform X1 [Glycine 
max]
 gb|AJE59643.1| theta class glutathione S-transferase [Glycine max]
Length=252

 Score =   151 bits (382),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY D+MSQPSRAVLIFCR NGIDFEE+++ ++K  H SPEF++INP+ +VPAIV G F
Sbjct  5    LKVYADQMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREINPLQKVPAIVHGSF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             L ESHAIL YLA +FPG+ADHWYPS+LF+RAKI+S
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSNLFRRAKINS  100



>ref|XP_006579426.1| PREDICTED: uncharacterized protein LOC100799229 isoform X2 [Glycine 
max]
Length=239

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DRMSQPSRAVLIFCR NGIDFEE+++ ++K  H SPEF+++NP+ +VPAIV G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             L ESHAIL YLA +FPG+ADHWYPSDL++RAKI S
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSDLYRRAKIIS  100



>ref|XP_009777222.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana sylvestris]
Length=256

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  83   SRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKLFESHAILKY  262
            SRA+LIFC++NGIDFEEV + L+K QH SPEFK++NP+ QVPAI+DGRFKLFESHAIL+Y
Sbjct  29   SRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPLKQVPAIMDGRFKLFESHAILRY  88

Query  263  LACSFPGVADHWYPSDLFKRAKIDS  337
            LAC+FPGVADHWYP+DL+KRAK+DS
Sbjct  89   LACAFPGVADHWYPADLYKRAKVDS  113


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  215  VDGRFKLFESHAILKYLACSFPGVADH  295
            +DGRFKLFESHAIL+YLAC+FPGVADH
Sbjct  1    MDGRFKLFESHAILRYLACAFPGVADH  27



>gb|AET05003.2| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=252

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DRMSQPSRAVLIFCR NGIDFEE+++ L+K  H SPEF ++NP+ +VPAI+ G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDLSKRHHLSPEFTEVNPLHKVPAILHGNF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             LFESHAIL YL+ +FPGVADHWYP+D+F+R KI+S
Sbjct  65   NLFESHAILVYLSSAFPGVADHWYPTDVFRRVKINS  100



>ref|XP_003630527.1| Glutathione S-transferase theta [Medicago truncatula]
Length=251

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DRMSQPSRAVLIFCR NGIDFEE+++ L+K  H SPEF ++NP+ +VPAI+ G F
Sbjct  4    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDLSKRHHLSPEFTEVNPLHKVPAILHGNF  63

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             LFESHAIL YL+ +FPGVADHWYP+D+F+R KI+S
Sbjct  64   NLFESHAILVYLSSAFPGVADHWYPTDVFRRVKINS  99



>gb|KHN23653.1| Glutathione S-transferase T1 [Glycine soja]
Length=252

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DRMSQPSRAVLIFCR NGIDFEE+++ ++K  H SPEF+++NP+ +VPAIV G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             L ESHAIL YLA +FPG+ADHWYPSDL++RAKI S
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSDLYRRAKIIS  100



>ref|XP_006579425.1| PREDICTED: uncharacterized protein LOC100799229 isoform X1 [Glycine 
max]
 gb|AJE59642.1| theta class glutathione S-transferase [Glycine max]
Length=252

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DRMSQPSRAVLIFCR NGIDFEE+++ ++K  H SPEF+++NP+ +VPAIV G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             L ESHAIL YLA +FPG+ADHWYPSDL++RAKI S
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSDLYRRAKIIS  100



>ref|XP_006360687.1| PREDICTED: glutathione S-transferase T1-like [Solanum tuberosum]
Length=236

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M+L +YVDR+SQPSRA+LIFC++NGI+FEEV + L+KGQH++PE++++N M QVPAIV  
Sbjct  1    MSLKIYVDRLSQPSRAILIFCKLNGIEFEEVNIDLSKGQHRTPEYQEVNIMKQVPAIVHD  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             FKLFESHAIL+YLA +FP  ADHWYP DL KRA ++
Sbjct  61   TFKLFESHAILRYLASAFPETADHWYPKDLQKRANVE  97



>ref|XP_010447179.1| PREDICTED: glutathione S-transferase T1-like [Camelina sativa]
Length=244

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI F+E+ + L+K Q  +PEFK INPM +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIQFDEILIILSKRQQLTPEFKDINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP V DHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSKRAKIHS  98



>gb|AHA46533.1| theta class glutathione S-transferase [Larix kaempferi]
Length=249

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VYVDRMSQPSRAVLIFC VN I+FEE  + L K +HK PE+  INP+ QVPAI DG F
Sbjct  4    LHVYVDRMSQPSRAVLIFCMVNRIEFEERLVNLGKREHKRPEYGAINPLQQVPAIDDGGF  63

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KLFESHAIL+YLAC++P V DHWYP+DL KRAKIDS
Sbjct  64   KLFESHAILRYLACAYPRVPDHWYPADLSKRAKIDS  99



>ref|NP_001242886.1| uncharacterized protein LOC100799229 [Glycine max]
 gb|ACU20910.1| unknown [Glycine max]
Length=227

 Score =   149 bits (375),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DRMSQPSRAVLIFCR NGIDFEE+++ ++K  H SPEF+++NP+ +VPAIV G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             L ESHAIL YL  +FPG+ADHWYPSDL++RAKI S
Sbjct  65   NLSESHAILVYLVSAFPGIADHWYPSDLYRRAKIIS  100



>gb|ADE75690.1| unknown [Picea sitchensis]
Length=248

 Score =   149 bits (376),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VYVDRMSQPSRAVLIFC VN I+FEE  + L K +HK PEF+ INP+  VP I DG F
Sbjct  4    LRVYVDRMSQPSRAVLIFCMVNKIEFEEHLVNLGKKEHKQPEFRAINPLGLVPTIDDGGF  63

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KLFESHAILKYLAC++P V DHWYP+DL KRAKIDS
Sbjct  64   KLFESHAILKYLACAYPRVPDHWYPADLSKRAKIDS  99



>ref|XP_010441287.1| PREDICTED: glutathione S-transferase T1-like [Camelina sativa]
Length=244

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI F+E  + L+K Q  +PEFK INPM +VPAIVDG
Sbjct  1    MMLKVYADRMSQPSRAVIIFCKVNGIQFDENLIILSKRQQLTPEFKDINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP V DHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSKRAKIHS  98



>ref|XP_002509786.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF51173.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=237

 Score =   147 bits (371),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y  R+SQPSRA++ FC++NG++FEE+ + L+K QHKSPEFK+INPM QVPAIV G
Sbjct  1    MELKLYTHRVSQPSRALITFCKMNGLEFEEIVIDLSKRQHKSPEFKEINPMGQVPAIVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKLFESHA L YLA +FPGVADHWYP DL KRAKI S
Sbjct  61   DFKLFESHACLIYLASAFPGVADHWYPIDLQKRAKIHS  98



>ref|XP_010436071.1| PREDICTED: glutathione S-transferase T1 [Camelina sativa]
Length=244

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGI F+E  + L+K Q  +PEFK INPM +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIQFDENLIILSKRQQLTPEFKDINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP V DHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSKRAKIHS  98



>ref|XP_006282694.1| hypothetical protein CARUB_v10005614mg [Capsella rubella]
 gb|EOA15592.1| hypothetical protein CARUB_v10005614mg [Capsella rubella]
Length=244

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VYVDRMSQPSRAV+IFC+VNGI F+E  + LAK Q  + EFK INP+ +VPAIVDG
Sbjct  1    MKLKVYVDRMSQPSRAVIIFCKVNGIQFDETLISLAKRQQLTSEFKDINPIGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ +FP V DHWYP+DL +RAKI S
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSQRAKIHS  98



>dbj|BAB11100.1| glutathione transferase [Arabidopsis thaliana]
Length=242

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VN I F+E+ + L K Q  SPEFK+INPM +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ ++  V DHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHS  98



>ref|XP_007160051.1| hypothetical protein PHAVU_002G288500g [Phaseolus vulgaris]
 gb|ESW32045.1| hypothetical protein PHAVU_002G288500g [Phaseolus vulgaris]
Length=253

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY DRMSQPSRAVLIFCR+NGI F E+++ ++KG H S EF ++NP+ +VPAIV G F
Sbjct  6    LKVYADRMSQPSRAVLIFCRLNGIGFVEIKVDISKGHHLSSEFTEVNPLQKVPAIVHGSF  65

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             L ESHAIL YL  +FPG+ADHWYPSD+F+RAKI+S
Sbjct  66   NLSESHAILVYLNSAFPGIADHWYPSDIFRRAKINS  101



>ref|XP_009386057.1| PREDICTED: glutathione S-transferase T1-like [Musa acuminata 
subsp. malaccensis]
Length=232

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            MTL VY  R+SQPSRA++IFC+VNGIDFEEV +    G+H+ P+FK+INPM +VPAIV G
Sbjct  1    MTLKVYGHRLSQPSRAIIIFCKVNGIDFEEVTIDFTTGKHRLPDFKEINPMAEVPAIVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
              KLFESHAIL YLA +FPGV D WYP+D+  RAKI S
Sbjct  61   DLKLFESHAILCYLASAFPGVPDGWYPADIISRAKIQS  98



>emb|CDP22238.1| unnamed protein product [Coffea canephora]
Length=86

 Score =   140 bits (352),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI-VD  220
            M L V+ DR SQPSRAVLI C+ NGI+FEEVQ+QLAKG+HKSPE++ INPM QVPAI VD
Sbjct  1    MKLKVFADRGSQPSRAVLILCKANGIEFEEVQIQLAKGEHKSPEYEAINPMKQVPAIEVD  60

Query  221  GRFKLFESHAILKYLACSFPGVADHW  298
            G+F+LFESHAIL++LA +FPG+A+HW
Sbjct  61   GKFRLFESHAILRFLATAFPGIAEHW  86



>emb|CAA10662.1| glutathione transferase, GST 10b [Arabidopsis thaliana]
Length=245

 Score =   144 bits (364),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY D+MSQPSRAVLIFC+VN I F+E+ + L K Q  SPEFK+INPM +VPAIVDG
Sbjct  2    MKLKVYADKMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG  61

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ ++  V DHWYP+DL KRAKI S
Sbjct  62   RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHS  99



>ref|XP_002967178.1| hypothetical protein SELMODRAFT_144252 [Selaginella moellendorffii]
 gb|EFJ31777.1| hypothetical protein SELMODRAFT_144252 [Selaginella moellendorffii]
Length=250

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  35   RKGMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI  214
            ++   L +YVD MSQPSRA+LIFCR+N ID E   + +AKGQ ++PEFK INPM QVPAI
Sbjct  8    KRDSKLHLYVDFMSQPSRAILIFCRINNIDAEIHVVNVAKGQQRTPEFKAINPMGQVPAI  67

Query  215  VDGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            VD  FKLFESHAIL+YLA ++P V DHWYPSDL +RA+IDS
Sbjct  68   VDHGFKLFESHAILRYLAATYPKVPDHWYPSDLSRRARIDS  108



>ref|XP_002960542.1| hypothetical protein SELMODRAFT_74927 [Selaginella moellendorffii]
 gb|EFJ38081.1| hypothetical protein SELMODRAFT_74927 [Selaginella moellendorffii]
Length=248

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  35   RKGMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAI  214
            ++   L +YVD MSQPSRA+LIFC++N ID E   + +AKGQ ++PEFK INPM QVPAI
Sbjct  6    KRDSKLHLYVDFMSQPSRAILIFCQINNIDAEIHVVNVAKGQQRTPEFKAINPMGQVPAI  65

Query  215  VDGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            VD  FKLFESHAIL+YLA ++P V DHWYPSDL +RA+IDS
Sbjct  66   VDHGFKLFESHAILRYLAATYPKVPDHWYPSDLSRRARIDS  106



>gb|AAF64449.1|AF239927_1 glutathione S-transferase [Euphorbia esula]
Length=238

 Score =   141 bits (356),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +YV R+SQPSRA++IFC+ NGI+FEE  + L K QHKSP+F +INPM QVP++V G
Sbjct  1    MALKLYVHRVSQPSRALVIFCKSNGIEFEEAHIDLMKKQHKSPDFLEINPMGQVPSMVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKLFESHAIL YL  ++P VADHWYPSD+ +RAK+ S
Sbjct  61   DFKLFESHAILTYLTAAYPEVADHWYPSDIKQRAKVQS  98



>ref|XP_001778018.1| predicted protein [Physcomitrella patens]
 gb|EDQ57127.1| predicted protein [Physcomitrella patens]
 gb|AFZ39142.1| theta class glutathione S-transferase [Physcomitrella patens]
Length=257

 Score =   142 bits (357),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  47   TLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGR  226
             L +Y D MSQPSRAVL+FCRVN ID ++  + + KG HK+PEFK INP+ +VP IVDGR
Sbjct  6    NLKLYADLMSQPSRAVLLFCRVNNIDVDQQLINIQKGDHKTPEFKAINPLGKVPCIVDGR  65

Query  227  FKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            FKL ESHAI++YLA + PGVADHWYP+D+ +R+KI+S
Sbjct  66   FKLAESHAIMEYLAATRPGVADHWYPTDVQRRSKINS  102



>ref|NP_198940.3| glutathione S-transferase THETA 2 [Arabidopsis thaliana]
 sp|Q8L727.1|GSTT2_ARATH RecName: Full=Glutathione S-transferase T2; Short=AtGSTT2; AltName: 
Full=GST class-theta member 2; AltName: Full=Glutathione 
S-transferase 10B [Arabidopsis thaliana]
 gb|AAM98138.1| glutathione transferase [Arabidopsis thaliana]
 gb|AAP37720.1| At5g41240 [Arabidopsis thaliana]
 gb|AED94656.1| glutathione S-transferase THETA 2 [Arabidopsis thaliana]
Length=591

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VN I F+E+ + L K Q  SPEFK+INPM +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            R KLFESHAIL YL+ ++  V DHWYP+DL KRAKI S
Sbjct  61   RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHS  98



>gb|AFV96155.1| glutathion-S-transferase theta, partial [Brassica oleracea]
Length=200

 Score =   137 bits (345),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  74   SQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKLFESHAI  253
            SQPSRAV+IFC+VNGI+F+EV + LAK Q  SPEFK+INP+ +VP IVDGR KLFESHAI
Sbjct  1    SQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDGRLKLFESHAI  60

Query  254  LKYLACSFPGVADHWYPSDLFKRAKIDS  337
            L YL+ +FP VADHWYP+DL KRAKI S
Sbjct  61   LIYLSSAFPSVADHWYPNDLSKRAKIHS  88



>ref|NP_198938.1| glutathione S-transferase THETA 3 [Arabidopsis thaliana]
 sp|Q9FHE1.1|GSTT3_ARATH RecName: Full=Glutathione S-transferase T3; Short=AtGSTT3; AltName: 
Full=GST class-theta member 3; AltName: Full=Glutathione 
S-transferase 10C [Arabidopsis thaliana]
 dbj|BAB11098.1| glutathione transferase-like [Arabidopsis thaliana]
 gb|AED94655.1| glutathione S-transferase THETA 3 [Arabidopsis thaliana]
Length=590

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAVLIFC+VN I F+E+ + LA  Q  SPEFK INPM +VPAIVDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            + KL ESHAIL YL+ ++P V DHWYP+DL KRA+I S
Sbjct  61   KLKLSESHAILIYLSSAYPSVVDHWYPTDLSKRARIHS  98



>ref|XP_002966830.1| hypothetical protein SELMODRAFT_144283 [Selaginella moellendorffii]
 gb|EFJ31429.1| hypothetical protein SELMODRAFT_144283 [Selaginella moellendorffii]
Length=224

 Score =   136 bits (342),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQPSRA+ IFCRVN I+ E   L L KG+H++PE+K +NPM QVPAIVD 
Sbjct  1    MALHLYIDLLSQPSRAIYIFCRVNNIEAEIHHLDLMKGEHQTPEYKAVNPMGQVPAIVDN  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKLFESHAIL+YLA + PGV+ +WYPSD  + A+IDS
Sbjct  61   GFKLFESHAILRYLATTKPGVSSNWYPSDPLRGARIDS  98



>ref|XP_002961176.1| hypothetical protein SELMODRAFT_270213 [Selaginella moellendorffii]
 gb|EFJ38715.1| hypothetical protein SELMODRAFT_270213 [Selaginella moellendorffii]
Length=224

 Score =   135 bits (340),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQPSRA+ IFCRVN I+ E   L L K +H++PE+K +NPM QVPAIVD 
Sbjct  1    MALHLYIDLLSQPSRAIYIFCRVNNIEAEIHHLDLMKREHQTPEYKAVNPMGQVPAIVDN  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKLFESHAIL+YLA + PGV+ +WYPSD  +RA+IDS
Sbjct  61   GFKLFESHAILRYLATTKPGVSSNWYPSDPLRRARIDS  98



>ref|XP_009774395.1| PREDICTED: glutathione S-transferase T1-like, partial [Nicotiana 
sylvestris]
Length=172

 Score =   128 bits (322),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  80   PSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKLFESHAILK  259
            PSRA+LIFC++NGIDFEEV + L+K QH SPEFK++NP+ QVPAI+DGRFKLFESHAIL+
Sbjct  1    PSRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPLKQVPAIMDGRFKLFESHAILR  60

Query  260  YLACSFPGVADHWYPS  307
            YLAC+FPGVADH + +
Sbjct  61   YLACAFPGVADHCFQT  76



>gb|KJB52085.1| hypothetical protein B456_008G246200 [Gossypium raimondii]
Length=89

 Score =   125 bits (315),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DR+SQPSRAV+ FC+VNGID+EE+++ + KGQH +PE + IN M ++PAI DG
Sbjct  1    MKLNVYADRISQPSRAVVFFCKVNGIDYEEIKVHIPKGQHLTPECEAINLMQKLPAIADG  60

Query  224  RFKLFESHAILKYLACSFPGVADHW  298
            RFKLFESHAI  YLA +FPGVAD+W
Sbjct  61   RFKLFESHAIHIYLAYAFPGVADYW  85



>ref|XP_002960536.1| hypothetical protein SELMODRAFT_402877 [Selaginella moellendorffii]
 gb|EFJ38075.1| hypothetical protein SELMODRAFT_402877 [Selaginella moellendorffii]
Length=239

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 9/110 (8%)
 Frame = +2

Query  29   EGRKGMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVP  208
            +G+K + L  YV+ +SQPSRA++IFC++N I+ E   L + KG+HK+ EFK INPM QVP
Sbjct  3    QGKKDLHL--YVNIISQPSRAIIIFCKLNNIEAEVHHLDILKGEHKTTEFKAINPMGQVP  60

Query  209  AIVDGRFKLFE-------SHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            AIV+  FKLFE       SHAILKYLA + PGV D+WYPSD  +RA+IDS
Sbjct  61   AIVENGFKLFERLTSKIRSHAILKYLAGTCPGVPDNWYPSDPQQRAQIDS  110



>ref|XP_002967183.1| hypothetical protein SELMODRAFT_407994 [Selaginella moellendorffii]
 gb|EFJ31782.1| hypothetical protein SELMODRAFT_407994 [Selaginella moellendorffii]
Length=239

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 9/110 (8%)
 Frame = +2

Query  29   EGRKGMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVP  208
            +G+K + L  YV+ +SQPSRA++IFC++N I+ E   L + KG+HK+ EFK INPM QVP
Sbjct  3    QGKKDLHL--YVNIISQPSRAIIIFCKLNNIEAEVHHLDILKGEHKTTEFKAINPMGQVP  60

Query  209  AIVDGRFKLFE-------SHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            AIV+  FKLFE       SHAILKYLA + PGV D+WYPSD  +RA+IDS
Sbjct  61   AIVENGFKLFERLTSRLCSHAILKYLAGTCPGVPDNWYPSDPQQRAQIDS  110



>ref|XP_008794198.1| PREDICTED: glutathione S-transferase T1 isoform X2 [Phoenix dactylifera]
Length=232

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 70/98 (71%), Gaps = 18/98 (18%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DR+SQPSRA++IFC++NGIDFEEV + L K QH+SPEFK+INPM QVPAIVDG
Sbjct  1    MKLKVYADRLSQPSRAIVIFCKLNGIDFEEVPIDLTKRQHRSPEFKEINPMGQVPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFE                   YP+DLF RAKIDS
Sbjct  61   RFKLFER------------------YPADLFNRAKIDS  80



>ref|XP_010676472.1| PREDICTED: glutathione S-transferase T1-like [Beta vulgaris subsp. 
vulgaris]
Length=239

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +2

Query  47   TLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGR  226
             L +Y DR SQP+RAV++FC +NGI+FEE  ++L   +H SPEF++INP+ ++P I  G 
Sbjct  5    VLKIYGDRKSQPTRAVMLFCNLNGIEFEEHTIELFNQEHLSPEFQEINPVREIPVIFHGD  64

Query  227  FKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             +LFESHAIL YLA  FP VA+HWYP+D  KRA + S
Sbjct  65   LRLFESHAILIYLASVFPDVANHWYPADAKKRALVHS  101



>gb|ACI16511.1| glutathione S-transferase [Cucumis sativus]
Length=184

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  125  FEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKLFESHAILKYLACSFPGVADHWYP  304
            FEEV++ L+K +H +PEFK+INPM +VP IVDGRFKLFESHAIL Y++C+FPGVADHWYP
Sbjct  1    FEEVKVTLSKFEHLTPEFKEINPMGKVPVIVDGRFKLFESHAILIYISCAFPGVADHWYP  60

Query  305  SDLFKRAKIDS  337
            +DLF+RAKI S
Sbjct  61   ADLFRRAKIHS  71



>gb|KJB52088.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=232

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 18/98 (18%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGID+EE+++ ++KGQH +PEF +INPM Q+PAI DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            RFKLFE                   YP+D+FKR+KI S
Sbjct  61   RFKLFER------------------YPADVFKRSKIHS  80



>ref|XP_006822345.1| PREDICTED: glutathione S-transferase theta-1-like [Saccoglossus 
kowalevskii]
Length=228

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M LTVY D MSQP R+VL+FC VNGI +E+  + + KG+H S EF +INP  ++PAI DG
Sbjct  1    MVLTVYYDVMSQPCRSVLLFCEVNGIPYEKEVVSIGKGEHMSEEFSQINPENKLPAIKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AILKYLA  +   ADHWYP DL KRAK+D 
Sbjct  61   LFCLRESVAILKYLAAKY-NTADHWYPRDLQKRAKVDE  97



>ref|XP_002509787.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF51174.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=238

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +YV R+S+PSRA++ FC++NGI+FEE+++ L KGQHKSPEFK I       +  + 
Sbjct  1    MELKLYVHRLSEPSRALIAFCKLNGIEFEEIEIDLVKGQHKSPEFKVITETEYHASKFEK  60

Query  224  RF-KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             + +    HAIL YLA +FPGVADHWYP+DL KRAK+ +
Sbjct  61   LYHRTMYCHAILGYLASAFPGVADHWYPADLQKRAKVHA  99



>ref|XP_004503732.1| PREDICTED: tRNA 2'-phosphotransferase 1-like isoform X1 [Cicer 
arietinum]
Length=305

 Score =   114 bits (284),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRA+LIFC+VNGIDFEE+Q++L+K QH SPEF+ INP  +VPAIVDG
Sbjct  1    MKLKVYTDRMSQPSRAILIFCKVNGIDFEEIQIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  224  RFKLFESHA  250
            RFKLFES  
Sbjct  61   RFKLFESSG  69



>ref|XP_010573725.1| PREDICTED: glutathione S-transferase theta-1-like [Haliaeetus 
leucocephalus]
Length=244

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R NGI FE  Q++L KGQH++ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNGIPFEFKQVELMKGQHRTEEFRKVNVLMKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YLA  F    DHWYPSDL KRA++D 
Sbjct  61   SFTLAESIAILLYLARKF-KTPDHWYPSDLQKRARVDE  97



>ref|XP_001767888.1| predicted protein [Physcomitrella patens]
 gb|EDQ67402.1| predicted protein, partial [Physcomitrella patens]
Length=224

 Score =   112 bits (279),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L +YVD  SQP+RAV IFCRVN I+  E+ + L K ++++PEF+KINPM  VP I D  F
Sbjct  1    LKLYVDLGSQPARAVTIFCRVNKIEAHEIGVDLRKLENRTPEFRKINPMGLVPCIDDHGF  60

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KL ESHAI++YLA +   VADHWYP D  KRA +D+
Sbjct  61   KLHESHAIMRYLATTH-NVADHWYPKDPQKRALVDA  95



>gb|AFZ39143.1| theta class glutathione S-transferase [Physcomitrella patens]
Length=251

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L +YVD  SQP+RAV IFCRVN I+  E+ + L K ++++PEF+KINPM  VP I D  F
Sbjct  12   LKLYVDLGSQPARAVTIFCRVNKIEAHEIGVDLRKLENRTPEFRKINPMGLVPCIDDHGF  71

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KL ESHAI++YLA +   VADHWYP D  KRA +D+
Sbjct  72   KLHESHAIMRYLATTH-NVADHWYPKDPQKRALVDA  106



>gb|KJB25825.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=232

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 18/98 (18%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VY DRMSQPSRAV+IFC+VNGID+ E+++ ++K +H +PEF +INPM Q+PAIVDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            +FKLFE                   YP++LFKR+KI S
Sbjct  61   KFKLFER------------------YPANLFKRSKIHS  80



>ref|XP_008678005.1| PREDICTED: glutathione S-transferase T1-like [Zea mays]
Length=237

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 64/96 (67%), Gaps = 18/96 (19%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            + VY  R S PSRAV+IFCRVN IDFEEV + L K +H++PEFKKINPM QVP IVDGRF
Sbjct  4    IKVYAHRWSSPSRAVIIFCRVNKIDFEEVTVDLFKSRHRTPEFKKINPMAQVPVIVDGRF  63

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
            KLFE                   YP+DLF RAKI+S
Sbjct  64   KLFER------------------YPTDLFSRAKIES  81



>ref|XP_005054826.1| PREDICTED: glutathione S-transferase theta-1-like [Ficedula albicollis]
Length=241

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N I FE  ++QLAKGQHK+ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKKVQLAKGQHKTEEFRKVNVLMKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   F    DHWYPSDL KRA++D 
Sbjct  61   SFTLAESIAILLYLVQKF-KTPDHWYPSDLQKRARVDE  97



>ref|XP_010396446.1| PREDICTED: glutathione S-transferase theta-1-like [Corvus cornix 
cornix]
Length=244

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N I FE  ++QLAKGQHK+ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKRVQLAKGQHKTEEFQKVNVLMKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   F    DHWYPSDL KRA++D 
Sbjct  61   SFTLAESIAILLYLVQKF-KTPDHWYPSDLQKRARVDE  97



>ref|XP_002200008.1| PREDICTED: glutathione S-transferase theta-1-like [Taeniopygia 
guttata]
Length=241

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N I FE  ++QLAKGQHK+ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNKIPFEFKRVQLAKGQHKTEEFRKVNVLMKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   F    DHWYPSDL KRA++D 
Sbjct  61   SFTLAESIAILLYLVQKF-KTPDHWYPSDLQKRARVDE  97



>ref|XP_005524538.1| PREDICTED: glutathione S-transferase theta-1-like [Pseudopodoces 
humilis]
Length=244

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N I FE  ++QL+KGQHK+ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARANNIPFEFKRVQLSKGQHKTEEFQKVNVLMKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   F    DHWYPSDL KRA++D 
Sbjct  61   SFTLAESIAILLYLVRKF-KTPDHWYPSDLQKRARVDE  97



>ref|XP_005023587.1| PREDICTED: glutathione S-transferase theta-1-like [Anas platyrhynchos]
Length=242

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N I FE   ++L KGQH++ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARTNNIPFEFKHVELMKGQHRTEEFRKVNMLMKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YLA  F    DHWYPSDL KRA++D 
Sbjct  61   SFTLAESIAILLYLARKFK-TPDHWYPSDLQKRARVDE  97



>ref|XP_009090481.1| PREDICTED: glutathione S-transferase theta-1-like [Serinus canaria]
Length=241

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N I FE  ++QL KGQHK+ EF+++N + +VPA+ DG
Sbjct  1    MGLEMYLDLLSQPCRALYIFARSNNIPFEFKRVQLTKGQHKTEEFRQVNVLMKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YLA  F    DHWYP+DL KRA++D 
Sbjct  61   SFTLAESIAILLYLAQKF-KTPDHWYPADLQKRARVDE  97



>ref|XP_010718625.1| PREDICTED: glutathione S-transferase theta-1-like [Meleagris 
gallopavo]
Length=242

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV +F R N I FE  +++L KGQH++ EFKK+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYLFARCNNIPFEFKRVELMKGQHRTEEFKKVNVLMKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YLA  F    DHWYPSDL K+A++D 
Sbjct  61   SFTLAESVAILMYLARKF-KTPDHWYPSDLQKQARVDE  97



>ref|XP_008500992.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase theta-1-like 
[Calypte anna]
Length=242

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N I FE  +++L KGQH++ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARNNNIPFEFKKVELMKGQHRTEEFRKVNILMKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YLA  F    DHWYPSDL KRA++D 
Sbjct  61   SFTLSESIAILLYLARKFK-TPDHWYPSDLEKRARVDE  97



>ref|XP_005848771.1| hypothetical protein CHLNCDRAFT_57549 [Chlorella variabilis]
 gb|EFN56669.1| hypothetical protein CHLNCDRAFT_57549 [Chlorella variabilis]
Length=243

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +2

Query  56   VYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKL  235
            ++VDR+SQPSR  LIFCRV GI FEE  + L K +   PEF  +NP+ +VPA+ DG F L
Sbjct  8    LFVDRLSQPSRTCLIFCRVAGIPFEEKVVTLGKKEQLRPEFLAVNPLGKVPALQDGAFCL  67

Query  236  FESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             ES AILKYL C     ADHWYP DL  RA++D+
Sbjct  68   PESSAILKYL-CGSRRAADHWYPRDLRARAQLDA  100



>ref|XP_007973333.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase theta-2B-like 
[Chlorocebus sabaeus]
Length=244

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQPSRAV IF + NGI FE   + + KGQH+S EF +IN + +VP + DG
Sbjct  1    MGLELYLDLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFSQINSLQKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +   ADHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTADHWYPSDLQARARV  95



>gb|EWS75951.1| glutathione S-transferase, amine-terminal domain protein [Tetrahymena 
thermophila SB210]
Length=229

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  47   TLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGR  226
            TL++Y+D MSQPSR V IFC +N I  +  ++++ KGQ +S E+K+INP  +VP I DG+
Sbjct  7    TLSLYMDWMSQPSRCVAIFCMINKIPVDISEVKILKGQLRSQEYKRINPNMRVPTIKDGK  66

Query  227  FKLFESHAILKYLACSFPG-VADHWYPSDLFKRAKID  334
            F L+ESHAILKYL  S    + +HWYP D+ +RA +D
Sbjct  67   FVLYESHAILKYLIASRAQYIPEHWYPKDIKERALVD  103



>ref|XP_005147828.1| PREDICTED: glutathione S-transferase theta-1-like [Melopsittacus 
undulatus]
Length=242

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N I FE  Q++L KG+HK+ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKQVELIKGEHKTEEFQKVNLLMKVPAMRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL Y+   F    DHWYPSDL KRA++D 
Sbjct  61   SFTLAESIAILLYMVRKF-KTPDHWYPSDLQKRARVDE  97



>gb|KFO57915.1| Glutathione S-transferase theta-1, partial [Corvus brachyrhynchos]
Length=240

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N    E  ++QLAKGQHK+ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNNPLEFKRVQLAKGQHKTEEFQKVNVLMKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   F    DHWYPSDL KRA++D 
Sbjct  61   SFTLAESIAILLYLVQKF-KTPDHWYPSDLQKRARVDE  97



>gb|ABQ82132.1| glutathione S-transferase theta [Alitta succinea]
Length=226

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L +Y D MSQPSRAV IF +  GI FEE  + L KG+H++ EF KINP   VP I DG F
Sbjct  4    LKLYFDLMSQPSRAVWIFLKATGIPFEEKPVALRKGEHQTEEFAKINPFQLVPVIDDGGF  63

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             L+ES +I KYLA S   +ADHWYPS+L  RA+I+S
Sbjct  64   VLYESLSICKYLAKS-RNLADHWYPSELKHRARIES  98



>ref|XP_008630325.1| PREDICTED: glutathione S-transferase theta-1-like [Corvus brachyrhynchos]
Length=244

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N    E  ++QLAKGQHK+ EF+K+N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNNPLEFKRVQLAKGQHKTEEFQKVNVLMKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   F    DHWYPSDL KRA++D 
Sbjct  61   SFTLAESIAILLYLVQKF-KTPDHWYPSDLQKRARVDE  97



>ref|XP_006584714.1| PREDICTED: glutathione S-transferase T2-like isoform X2 [Glycine 
max]
 gb|KHN16830.1| Glutathione S-transferase T2 [Glycine soja]
Length=234

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 18/96 (19%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L VY D+MSQPSRAVLIFCR NGIDFEE+++ ++K  H SPEF++INP+ +VPAIV G F
Sbjct  5    LKVYADQMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREINPLQKVPAIVHGSF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             L E                   YPS+LF+RAKI+S
Sbjct  65   NLSER------------------YPSNLFRRAKINS  82



>ref|XP_003919135.1| PREDICTED: glutathione S-transferase theta-2B [Papio anubis]
Length=244

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQPSRAV IF + NGI FE   + + KGQH+S EF +IN + +VP + DG
Sbjct  1    MGLELYLDLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFFQINSLQKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +   ADHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTADHWYPSDLQARARV  95



>ref|XP_007451118.1| PREDICTED: glutathione S-transferase theta-1-like [Lipotes vexillifer]
Length=240

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S +F ++NP+ +VPA+ DG
Sbjct  1    MGLQLYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHYSDDFAQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL C +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLTCKYEA-PDHWYPQDLQARARVDE  97



>ref|XP_004742534.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Mustela putorius furo]
 ref|XP_004817181.1| PREDICTED: glutathione S-transferase theta-1-like [Mustela putorius 
furo]
Length=240

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE  Q++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRQVELLKGQHHSDAFAQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +  V DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-EVPDHWYPQDLQARARVDE  97



>ref|XP_005503935.1| PREDICTED: glutathione S-transferase theta-1-like [Columba livia]
Length=241

 Score =   104 bits (259),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF R N I FE  ++ L KGQH+  EF+K+N + QVPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKRVDLMKGQHRLEEFRKVNLLMQVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   F    DHWYPSDL +RA++D 
Sbjct  61   SFTLAESIAILLYLVRKF-KTPDHWYPSDLQQRARVDE  97



>ref|XP_001231971.3| PREDICTED: glutathione S-transferase theta-1-like isoform 1 [Gallus 
gallus]
Length=322

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = +2

Query  5    RYRRR*ESEG-RKG-MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEF  178
            R R R +  G R G M L +Y+D +SQP RAV IF R N I FE  +++L KG+H++ EF
Sbjct  58   RLRDRTDGTGARSGSMGLELYLDLLSQPCRAVYIFARCNSIPFEFKRVELMKGEHRTEEF  117

Query  179  KKINPMTQVPAIVDGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
            +K+N + +VPA+ DG F L ES AIL YL   F    DHWYPSDL K+A++D
Sbjct  118  RKVNVLMKVPALRDGSFTLAESVAILMYLTRKFK-TPDHWYPSDLQKQARVD  168



>gb|AHC08064.1| theta glutathione S-transferase [Locusta migratoria]
Length=231

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M+L  Y D  SQPSRAVL+  ++N I FE  ++ L KG+H S E+ KINP  +VP IV G
Sbjct  1    MSLKFYYDIFSQPSRAVLLLLKLNKIPFESKKINLLKGEHFSEEYAKINPFQKVPVIVHG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F LFES AIL+YL   F  VADHWYP D   +AK+D 
Sbjct  61   DFALFESVAILRYLCREFE-VADHWYPKDSKAQAKVDE  97



>ref|XP_001106693.1| PREDICTED: glutathione S-transferase theta-2 isoform 2 [Macaca 
mulatta]
Length=244

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y++ +SQPSRAV IF + NGI FE   + + KGQH+S EF +IN + +VP + DG
Sbjct  1    MGLELYLNLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFFQINSLQKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +   ADHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTADHWYPSDLQARARV  95



>gb|EHH62577.1| hypothetical protein EGM_20970 [Macaca fascicularis]
Length=244

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y++ +SQPSRAV IF + NGI FE   + + KGQH+S EF +IN + +VP + DG
Sbjct  1    MGLELYLNLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFFQINSLQKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +   ADHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTADHWYPSDLQARARV  95



>ref|XP_001106578.1| PREDICTED: glutathione S-transferase theta-2 isoform 1 [Macaca 
mulatta]
Length=230

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y++ +SQPSRAV IF + NGI FE   + + KGQH+S EF +IN + +VP + DG
Sbjct  1    MGLELYLNLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFFQINSLQKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +   ADHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTADHWYPSDLQARARV  95



>ref|NP_001244563.1| glutathione S-transferase theta 2 [Macaca mulatta]
 ref|NP_001276888.1| glutathione S-transferase theta 2 [Macaca fascicularis]
 ref|XP_010368124.1| PREDICTED: glutathione S-transferase theta-2B [Rhinopithecus 
roxellana]
 gb|EHH25432.1| hypothetical protein EGK_21203 [Macaca mulatta]
 gb|AHH29315.1| glutathione S-transferase T2 [Macaca fascicularis]
 gb|AHH29316.1| glutathione S-transferase T2 [Macaca mulatta]
Length=244

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y++ +SQPSRAV IF + NGI FE   + + KGQH+S EF +IN + +VP + DG
Sbjct  1    MGLELYLNLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFFQINSLQKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +   ADHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTADHWYPSDLQARARV  95



>gb|EHH16568.1| hypothetical protein EGK_11862 [Macaca mulatta]
Length=230

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y++ +SQPSRAV IF + NGI FE   + + KGQH+S EF +IN + +VP + DG
Sbjct  1    MGLELYLNLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFFQINSLQKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +   ADHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTADHWYPSDLQARARV  95



>ref|XP_007957332.1| PREDICTED: glutathione S-transferase theta-1-like [Orycteropus 
afer afer]
Length=240

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH+S  F ++NPM +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHQSDAFAQVNPMQKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-QTPDHWYPQDLQTRARVDE  97



>ref|XP_004742533.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Mustela putorius furo]
Length=333

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE  Q++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRQVELLKGQHHSDAFAQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             F L ES AIL YL+  +  V DHWYP DL  RA++D
Sbjct  61   DFTLAESVAILLYLSRKYE-VPDHWYPQDLQARARVD  96



>gb|KGL79187.1| Glutathione S-transferase theta-1, partial [Tinamus guttatus]
Length=232

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  74   SQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKLFESHAI  253
            SQP RA+ +F + N I FE  +++L KGQHKS EF+K+NPM +VPA+ DG F L ES AI
Sbjct  3    SQPCRALYLFAKSNNIPFEFKRVELMKGQHKSKEFRKVNPMMKVPALEDGSFLLSESIAI  62

Query  254  LKYLACSFPGVADHWYPSDLFKRAKID  334
            L YLA  F    DHWYPSDL KRA++D
Sbjct  63   LLYLARKF-KTPDHWYPSDLQKRARVD  88



>ref|XP_004636372.1| PREDICTED: glutathione S-transferase theta-1-like [Octodon degus]
Length=240

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D MSQP RAV IFC+ NGI F+   ++L KGQH +  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFCKKNGIPFQLRPVELLKGQHYTDSFAQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             F L ES AIL YL+  +    DHWYP DL  RA++D
Sbjct  61   DFTLAESVAILLYLSRKY-KTPDHWYPQDLQARARVD  96



>ref|XP_007092374.1| PREDICTED: glutathione S-transferase theta-1-like [Panthera tigris 
altaica]
Length=240

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLISQPCRAVYIFAKKNGIPFELRTVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL C    V DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYL-CRKYEVPDHWYPQDLQARARVDE  97



>ref|XP_003994893.1| PREDICTED: glutathione S-transferase theta-1-like [Felis catus]
Length=240

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLISQPCRAVYIFAKKNGIPFELRTVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL C    V DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYL-CRKYEVPDHWYPQDLQARARVDE  97



>ref|XP_004680982.1| PREDICTED: glutathione S-transferase theta-1-like [Condylura 
cristata]
Length=240

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   +  V DHWYP DL  RA++D 
Sbjct  61   NFTLTESVAILLYLTHKY-KVPDHWYPPDLQTRARVDE  97



>ref|XP_004346352.1| glutathione S-transferase domain-containing protein [Capsaspora 
owczarzaki ATCC 30864]
 gb|KJE95201.1| glutathione S-transferase domain-containing protein [Capsaspora 
owczarzaki ATCC 30864]
Length=231

 Score =   102 bits (253),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            L++Y D MSQPSRAVLI  R N + F    + + KG    PEFKKINP  ++P I D  F
Sbjct  5    LSLYFDAMSQPSRAVLILLRANNLPFTPKIINVVKGDQYKPEFKKINPNKKIPVIDDNGF  64

Query  230  KLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             LFESHAIL+YL C+   + DHWYP D  KRA +D
Sbjct  65   VLFESHAILRYL-CNKYNLPDHWYPKDPQKRALVD  98



>ref|XP_004607625.1| PREDICTED: glutathione S-transferase theta-1-like [Sorex araneus]
Length=240

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFEMRTVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  F    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKF-ETPDHWYPQDLQARARVDE  97



>ref|XP_790223.2| PREDICTED: glutathione S-transferase theta-1-like [Strongylocentrotus 
purpuratus]
Length=227

 Score =   102 bits (253),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M + VYVD  SQP RA+++F + + I  E V+L L KG  K PEF  INP+ Q PAI DG
Sbjct  1    MVIKVYVDLGSQPCRALVVFLKHSSIPHEIVELDLGKGDQKKPEFAAINPLKQFPAIKDG  60

Query  224  RFKLFESHAILKYLACSFP-GVADHWYPSDLFKRAKIDS  337
             F L E+ AI +YL   FP   +DHWYP+D  +RAK+D 
Sbjct  61   DFCLAETVAIFRYLTTQFPKSFSDHWYPADPHRRAKVDE  99



>ref|XP_005334523.1| PREDICTED: glutathione S-transferase theta-2B-like [Ictidomys 
tridecemlineatus]
 ref|XP_005334524.1| PREDICTED: glutathione S-transferase theta-2B-like [Ictidomys 
tridecemlineatus]
Length=275

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +2

Query  41   GMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVD  220
             M L +Y+D +SQP RAV IF + NGI F+   +QL KGQ+ S EF +IN + +VP + D
Sbjct  31   AMGLELYLDLLSQPCRAVFIFAKKNGIPFQLRTVQLLKGQNCSKEFLQINSLQRVPVLKD  90

Query  221  GRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
            G F L ES AIL YL+C +  VADHWYPSDL  R++I
Sbjct  91   GDFILTESSAILIYLSCKY-QVADHWYPSDLQTRSQI  126



>ref|XP_006746108.1| PREDICTED: glutathione S-transferase theta-1-like [Leptonychotes 
weddellii]
Length=240

 Score =   102 bits (253),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRPVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +  V DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-EVPDHWYPQDLQARARVDE  97



>ref|XP_003639976.1| PREDICTED: glutathione S-transferase theta-1-like [Canis lupus 
familiaris]
Length=240

 Score =   102 bits (253),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRPVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +  V DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-EVPDHWYPQDLQARARVDE  97



>ref|XP_010953752.1| PREDICTED: glutathione S-transferase theta-2 isoform X1 [Camelus 
bactrianus]
 ref|XP_010985618.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Camelus dromedarius]
Length=208

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S +F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHHSDDFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-ETPDHWYPQDLQARARVDE  97



>ref|XP_004400592.1| PREDICTED: glutathione S-transferase theta-1-like [Odobenus rosmarus 
divergens]
Length=240

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQPSRAV IF + NGI FE   ++L KGQ  S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPSRAVYIFAKKNGIPFELRSVELLKGQQHSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +  V DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-EVPDHWYPQDLQARARVDE  97



>ref|XP_010215724.1| PREDICTED: glutathione S-transferase theta-1-like [Tinamus guttatus]
Length=308

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  74   SQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKLFESHAI  253
            SQP RA+ +F + N I FE  +++L KGQHKS EF+K+NPM +VPA+ DG F L ES AI
Sbjct  75   SQPCRALYLFAKSNNIPFEFKRVELMKGQHKSKEFRKVNPMMKVPALEDGSFLLSESIAI  134

Query  254  LKYLACSFPGVADHWYPSDLFKRAKID  334
            L YLA  F    DHWYPSDL KRA++D
Sbjct  135  LLYLARKF-KTPDHWYPSDLQKRARVD  160



>gb|ELK15601.1| Glutathione S-transferase theta-1 [Pteropus alecto]
Length=226

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSNAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   +  V DHWYP DL  RA++D 
Sbjct  61   DFILTESVAILLYLTRKY-KVPDHWYPQDLQARARVDE  97



>ref|XP_004063210.1| PREDICTED: glutathione S-transferase theta-2-like isoform 1 [Gorilla 
gorilla gorilla]
Length=244

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M+L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MSLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLIKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTPDHWYPSDLQARARV  95



>gb|AFW60455.1| hypothetical protein ZEAMMB73_761144 [Zea mays]
Length=272

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +2

Query  50   LTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRF  229
            + VY  R S PSRAV+IFCRVN IDFEEV + L K +H++PEFKKINPM QVP IVDGRF
Sbjct  4    IKVYAHRWSSPSRAVIIFCRVNKIDFEEVTVDLFKSRHRTPEFKKINPMAQVPVIVDGRF  63

Query  230  KLFESHAILKYLACS  274
            KLFE   +   L  S
Sbjct  64   KLFERLKLTASLVTS  78



>ref|XP_004063211.1| PREDICTED: glutathione S-transferase theta-2-like isoform 2 [Gorilla 
gorilla gorilla]
Length=230

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M+L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MSLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLIKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTPDHWYPSDLQARARV  95



>pdb|4MPG|A Chain A, Crystal Structure Of Human Glutathione Transferase Theta-2, 
Complex With Glutathione And Unknown Ligand, Target 
Efi-507257
 pdb|4MPG|B Chain B, Crystal Structure Of Human Glutathione Transferase Theta-2, 
Complex With Glutathione And Unknown Ligand, Target 
Efi-507257
Length=266

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  38   KGMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIV  217
            + M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + 
Sbjct  21   QSMGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLK  80

Query  218  DGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
            DG F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  81   DGDFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  117



>ref|XP_006908737.1| PREDICTED: glutathione S-transferase theta-1-like [Pteropus alecto]
Length=240

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSNAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   +  V DHWYP DL  RA++D 
Sbjct  61   DFILTESVAILLYLTRKY-KVPDHWYPQDLQARARVDE  97



>ref|XP_003730181.1| PREDICTED: glutathione S-transferase theta-1-like [Strongylocentrotus 
purpuratus]
Length=226

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L VYVD  SQP RA++IF +   I FE   + L  G HK PEF KI P+  +PAI DG
Sbjct  1    MLLKVYVDLRSQPCRALIIFLKNTKIPFEIETINLRTGDHKKPEFVKITPLCTLPAIQDG  60

Query  224  RFKLFESHAILKYLACSFPG-VADHWYPSDLFKRAKIDS  337
             F L E+ AI++YLA  +   V DHWYP DL KRA++D 
Sbjct  61   DFSLGETVAIIRYLATKYSDLVPDHWYPKDLKKRARVDE  99



>pdb|4MPF|A Chain A, Crystal Structure Of Human Glutathione Transferase Theta-2, 
Complex With Inorganic Phosphate, Gsh Free, Target Efi-507257
 pdb|4MPF|B Chain B, Crystal Structure Of Human Glutathione Transferase Theta-2, 
Complex With Inorganic Phosphate, Gsh Free, Target Efi-507257
Length=266

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  38   KGMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIV  217
            + M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + 
Sbjct  21   QSMGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLK  80

Query  218  DGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
            DG F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  81   DGDFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  117



>ref|XP_002834662.1| PREDICTED: glutathione S-transferase theta-2B [Pongo abelii]
Length=244

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLLSQPSRAVYIFAKKNGIPLELRTVDLIKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|NP_000845.2| glutathione S-transferase theta-2 isoform a [Homo sapiens]
 sp|P0CG29.1|GST2_HUMAN RecName: Full=Glutathione S-transferase theta-2; AltName: Full=GST 
class-theta-2 [Homo sapiens]
 gb|AAG02373.1| glutathione S-transferase theta 2 [Homo sapiens]
Length=244

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|NP_001074312.1| glutathione S-transferase theta-2B [Homo sapiens]
 sp|P0CG30.1|GSTT2_HUMAN RecName: Full=Glutathione S-transferase theta-2B; AltName: Full=GST 
class-theta-2; AltName: Full=Glutathione S-transferase 
theta-2 [Homo sapiens]
 pdb|1LJR|A Chain A, Glutathione Transferase (Hgst T2-2) From Human
 pdb|1LJR|B Chain B, Glutathione Transferase (Hgst T2-2) From Human
 pdb|2LJR|A Chain A, Glutathione Transferase Apo-Form From Human
 pdb|2LJR|B Chain B, Glutathione Transferase Apo-Form From Human
 pdb|3LJR|A Chain A, Glutathione Transferase (Theta Class) From Human In 
Complex With The Glutathione Conjugate Of 1-Menaphthyl Sulfate
 pdb|3LJR|B Chain B, Glutathione Transferase (Theta Class) From Human In 
Complex With The Glutathione Conjugate Of 1-Menaphthyl Sulfate
 gb|AAB63956.1| glutathione S-transferase theta 2 [Homo sapiens]
 gb|AAH02415.1| Glutathione S-transferase theta 2 [Homo sapiens]
 emb|CAG30386.1| GSTT2 [Homo sapiens]
 gb|AAH71700.1| Glutathione S-transferase theta 2B (gene/pseudogene) [Homo sapiens]
 gb|AAX32146.1| glutathione S-transferase theta 2 [synthetic construct]
 emb|CAK54528.1| GSTT2 [synthetic construct]
 emb|CAK54827.1| GSTT2 [synthetic construct]
 gb|EAW59626.1| glutathione S-transferase theta 2, isoform CRA_b [Homo sapiens]
 gb|ABM81668.1| glutathione S-transferase theta 2 [synthetic construct]
 gb|AAI46930.1| Glutathione S-transferase theta 2B (gene/pseudogene) [Homo sapiens]
 gb|AAI46937.1| Glutathione S-transferase theta 2B (gene/pseudogene) [Homo sapiens]
 gb|AAI46941.1| Glutathione S-transferase theta 2 [Homo sapiens]
 gb|AAI46944.1| Glutathione S-transferase theta 2 [Homo sapiens]
 dbj|BAI46309.1| glutathione S-transferase theta 2 [synthetic construct]
 gb|AEW26631.1| GSTT2 [Homo sapiens]
 gb|AIC54514.1| GSTT2 [synthetic construct]
 gb|AIC58329.1| GSTT2B, partial [synthetic construct]
Length=244

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|XP_005261772.1| PREDICTED: glutathione S-transferase theta-2B isoform X1 [Homo 
sapiens]
 emb|CAG30260.1| Em:AP000351.3 [Homo sapiens]
 emb|CAK54510.1| GSTT2 [synthetic construct]
 emb|CAK54809.1| GSTT2 [synthetic construct]
 gb|EAW59625.1| glutathione S-transferase theta 2, isoform CRA_a [Homo sapiens]
Length=230

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>gb|AEW26632.1| GSTT2 [Homo sapiens]
Length=244

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|XP_010953754.1| PREDICTED: glutathione S-transferase theta-2 isoform X2 [Camelus 
bactrianus]
Length=240

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S +F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHHSDDFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKYE-TPDHWYPQDLQARARVDE  97



>gb|AAV38755.1| glutathione S-transferase theta 2 [synthetic construct]
 gb|AAX42853.1| glutathione S-transferase theta 2, partial [synthetic construct]
 gb|AAX43772.1| glutathione S-transferase theta 2, partial [synthetic construct]
Length=245

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>gb|AAC13317.1| glutathione S-transferase theta 2 [Homo sapiens]
Length=242

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKY-QTPDHWYPSDLQARARV  95



>ref|XP_008825395.1| PREDICTED: glutathione S-transferase theta-1-like, partial [Nannospalax 
galili]
Length=134

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI F+   ++L KGQH +  F KINP+ +VPA+ DG
Sbjct  1    MGLELYLDLISQPCRAVYIFAKKNGIPFQLHTVELFKGQHHTDAFVKINPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             F L ES AIL YL+  +    DHWYP DL  RA++D
Sbjct  61   DFTLAESVAILLYLSRKY-KAPDHWYPEDLQARARVD  96



>ref|NP_001289599.1| glutathione S-transferase theta-2 isoform b [Homo sapiens]
Length=230

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|XP_010985617.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Camelus dromedarius]
 gb|AHN49806.1| glutahione S-transferase theta [synthetic construct]
Length=240

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S +F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHHSDDFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKYE-TPDHWYPQDLQARARVDE  97



>ref|XP_004466458.1| PREDICTED: glutathione S-transferase theta-1-like isoform 2 [Dasypus 
novemcinctus]
Length=239

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKRNGIPFELRPVELLKGQHHSEAFVRVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL C      DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYL-CHKYKAPDHWYPQDLQARARVDE  97



>ref|XP_006106312.1| PREDICTED: glutathione S-transferase theta-1-like [Myotis lucifugus]
Length=240

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSDAFVQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             F L ES AIL YL   F  V DHWYP +L  RA++D
Sbjct  61   DFTLTESVAILLYLTRKF-KVPDHWYPQELQARARVD  96



>gb|EHH25431.1| hypothetical protein EGK_21202 [Macaca mulatta]
Length=240

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL C +  V D+WYP +L  RA++D 
Sbjct  61   DFTLTESVAILLYLTCKY-KVPDYWYPQNLQARARVDE  97



>ref|XP_004443156.1| PREDICTED: glutathione S-transferase theta-1-like [Ceratotherium 
simum simum]
Length=240

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHHSDAFVQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLTESVAILLYLSRKYKA-PDHWYPQDLQARARVDE  97



>ref|XP_005987168.1| PREDICTED: glutathione S-transferase theta-1-like isoform X3 
[Latimeria chalumnae]
Length=242

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y D +SQP RA+ IF RV G+ +   +  L +G+HKS E+ +INPM  +PA+V+ 
Sbjct  1    MALELYSDLLSQPCRALAIFLRVLGVPYTTRKTSLLEGEHKSAEYARINPMQSIPAMVEE  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AI+KYLA  +    DHWYP+D+ +RAK+D 
Sbjct  61   GFVLTESVAIIKYLAARY-NAPDHWYPADVRRRAKVDE  97



>ref|XP_003811115.1| PREDICTED: glutathione S-transferase theta-2B isoform X1 [Pan 
paniscus]
 gb|AEW26634.1| GSTT2 [Pan troglodytes]
 gb|AEW26635.1| GSTT2 [Pan troglodytes]
 gb|AEW26638.1| GSTT2 [Pan troglodytes]
Length=244

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLIKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|XP_515243.2| PREDICTED: glutathione S-transferase theta-2 [Pan troglodytes]
Length=244

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLIKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|XP_009006212.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Callithrix 
jacchus]
Length=230

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF + NGI FE   + L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNGIPFELRTVDLIKGQHLSDAFSQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   +  V DHWYP DL  RA++D 
Sbjct  61   DFTLSESVAILLYLTHKY-KVPDHWYPQDLQARARVDE  97



>gb|AEW26633.1| GSTT2B [Pan troglodytes]
Length=244

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLIKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>gb|AEW26637.1| GSTT2B [Pan troglodytes]
Length=244

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLIKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|XP_003727085.1| PREDICTED: glutathione S-transferase theta-1-like isoform 2 [Strongylocentrotus 
purpuratus]
Length=224

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M++ ++ D MSQP+R+VL+F R N I +    + + K +H+S E+  +NPM ++PA+ DG
Sbjct  1    MSVKIFYDLMSQPARSVLMFARANKIPYTPCPIAMRKSEHQSEEYAAVNPMKKIPAMQDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             FKL ES AI+KYL        DHWYPSDL  RAK+D 
Sbjct  61   EFKLTESIAIVKYLQAKH-ACPDHWYPSDLQTRAKVDE  97



>ref|XP_003811116.1| PREDICTED: glutathione S-transferase theta-2B isoform X2 [Pan 
paniscus]
Length=230

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLIKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|XP_001929409.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Sus scrofa]
Length=240

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S +F ++NP+ +VPA+ DG
Sbjct  1    MVLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHFSDDFAQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKYEA-PDHWYPQDLQTRARVDE  97



>ref|XP_005396465.1| PREDICTED: glutathione S-transferase theta-1-like [Chinchilla 
lanigera]
Length=240

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D MSQP RAV IF + NGI F+   ++L KGQH +  F +INP+ +VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTVELLKGQHYTDSFAQINPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-KTPDHWYPQDLQARARVDE  97



>ref|XP_006130307.1| PREDICTED: glutathione S-transferase theta-1-like [Pelodiscus 
sinensis]
Length=239

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M + +++D +SQP RA+ IF + N I FE   ++L KGQH S EF K+N + +VPA+ DG
Sbjct  1    MVVELFLDLLSQPCRALFIFAKKNNIPFEFKHVELIKGQHLSEEFGKVNVLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   F    DHWYPSDL KRA++D 
Sbjct  61   TFTLAESIAILLYLRRKF-NTPDHWYPSDLRKRARVDE  97



>ref|XP_005987166.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Latimeria chalumnae]
 ref|XP_005987167.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Latimeria chalumnae]
Length=242

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y D +SQP RA+ IF RV G+ +   +  L +G+HKS E+ +INPM  +PA+V+ 
Sbjct  1    MALELYSDLLSQPCRALAIFLRVLGVPYTTRKTSLLEGEHKSAEYARINPMQSIPAMVEE  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AI+KYLA  +    DHWYP+D+ +RAK+D 
Sbjct  61   GFVLTESVAIIKYLAARY-NAPDHWYPADVRRRAKVDE  97



>emb|CAA66665.1| glutathione S-transferase theta [Mus musculus]
Length=240

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF + N I F+   ++L KG+H S  F ++NPM +VPA++DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKKVPAMMDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YLA  +  V DHWYP DL  RA++D 
Sbjct  61   GFTLCESVAILLYLAHKY-KVPDHWYPQDLQARARVDE  97



>ref|XP_007127246.1| PREDICTED: glutathione S-transferase theta-1-like [Physeter catodon]
Length=240

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S +F ++NP+ +VPA+ DG
Sbjct  1    MGLQLYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHYSDDFAQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLTRKYEA-PDHWYPQDLQARARVDE  97



>ref|XP_007196373.1| PREDICTED: glutathione S-transferase theta-1-like [Balaenoptera 
acutorostrata scammoni]
Length=240

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S +F ++NP+ +VPA+ DG
Sbjct  1    MGLQLYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHYSDDFAQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLTRKYEA-PDHWYPQDLQARARVDE  97



>dbj|BAB22023.1| unnamed protein product [Mus musculus]
Length=240

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF + N I F+   ++L KG+H S  F ++NPM +VPA++DG
Sbjct  1    MVLELYLDLLSQPRRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YLA  +  V DHWYP DL  RA++D 
Sbjct  61   GFTLCESVAILLYLAHKY-KVPDHWYPQDLQARARVDE  97



>ref|XP_006277068.1| PREDICTED: glutathione S-transferase theta-1-like [Alligator 
mississippiensis]
Length=242

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M + +++D +SQP RA+ IF + N I FE   + L KGQH + EF K+N + +VPA+ DG
Sbjct  1    MVVELFLDLLSQPCRALFIFAKKNNIPFELKHVDLLKGQHMTEEFDKVNALRKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  F    DHWYPSDL KRA++D 
Sbjct  61   AFTLAESTAILLYLSRKF-KTPDHWYPSDLQKRARVDE  97



>ref|NP_032211.3| glutathione S-transferase theta-1 [Mus musculus]
 sp|Q64471.4|GSTT1_MOUSE RecName: Full=Glutathione S-transferase theta-1; AltName: Full=GST 
class-theta-1 [Mus musculus]
 gb|AAH12254.1| Glutathione S-transferase, theta 1 [Mus musculus]
 gb|AAH55020.1| Glutathione S-transferase, theta 1 [Mus musculus]
 gb|EDL31888.1| glutathione S-transferase, theta 1, isoform CRA_c [Mus musculus]
Length=240

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF + N I F+   ++L KG+H S  F ++NPM +VPA++DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YLA  +  V DHWYP DL  RA++D 
Sbjct  61   GFTLCESVAILLYLAHKY-KVPDHWYPQDLQARARVDE  97



>emb|CAG33210.1| GSTT2 [Homo sapiens]
Length=244

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L KGQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESLAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>ref|XP_006019954.1| PREDICTED: glutathione S-transferase theta-1-like [Alligator 
sinensis]
Length=242

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M + +++D +SQP RA+ IF + N I FE   + L KGQH + EF K+N + +VPA+ DG
Sbjct  1    MVVELFLDLLSQPCRALFIFAKKNNIPFELKHVDLLKGQHMTEEFDKVNALRKVPALRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  F    DHWYPSDL KRA++D 
Sbjct  61   AFTLAESTAILLYLSRKF-KTPDHWYPSDLQKRARVDE  97



>ref|XP_004318777.1| PREDICTED: glutathione S-transferase theta-1-like, partial [Tursiops 
truncatus]
Length=239

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S +F ++NP+ +VPA+ DG
Sbjct  1    MGLQLYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHYSDDFAQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLTRKY-ETPDHWYPQDLQARARVDE  97



>dbj|BAG34980.1| unnamed protein product [Homo sapiens]
Length=244

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQPSRAV IF + NGI  E   + L +GQHKS EF +IN + ++P + DG
Sbjct  1    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVRGQHKSKEFLQINSLGKLPTLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+C +    DHWYPSDL  RA++
Sbjct  61   DFILTESSAILIYLSCKYQ-TPDHWYPSDLQARARV  95



>gb|ADO27893.1| glutathione S-transferase theta-1 [Ictalurus furcatus]
Length=241

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP R+V IF + N I FE  ++ L  G+H   EF KIN M +VPAI DG
Sbjct  1    MVLEIYLDLLSQPCRSVYIFTKKNNIQFEYKKVSLMAGEHHGEEFGKINVMRKVPAIRDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AI++YL   + G  DHWYP+DL KRA+++ 
Sbjct  61   DFCLGESIAIMQYLVEKY-GTPDHWYPADLQKRARVNE  97



>ref|XP_008248398.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Oryctolagus cuniculus]
Length=208

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D MSQP RAV IF + NGI F+   + L KGQH +  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLCPVDLLKGQHYTESFTQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-KAPDHWYPQDLQARARVDE  97



>ref|XP_006640254.1| PREDICTED: glutathione S-transferase theta-1-like [Lepisosteus 
oculatus]
Length=228

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +2

Query  41   GMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVD  220
            G  L VY+D +SQP RAVLIF + N I      + + KG +++PEF K+NPM +VP IVD
Sbjct  4    GKALEVYLDLLSQPCRAVLIFLKHNNIPHTVKTVAIRKGDNRTPEFTKLNPMQKVPVIVD  63

Query  221  GRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
              F L ES AILKYLA  +   A HWYP D  +RA++D 
Sbjct  64   HGFVLTESDAILKYLATQYKTAA-HWYPQDPERRARVDE  101



>ref|XP_008248399.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Oryctolagus cuniculus]
Length=198

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D MSQP RAV IF + NGI F+   + L KGQH +  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLCPVDLLKGQHYTESFTQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             F L ES AIL YL+  +    DHWYP DL  RA++D
Sbjct  61   DFTLAESVAILLYLSRKYKA-PDHWYPQDLQARARVD  96



>gb|AAB03534.1| glutathione transferase theta class type 2 [Mus musculus]
Length=244

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQPSRAV IF + NGI F+   + + KGQH S +F ++N + +VP + DG
Sbjct  1    MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+  +  VADHWYP+DL  RA++
Sbjct  61   SFVLTESTAILIYLSSKYQ-VADHWYPADLQARAQV  95



>ref|XP_005886352.1| PREDICTED: glutathione S-transferase theta-1-like [Myotis brandtii]
 gb|EPQ20307.1| Glutathione S-transferase theta-1 [Myotis brandtii]
Length=240

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFRQENGIPFELRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   F  V DHWYP +L  RA++D 
Sbjct  61   DFTLTESVAILLYLTRKF-KVPDHWYPQELQARARVDE  97



>ref|XP_006157221.1| PREDICTED: glutathione S-transferase theta-1-like [Tupaia chinensis]
 gb|ELW49642.1| Glutathione S-transferase theta-1 [Tupaia chinensis]
Length=240

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   + L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLMKGQHLSDAFAQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKYKA-PDHWYPQDLQARARVDE  97



>ref|XP_005334521.1| PREDICTED: glutathione S-transferase theta-1-like [Ictidomys 
tridecemlineatus]
Length=240

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D MSQP RAV IF + NGI F+   ++L KGQH +  F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTVELLKGQHYTDSFGQVNPLRKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKYKA-PDHWYPQDLQARARVDE  97



>ref|NP_034491.2| glutathione S-transferase theta-2 [Mus musculus]
 ref|XP_006513303.1| PREDICTED: glutathione S-transferase theta-2 isoform X1 [Mus 
musculus]
 sp|Q61133.4|GSTT2_MOUSE RecName: Full=Glutathione S-transferase theta-2; AltName: Full=GST 
class-theta-2 [Mus musculus]
 emb|CAA66666.1| glutathione S-transferase theta [Mus musculus]
 dbj|BAB22065.1| unnamed protein product [Mus musculus]
 gb|AAH12707.1| Glutathione S-transferase, theta 2 [Mus musculus]
 dbj|BAE34734.1| unnamed protein product [Mus musculus]
 gb|EDL31881.1| glutathione S-transferase, theta 2, isoform CRA_a [Mus musculus]
Length=244

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQPSRAV IF + NGI F+   + + KGQH S +F ++N + +VP + DG
Sbjct  1    MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+  +  VADHWYP+DL  RA++
Sbjct  61   SFVLTESTAILIYLSSKYQ-VADHWYPADLQARAQV  95



>ref|XP_797684.3| PREDICTED: glutathione S-transferase theta-1-like [Strongylocentrotus 
purpuratus]
Length=226

 Score = 99.0 bits (245),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M + VYVD +SQP RA+++F +   I FE   + L  G HK PEF K+ P+  VPAI DG
Sbjct  1    MVVKVYVDLLSQPCRALILFLKNTKIPFEIETINLNDGGHKKPEFVKMTPLCTVPAIQDG  60

Query  224  RFKLFESHAILKYLACSFPG-VADHWYPSDLFKRAKIDS  337
             F + E+ AI++YLA  +   V DHWYP DL KRA++D 
Sbjct  61   DFGMGETVAIIRYLATKYADLVPDHWYPKDLEKRARVDE  99



>gb|EMP32140.1| Glutathione S-transferase theta-1 [Chelonia mydas]
Length=388

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 69/109 (63%), Gaps = 3/109 (3%)
 Frame = +2

Query  11   RRR*ESEGRKGMTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKIN  190
            R R E  GR G+ L  Y+D +SQP R V IF + N I FE   ++L KGQH   EF K+N
Sbjct  138  RWRAEDAGRMGLEL--YLDLLSQPCRTVYIFAKKNNIPFEFKHVELFKGQHYREEFGKVN  195

Query  191  PMTQVPAIVDGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             + +VPA+ DG F L ES AIL YL+  +    DHWYPSD+ KRA++D 
Sbjct  196  ILKKVPALKDGVFTLAESTAILLYLSRKY-NTPDHWYPSDIQKRARVDE  243


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  155  GQHKSPEFKKINPMTQVPAIVDGRFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
            GQ  S  F K+N + +VPA+ DG F L ES AIL YL+  +    DHWYP D+ KRA +D
Sbjct  8    GQQHSDGFGKVNVLRKVPALKDGDFTLPESPAILAYLSQKY-KTPDHWYPLDMKKRAWVD  66

Query  335  S  337
             
Sbjct  67   E  67



>ref|NP_001131115.1| glutathione S-transferase, theta 3 [Rattus norvegicus]
 gb|EDL97189.1| similar to Glutathione S-transferase, theta 3 (predicted) [Rattus 
norvegicus]
Length=210

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D MSQP RAV IF + NGI F+   ++L KGQH +  F ++NP+ +VPA+ DG
Sbjct  58   MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDG  117

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             F L ES AIL YL+  +    DHWYP DL  RA++D
Sbjct  118  DFVLAESVAILLYLSRKYK-APDHWYPQDLQTRARVD  153



>ref|XP_797671.3| PREDICTED: glutathione S-transferase theta-1-like [Strongylocentrotus 
purpuratus]
Length=226

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M + VYVD  SQP R+++IF +   I FE   + L  G HK PEF K+NP+  VPAI DG
Sbjct  1    MVVKVYVDWRSQPCRSLIIFLKNTKIPFEIETITLKDGIHKKPEFVKMNPLCTVPAIQDG  60

Query  224  RFKLFESHAILKYLACSFPG-VADHWYPSDLFKRAKIDS  337
             F + E+ AI++YLA  +   V DHWYP DL KRA++D 
Sbjct  61   DFGMGETVAIIRYLATKYADLVPDHWYPKDLEKRARVDE  99



>ref|XP_001489453.1| PREDICTED: glutathione S-transferase theta-1-like [Equus caballus]
Length=240

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI FE   ++L KGQH S +F ++NP+ +VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHFSADFAQLNPLKKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL   +    DHWYP DL  RA++D 
Sbjct  61   DFTLTESVAILLYLTRKY-KTPDHWYPQDLQARARVDE  97



>gb|KFV63272.1| Glutathione S-transferase theta-1 [Picoides pubescens]
Length=239

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF R N I FE   ++L KGQ ++ EF+K+N +  VPA+ D 
Sbjct  1    MGLELYLDLISQPCRAVYIFARSNNIPFEFKHVELLKGQQRTEEFRKVNLLMTVPALKDD  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AI  YLA  F    DHWYP+DL KRA++D 
Sbjct  61   SFTLAESIAIFLYLARKF-KTPDHWYPADLQKRARVDE  97



>ref|XP_006874993.1| PREDICTED: glutathione S-transferase theta-1-like [Chrysochloris 
asiatica]
Length=240

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +++D +SQP RAV IF + N I FE   ++L KGQH S  F ++NPM QVPA+ DG
Sbjct  1    MGLELFLDLLSQPCRAVYIFAKRNRIPFELRTVELLKGQHHSDAFAQVNPMRQVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-QTPDHWYPQDLQTRARVDE  97



>ref|NP_036928.1| glutathione S-transferase theta-2 [Rattus norvegicus]
 sp|P30713.3|GSTT2_RAT RecName: Full=Glutathione S-transferase theta-2; AltName: Full=GST 
12-12; AltName: Full=GST class-theta-2; AltName: Full=Glutathione 
S-transferase 12; AltName: Full=Glutathione S-transferase 
Yrs-Yrs [Rattus norvegicus]
 dbj|BAA00916.1| glutathione S-transferase Yrs-Yrs [Rattus norvegicus]
 dbj|BAA07559.1| glutathione S-transferase subunit Yrs [Rattus norvegicus]
 gb|AAH61856.1| Glutathione S-transferase, theta 2 [Rattus norvegicus]
 gb|EDL97181.1| glutathione S-transferase, theta 2, isoform CRA_a [Rattus norvegicus]
 gb|ACI32126.1| glutathione S-transferase theta 2 [Rattus norvegicus]
Length=244

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQPSRAV IF + NGI F+   + L KGQH S +F ++N + +VP + DG
Sbjct  1    MGLELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKI  331
             F L ES AIL YL+  +  VADHWYP+DL  RA++
Sbjct  61   SFVLTESTAILIYLSSKYQ-VADHWYPADLQARAQV  95



>gb|AEB91980.1| glutathione S-transferase theta 1 [Locusta migratoria]
Length=231

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M+L VY D +SQPSRAV++F   N I +E  ++ +  G+  S EF K+NPM +VP I DG
Sbjct  1    MSLKVYYDLLSQPSRAVVLFLLANDIPYEAREINVLHGEQFSEEFAKLNPMKKVPVIKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL+YL C    V DHWYP+D  K+A++D 
Sbjct  61   DFTLTESVAILRYL-CRERDVPDHWYPADSKKQARVDE  97



>ref|NP_445745.1| glutathione S-transferase theta-1 [Rattus norvegicus]
 sp|Q01579.2|GSTT1_RAT RecName: Full=Glutathione S-transferase theta-1; AltName: Full=GST 
5-5; AltName: Full=GST class-theta-1; AltName: Full=Glutathione 
S-transferase 5 [Rattus norvegicus]
 emb|CAA47896.1| glutathione transferase [Rattus norvegicus]
 gb|AAH86426.1| Glutathione S-transferase theta 1 [Rattus norvegicus]
 gb|EDL97185.1| glutathione S-transferase theta 1, isoform CRA_a [Rattus norvegicus]
 gb|ACI32125.1| glutathione S-transferase theta 1 [Rattus norvegicus]
Length=240

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RA+ IF + N I F+   ++L KG+H S  F ++NPM +VPA+ DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YLA  +  V DHWYP DL  RA++D 
Sbjct  61   GFTLCESVAILLYLAHKY-KVPDHWYPQDLQARARVDE  97



>ref|XP_008838833.1| PREDICTED: glutathione S-transferase theta-1-like [Nannospalax 
galili]
Length=242

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + NGI F+   ++L KGQH +  F KINP+ +VPA+ DG
Sbjct  1    MGLELYLDLISQPCRAVYIFAKKNGIPFQLHTVELFKGQHHTDAFVKINPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKYKA-PDHWYPEDLQARARVDE  97



>ref|XP_003803344.1| PREDICTED: glutathione S-transferase theta-1-like [Otolemur garnettii]
Length=240

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + N I FE   ++L KGQH S  F ++NP+ +VPA+ DG
Sbjct  1    MVLELYLDLVSQPCRAVYIFAKKNSIPFEMRTVELLKGQHYSDAFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             F L ES AIL YL+  +    DHWYP DL  RA++D
Sbjct  61   DFTLAESVAILLYLSRKYKA-PDHWYPQDLQARARVD  96



>ref|NP_001279515.1| glutathione S-transferase theta-1-like [Callorhinchus milii]
 ref|XP_007900009.1| PREDICTED: glutathione S-transferase theta-1-like [Callorhinchus 
milii]
 gb|AFK11343.1| glutathione S-transferase theta-like protein [Callorhinchus milii]
Length=239

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +2

Query  56   VYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDGRFKL  235
            VY D +SQPSRAVLI  R  GI   E  + L KG+  SPEF ++NPM +VP IVD  F L
Sbjct  22   VYFDLLSQPSRAVLILLRAAGIPHVERPVALRKGEQNSPEFGRLNPMRKVPVIVDNGFVL  81

Query  236  FESHAILKYLACSFPGVADHWYPSDLFKRAKID  334
             ES AILKYLA ++  V  +WYP D  +RAK+D
Sbjct  82   TESVAILKYLASTY-DVPQNWYPRDPQRRAKVD  113



>ref|XP_006213357.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Vicugna pacos]
Length=240

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  44   MTLTVYVDRMSQPSRAVLIFCRVNGIDFEEVQLQLAKGQHKSPEFKKINPMTQVPAIVDG  223
            M L +Y+D +SQP RAV IF + N I FE   + L KGQH S +F ++NP+ +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNSIPFELRTVDLRKGQHHSDDFAQVNPLKKVPALKDG  60

Query  224  RFKLFESHAILKYLACSFPGVADHWYPSDLFKRAKIDS  337
             F L ES AIL YL+  +    DHWYP DL  RA++D 
Sbjct  61   DFTLAESVAILLYLSRKY-ETPDHWYPQDLQARARVDE  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560672394880