BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I09

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10236.1|  unnamed protein product                                239   5e-77   Coffea canephora [robusta coffee]
ref|XP_009766071.1|  PREDICTED: uncharacterized protein LOC104217495    240   3e-75   Nicotiana sylvestris
ref|XP_009605551.1|  PREDICTED: uncharacterized protein LOC104100087    239   5e-75   Nicotiana tomentosiformis
ref|XP_006343647.1|  PREDICTED: uncharacterized protein LOC102586896    237   5e-74   Solanum tuberosum [potatoes]
ref|XP_004242594.1|  PREDICTED: uncharacterized protein LOC101268290    236   8e-74   Solanum lycopersicum
ref|XP_008343896.1|  PREDICTED: uncharacterized protein LOC103406687    232   1e-73   
ref|XP_011079409.1|  PREDICTED: uncharacterized protein LOC105162931    235   3e-73   Sesamum indicum [beniseed]
ref|XP_008354328.1|  PREDICTED: uncharacterized protein LOC103417...    232   2e-72   
ref|XP_008354327.1|  PREDICTED: uncharacterized protein LOC103417...    232   5e-72   
ref|XP_008354326.1|  PREDICTED: uncharacterized protein LOC103417...    232   8e-72   
ref|XP_009366177.1|  PREDICTED: uncharacterized protein LOC103955...    228   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_009358437.1|  PREDICTED: uncharacterized protein LOC103949067    229   7e-71   Pyrus x bretschneideri [bai li]
ref|XP_008367748.1|  PREDICTED: uncharacterized protein LOC103431379    229   7e-71   
ref|XP_009366176.1|  PREDICTED: uncharacterized protein LOC103955...    228   8e-71   Pyrus x bretschneideri [bai li]
ref|XP_007203657.1|  hypothetical protein PRUPE_ppb007460mg             229   9e-71   Prunus persica
ref|XP_008242991.1|  PREDICTED: uncharacterized protein LOC103341270    228   1e-70   Prunus mume [ume]
ref|XP_009366175.1|  PREDICTED: uncharacterized protein LOC103955...    228   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_011033403.1|  PREDICTED: uncharacterized protein LOC105131906    228   1e-70   Populus euphratica
gb|ABK94135.1|  unknown                                                 228   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_002308403.2|  hypothetical protein POPTR_0006s19790g             228   2e-70   Populus trichocarpa [western balsam poplar]
emb|CDY28225.1|  BnaA01g06240D                                          221   2e-70   Brassica napus [oilseed rape]
emb|CBI36528.3|  unnamed protein product                                221   5e-70   Vitis vinifera
ref|XP_006474001.1|  PREDICTED: uncharacterized protein LOC102608798    226   1e-69   Citrus sinensis [apfelsine]
gb|KDO59459.1|  hypothetical protein CISIN_1g021437mg                   225   2e-69   Citrus sinensis [apfelsine]
ref|XP_006453612.1|  hypothetical protein CICLE_v10008980mg             225   2e-69   Citrus clementina [clementine]
ref|XP_002529381.1|  hypothetical protein RCOM_0623210                  223   2e-69   
ref|XP_003610317.1|  hypothetical protein MTR_4g130840                  219   3e-69   
gb|KDP38680.1|  hypothetical protein JCGZ_04033                         224   3e-69   Jatropha curcas
ref|XP_003519148.1|  PREDICTED: uncharacterized protein LOC100783799    224   4e-69   Glycine max [soybeans]
gb|EYU34347.1|  hypothetical protein MIMGU_mgv1a010558mg                224   6e-69   Erythranthe guttata [common monkey flower]
ref|XP_011018034.1|  PREDICTED: uncharacterized protein LOC105121182    224   9e-69   Populus euphratica
ref|XP_003610316.1|  hypothetical protein MTR_4g130825                  217   1e-68   
ref|XP_009127415.1|  PREDICTED: uncharacterized protein LOC103852248    223   2e-68   Brassica rapa
ref|XP_003549542.1|  PREDICTED: uncharacterized protein LOC100784...    222   3e-68   Glycine max [soybeans]
ref|XP_008778405.1|  PREDICTED: uncharacterized protein LOC103698...    221   6e-68   Phoenix dactylifera
ref|XP_007011928.1|  DNAse I-like superfamily protein isoform 2         220   6e-68   
ref|XP_010103675.1|  hypothetical protein L484_002875                   216   7e-68   
ref|XP_010275824.1|  PREDICTED: uncharacterized protein LOC104610...    221   8e-68   Nelumbo nucifera [Indian lotus]
gb|EPS71161.1|  hypothetical protein M569_03592                         221   9e-68   Genlisea aurea
ref|XP_007154882.1|  hypothetical protein PHAVU_003G156000g             221   1e-67   Phaseolus vulgaris [French bean]
ref|XP_002278804.1|  PREDICTED: uncharacterized protein LOC100263811    221   1e-67   Vitis vinifera
ref|XP_007011929.1|  DNAse I-like superfamily protein isoform 3         220   2e-67   Theobroma cacao [chocolate]
ref|XP_007011927.1|  DNAse I-like superfamily protein isoform 1         221   2e-67   
gb|KJB27341.1|  hypothetical protein B456_004G291800                    219   7e-67   Gossypium raimondii
gb|KJB27340.1|  hypothetical protein B456_004G291800                    219   8e-67   Gossypium raimondii
ref|XP_010265582.1|  PREDICTED: uncharacterized protein LOC104603...    218   1e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010908249.1|  PREDICTED: uncharacterized protein LOC105034...    218   1e-66   Elaeis guineensis
ref|XP_011462483.1|  PREDICTED: uncharacterized protein LOC101314402    217   3e-66   Fragaria vesca subsp. vesca
ref|XP_010436319.1|  PREDICTED: uncharacterized protein LOC104720045    217   3e-66   
ref|XP_006412651.1|  hypothetical protein EUTSA_v10025727mg             217   3e-66   Eutrema salsugineum [saltwater cress]
ref|XP_004507739.1|  PREDICTED: uncharacterized protein LOC101488559    216   5e-66   Cicer arietinum [garbanzo]
ref|XP_010265581.1|  PREDICTED: uncharacterized protein LOC104603...    217   7e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010048746.1|  PREDICTED: uncharacterized protein LOC104437486    216   1e-65   Eucalyptus grandis [rose gum]
ref|XP_010447644.1|  PREDICTED: uncharacterized protein LOC104730207    215   1e-65   
ref|XP_006282675.1|  hypothetical protein CARUB_v10005285mg             215   2e-65   Capsella rubella
ref|XP_009387996.1|  PREDICTED: uncharacterized protein LOC103974833    214   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010438105.1|  PREDICTED: uncharacterized protein LOC104721745    214   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010525805.1|  PREDICTED: uncharacterized protein LOC104803...    214   6e-65   Tarenaya hassleriana [spider flower]
ref|XP_010525806.1|  PREDICTED: uncharacterized protein LOC104803...    214   6e-65   Tarenaya hassleriana [spider flower]
ref|XP_008443859.1|  PREDICTED: uncharacterized protein LOC103487355    213   1e-64   Cucumis melo [Oriental melon]
ref|XP_004146677.1|  PREDICTED: uncharacterized protein LOC101208977    213   1e-64   Cucumis sativus [cucumbers]
ref|XP_002869355.1|  hypothetical protein ARALYDRAFT_913382             213   2e-64   
ref|XP_002325133.2|  hypothetical protein POPTR_0018s11590g             211   5e-64   
gb|EEE63087.1|  hypothetical protein OsJ_17895                          203   4e-63   Oryza sativa Japonica Group [Japonica rice]
ref|NP_194819.3|  endonuclease/exonuclease/phosphatase domain-con...    209   5e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68702.1|  BnaC01g07510D                                          207   2e-62   
ref|XP_006655153.1|  PREDICTED: uncharacterized protein LOC102699868    207   3e-62   Oryza brachyantha
gb|KHN17493.1|  hypothetical protein glysoja_005690                     205   6e-62   Glycine soja [wild soybean]
gb|EMS56811.1|  hypothetical protein TRIUR3_29894                       204   3e-61   Triticum urartu
ref|XP_004962487.1|  PREDICTED: uncharacterized protein LOC101775377    202   1e-60   Setaria italica
gb|EEC78900.1|  hypothetical protein OsI_19281                          202   1e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_008663084.1|  PREDICTED: uncharacterized protein LOC103641526    202   3e-60   Zea mays [maize]
ref|XP_002446198.1|  hypothetical protein SORBIDRAFT_06g003360          201   3e-60   Sorghum bicolor [broomcorn]
ref|XP_008669587.1|  PREDICTED: uncharacterized protein LOC103646656    201   5e-60   
gb|KHG21278.1|  Uncharacterized protein F383_02575                      201   5e-60   Gossypium arboreum [tree cotton]
ref|XP_010687982.1|  PREDICTED: uncharacterized protein LOC104902...    200   9e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010228566.1|  PREDICTED: uncharacterized protein LOC100833...    196   4e-58   Brachypodium distachyon [annual false brome]
ref|XP_010275825.1|  PREDICTED: uncharacterized protein LOC104610...    192   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010908250.1|  PREDICTED: uncharacterized protein LOC105034...    190   4e-56   Elaeis guineensis
ref|XP_010228565.1|  PREDICTED: uncharacterized protein LOC100833...    181   5e-52   
ref|XP_006857235.1|  hypothetical protein AMTR_s00065p00210150          152   1e-41   
gb|KCW81115.1|  hypothetical protein EUGRSUZ_C02493                     123   2e-30   Eucalyptus grandis [rose gum]
ref|XP_006600542.1|  PREDICTED: uncharacterized protein LOC100784...    118   1e-28   
ref|XP_006453611.1|  hypothetical protein CICLE_v10008980mg             117   2e-28   
ref|XP_007011930.1|  DNAse I-like superfamily protein isoform 4         117   2e-28   
ref|XP_010275826.1|  PREDICTED: uncharacterized protein LOC104610...    116   7e-28   Nelumbo nucifera [Indian lotus]
gb|EIL88922.1|  endonuclease-exonuclease-phosphatase family protein     114   3e-27   Rhodanobacter sp. 115
ref|WP_037101851.1|  endonuclease                                       114   3e-27   
gb|KCW81172.1|  hypothetical protein EUGRSUZ_C02541                     107   2e-26   Eucalyptus grandis [rose gum]
ref|WP_040597465.1|  endonuclease                                       108   7e-25   Sphingomonas elodea
ref|WP_025560397.1|  MULTISPECIES: endonuclease                         108   7e-25   Sphingomonas sp. UNC305MFCol5.2
gb|AFW93615.1|  hypothetical protein ANA_C10823                         107   2e-24   Anabaena sp. 90
ref|WP_029724347.1|  endonuclease                                       106   3e-24   
ref|XP_010687985.1|  PREDICTED: uncharacterized protein LOC104902...    106   4e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_043741582.1|  endonuclease                                       105   6e-24   Luteimonas sp. J29
ref|WP_043130609.1|  endonuclease                                       105   9e-24   
ref|WP_019183219.1|  endonuclease                                       105   1e-23   Stenotrophomonas maltophilia
ref|WP_038688967.1|  endonuclease                                       104   1e-23   Stenotrophomonas rhizophila
ref|WP_019420813.1|  hypothetical protein                               104   2e-23   Paenibacillus sp. OSY-SE
ref|WP_044330154.1|  endonuclease                                       104   2e-23   
ref|WP_012510732.1|  endonuclease                                       104   2e-23   Stenotrophomonas maltophilia
ref|WP_017356108.1|  endonuclease                                       104   2e-23   Stenotrophomonas maltophilia
ref|WP_044569865.1|  endonuclease                                       103   3e-23   Stenotrophomonas maltophilia
emb|CAQ45357.1|  conserved hypothetical protein                         104   3e-23   Stenotrophomonas maltophilia K279a
ref|WP_005416166.1|  hypothetical protein                               103   4e-23   Stenotrophomonas
ref|WP_021203969.1|  endonuclease                                       103   5e-23   Stenotrophomonas maltophilia
ref|WP_019661229.1|  endonuclease                                       103   5e-23   Stenotrophomonas maltophilia
ref|WP_043399271.1|  endonuclease                                       103   5e-23   Stenotrophomonas maltophilia
ref|WP_019465881.1|  hypothetical protein                               102   6e-23   
ref|WP_028971009.1|  endonuclease                                       102   8e-23   Sphingopyxis baekryungensis
ref|WP_019338351.1|  endonuclease                                       102   9e-23   Stenotrophomonas maltophilia
ref|WP_014776142.1|  endonuclease                                       102   9e-23   Alistipes finegoldii
ref|WP_010484417.1|  endonuclease [                                     102   9e-23   [Pseudomonas] geniculata
ref|WP_033833096.1|  endonuclease                                       102   1e-22   Stenotrophomonas maltophilia
ref|WP_022043979.1|  metal-dependent hydrolase                          102   1e-22   
ref|WP_023977954.1|  endonuclease                                       102   1e-22   
emb|CCA23669.1|  conserved hypothetical protein                         102   1e-22   Albugo laibachii Nc14
ref|WP_015954319.1|  hypothetical protein                               101   1e-22   Cyanothece sp. PCC 7424
ref|WP_041457662.1|  endonuclease/exonuclease/phosphatase family ...    101   2e-22   
ref|WP_004153210.1|  Nocturnin                                          102   2e-22   Stenotrophomonas maltophilia
ref|WP_040008000.1|  endonuclease                                       101   2e-22   Stenotrophomonas sp. SKA14
ref|WP_005409116.1|  endonuclease                                       101   2e-22   Stenotrophomonas
gb|EED38962.1|  endonuclease/exonuclease/phosphatase family protein     101   2e-22   Stenotrophomonas sp. SKA14
ref|WP_032128269.1|  endonuclease                                       101   3e-22   Stenotrophomonas maltophilia
ref|WP_009598084.1|  endonuclease                                       100   3e-22   Alistipes sp. HGB5
ref|WP_043035472.1|  endonuclease                                       100   4e-22   Stenotrophomonas maltophilia
ref|WP_036380102.1|  endonuclease/exonuclease/phosphatase               100   5e-22   Muricauda sp. MAR_2010_75
ref|WP_032966628.1|  endonuclease                                       100   5e-22   Stenotrophomonas maltophilia
gb|EMF59043.1|  Hypothetical protein EPM1_4313                          100   5e-22   Stenotrophomonas maltophilia EPM1
ref|WP_026690547.1|  hypothetical protein                               100   6e-22   Bacillus aurantiacus
ref|WP_029902879.1|  endonuclease                                       100   6e-22   Prevotella sp. 10(H)
ref|WP_010035080.1|  endonuclease                                       100   7e-22   Gemmata obscuriglobus
ref|WP_013191422.1|  hypothetical protein                             99.4    9e-22   Trichormus azollae
tpg|DAA38364.1|  TPA: hypothetical protein ZEAMMB73_818223            94.7    1e-21   
ref|WP_032959133.1|  endonuclease                                     99.4    1e-21   Stenotrophomonas maltophilia
ref|WP_007127566.1|  endonuclease                                     99.0    1e-21   Paenibacillus lactis
ref|WP_028406035.1|  endonuclease                                     99.0    1e-21   Bacillus sp. J13
ref|WP_013321917.1|  hypothetical protein                             99.0    1e-21   Cyanothece sp. PCC 7822
gb|AHX14743.1|  endonuclease                                          99.4    1e-21   Dyella jiangningensis
ref|WP_036139157.1|  endonuclease                                     99.4    1e-21   
emb|CCH12316.1|  hypothetical protein SMD_1770                        99.4    1e-21   Stenotrophomonas maltophilia D457
ref|WP_038621472.1|  endonuclease                                     99.4    2e-21   
ref|WP_043100597.1|  endonuclease                                     99.0    2e-21   Oleiagrimonas soli
ref|WP_037293166.1|  hypothetical protein                             99.0    2e-21   
ref|WP_014036832.1|  endonuclease                                     98.6    3e-21   Stenotrophomonas maltophilia
ref|WP_042464443.1|  endonuclease/exonuclease/phosphatase family ...  98.2    3e-21   Anabaena cylindrica
ref|WP_025834044.1|  endonuclease                                     98.2    4e-21   Bacteroides
ref|WP_025852029.1|  endonuclease                                     97.4    5e-21   Paenibacillus ehimensis
ref|WP_020475720.1|  hypothetical protein                             97.8    5e-21   Zavarzinella formosa
ref|WP_036742048.1|  hypothetical protein                             97.4    5e-21   
ref|WP_009094936.1|  endonuclease/exonuclease/phosphatase family ...  97.8    6e-21   Rhodopirellula sp. SWK7
ref|WP_025878848.1|  endonuclease                                     97.4    6e-21   Stenotrophomonas maltophilia
gb|EVT72121.1|  endonuclease                                          97.4    6e-21   Stenotrophomonas maltophilia 5BA-I-2
ref|WP_035444113.1|  hypothetical protein                               101   7e-21   Asaia platycodi
ref|WP_042597078.1|  endonuclease                                     97.4    7e-21   Xanthomonas campestris
ref|WP_031339241.1|  endonuclease                                     97.4    7e-21   Xanthomonas maliensis
ref|WP_033830850.1|  endonuclease                                     97.4    7e-21   Xanthomonadaceae
ref|WP_032977829.1|  endonuclease                                     97.4    7e-21   Stenotrophomonas sp. RIT309
ref|WP_011038545.1|  endonuclease                                     97.1    8e-21   Xanthomonas campestris
ref|WP_043921954.1|  endonuclease                                     97.1    9e-21   Xanthomonas campestris
ref|WP_014031508.1|  endonuclease/exonuclease/phosphatase             97.1    9e-21   Muricauda ruestringensis
gb|AEL08647.1|  endonuclease-exonuclease-phosphatase family           97.4    1e-20   Xanthomonas campestris pv. raphani 756C
ref|WP_040431966.1|  endonuclease                                     96.7    1e-20   
ref|WP_012437370.1|  endonuclease                                     97.1    1e-20   Xanthomonas campestris
gb|KGK56424.1|  endonuclease                                          97.1    1e-20   Xanthomonas cannabis pv. phaseoli
ref|WP_041047002.1|  hypothetical protein                             96.7    1e-20   Paenibacillus sp. VKM B-2647
ref|WP_041740053.1|  endonuclease                                     96.3    1e-20   
ref|WP_039573221.1|  endonuclease                                     96.7    1e-20   Xanthomonas
ref|WP_010500150.1|  endonuclease                                     96.3    1e-20   Paenibacillus elgii
ref|WP_017159070.1|  endonuclease                                     96.7    1e-20   Xanthomonas phaseoli
ref|WP_017155348.1|  endonuclease                                     96.7    1e-20   Xanthomonas phaseoli
gb|AGA80207.1|  metal-dependent hydrolase                             96.3    2e-20   Echinicola vietnamensis DSM 17526
ref|WP_026009056.1|  endonuclease                                     95.9    2e-20   Sphingomonas
gb|KDO23506.1|  hypothetical protein SPRG_11428                       96.3    2e-20   Saprolegnia parasitica CBS 223.65
ref|WP_039530895.1|  endonuclease                                     95.9    2e-20   Xanthomonas arboricola
ref|WP_020742136.1|  hypothetical protein                             95.5    3e-20   
ref|WP_016661564.1|  hypothetical protein                             95.5    3e-20   Bacteroides stercoris
ref|WP_036882259.1|  hypothetical protein                             95.5    3e-20   
ref|WP_041326973.1|  endonuclease/exonuclease/phosphatase             95.5    4e-20   
ref|WP_016851472.1|  endonuclease                                     95.1    5e-20   Xanthomonas
ref|WP_013545729.1|  endonuclease                                     95.1    5e-20   Bacteroides helcogenes
ref|WP_009606291.1|  putative exported protein                        95.1    5e-20   Xanthomonas translucens
ref|WP_007968534.1|  endonuclease                                     94.7    5e-20   Xanthomonas
ref|WP_022558232.1|  MULTISPECIES: hypothetical protein               94.7    6e-20   Xanthomonas
ref|WP_036688201.1|  endonuclease                                     94.4    6e-20   Paenibacillus tyrfis
gb|AFZ55928.1|  Endonuclease/exonuclease/phosphatase                  94.4    6e-20   Anabaena cylindrica PCC 7122
ref|WP_009343891.1|  hypothetical protein                             94.4    6e-20   Raphidiopsis brookii
ref|WP_023905149.1|  hypothetical protein                             94.7    7e-20   Xanthomonas hortorum
ref|WP_027485814.1|  endonuclease                                     94.4    7e-20   Rhodanobacter sp. OR87
ref|XP_008603913.1|  hypothetical protein SDRG_00223                  94.7    7e-20   Saprolegnia diclina VS20
ref|WP_040940640.1|  endonuclease                                     94.4    7e-20   Xanthomonas campestris
ref|WP_015446695.1|  MULTISPECIES: endonuclease                       94.4    7e-20   Rhodanobacter
ref|WP_026634180.1|  endonuclease                                     94.4    7e-20   Dyella
ref|WP_006276313.1|  hypothetical protein                             94.0    8e-20   Cylindrospermopsis
ref|WP_016900841.1|  endonuclease                                     94.4    8e-20   Xanthomonas arboricola
ref|WP_043910723.1|  endonuclease                                     94.4    8e-20   Xanthomonas
ref|WP_041781060.1|  endonuclease/exonuclease/phosphatase family ...  94.0    8e-20   
gb|EGD17029.1|  metal-dependent hydrolase                             94.0    8e-20   Xanthomonas gardneri ATCC 19865
ref|WP_022103807.1|  endonuclease/Exonuclease/phosphatase             94.4    8e-20   
gb|AFZ19845.1|  metal-dependent hydrolase                             94.0    9e-20   Microcoleus sp. PCC 7113
gb|ABL97825.1|  hypothetical protein ALOHA_HF1049E08.0013             94.0    1e-19   uncultured marine bacterium HF10_49E08
ref|WP_028551272.1|  hypothetical protein                             94.0    1e-19   Paenibacillus sp. UNC451MF
ref|WP_003482709.1|  endonuclease                                     94.0    1e-19   Xanthomonas
ref|WP_011409451.1|  endonuclease                                     94.4    1e-19   
ref|XP_008870790.1|  hypothetical protein H310_07222                  94.4    1e-19   Aphanomyces invadans
ref|WP_011050469.1|  MULTISPECIES: endonuclease                       94.0    1e-19   Xanthomonas
ref|WP_039579858.1|  endonuclease                                     94.0    1e-19   Xanthomonas
ref|WP_008436752.1|  endonuclease                                     94.0    1e-19   Rhodanobacter thiooxydans
ref|WP_005911153.1|  MULTISPECIES: hypothetical protein               94.0    1e-19   Xanthomonas
ref|WP_005925093.1|  endonuclease                                     94.0    1e-19   Xanthomonas citri
ref|WP_019303951.1|  endonuclease                                     94.0    1e-19   Xanthomonas oryzae
ref|WP_031420993.1|  endonuclease                                     94.0    1e-19   Xanthomonas
ref|WP_022333457.1|  MULTISPECIES: metal-dependent hydrolase          93.6    1e-19   Alistipes
ref|WP_039811162.1|  endonuclease                                     94.0    1e-19   Xanthomonas arboricola
ref|WP_014501890.1|  endonuclease                                     94.0    1e-19   Xanthomonas oryzae
ref|WP_011346346.1|  MULTISPECIES: endonuclease                       93.6    1e-19   Xanthomonas
ref|WP_039523427.1|  endonuclease                                     93.6    1e-19   Xanthomonas arboricola
ref|WP_019301163.1|  endonuclease                                     94.0    1e-19   Xanthomonas oryzae
emb|CBX31373.1|  hypothetical protein N47_E48850                      94.0    1e-19   uncultured Desulfobacterium sp.
ref|WP_044756430.1|  endonuclease                                     94.0    1e-19   
ref|WP_012444111.1|  endonuclease                                     94.0    2e-19   
ref|WP_026318556.1|  endonuclease                                     93.6    2e-19   Alistipes onderdonkii
ref|WP_040269324.1|  endonuclease                                     93.6    2e-19   Xanthomonas citri
ref|WP_024939679.1|  endonuclease                                     93.6    2e-19   Xanthomonas arboricola
ref|WP_009125678.1|  endonuclease                                     93.2    2e-19   Bacteroides fluxus
ref|WP_010263318.1|  endonuclease                                     93.2    2e-19   Alistipes timonensis
ref|WP_007080670.1|  endonuclease                                     93.2    2e-19   Rhodanobacter fulvus
ref|WP_007511681.1|  endonuclease                                     93.2    2e-19   Rhodanobacter denitrificans
gb|AGU11283.1|  Endonuclease/Exonuclease/phosphatase family           93.2    2e-19   uncultured organism
ref|WP_027493355.1|  endonuclease                                     93.2    2e-19   Rhodanobacter sp. OR444
gb|AFN73654.1|  endonuclease/exonuclease/phosphatase family protein   93.2    2e-19   Melioribacter roseus P3M-2
ref|WP_015847775.1|  endonuclease/exonuclease/phosphatase             92.8    3e-19   Paenibacillus sp. JDR-2
ref|WP_039128836.1|  hypothetical protein                             92.8    3e-19   Flavihumibacter sp. ZG627
ref|WP_041182274.1|  endonuclease                                     93.2    3e-19   
ref|WP_041356193.1|  hypothetical protein                             92.8    3e-19   
ref|WP_029951286.1|  hypothetical protein                             91.7    3e-19   
gb|AAW77203.1|  Metal-dependent hydrolase                             93.2    3e-19   Xanthomonas oryzae pv. oryzae KACC 10331
gb|EAR16692.1|  hypothetical protein RB2501_07320                     92.4    3e-19   Robiginitalea biformata HTCC2501
gb|KFA03412.1|  endonuclease                                          90.9    3e-19   Xanthomonas vasicola pv. vasculorum NCPPB 890
ref|WP_039444134.1|  endonuclease                                     92.4    4e-19   Xanthomonas vasicola
gb|KGP56038.1|  endonuclease                                          92.4    4e-19   
gb|EPR65521.1|  endonuclease/exonuclease/phosphatase family protein   92.4    4e-19   Cyclobacterium qasimii M12-11B
ref|WP_039431767.1|  endonuclease                                     92.4    4e-19   Xanthomonas vasicola
emb|CCI44541.1|  unnamed protein product                              92.4    4e-19   Albugo candida
ref|WP_040417921.1|  hypothetical protein                             92.4    4e-19   
ref|WP_035082784.1|  endonuclease/exonuclease/phosphatase family ...  92.4    4e-19   
ref|WP_010368226.1|  MULTISPECIES: endonuclease                       92.4    4e-19   Xanthomonas
ref|WP_039514957.1|  endonuclease                                     92.4    4e-19   Xanthomonas arboricola
ref|XP_002908683.1|  conserved hypothetical protein                   93.2    4e-19   Phytophthora infestans T30-4
ref|WP_039006050.1|  endonuclease                                     92.4    4e-19   Xanthomonas translucens
ref|WP_041585678.1|  hypothetical protein                             91.3    4e-19   
ref|XP_009826300.1|  hypothetical protein H257_03771                  92.8    4e-19   Aphanomyces astaci
ref|WP_039404355.1|  endonuclease                                     92.4    4e-19   Xanthomonas cannabis
gb|ELP95404.1|  hypothetical protein A989_19643                       92.0    4e-19   Xanthomonas translucens DAR61454
gb|AJQ81915.1|  endonuclease                                          92.0    5e-19   Xanthomonas oryzae pv. oryzae PXO86
ref|WP_034537563.1|  endonuclease                                     92.0    5e-19   Bacteroides pyogenes
ref|WP_038264750.1|  endonuclease/exonuclease/phosphatase             92.0    5e-19   Zhouia amylolytica
ref|XP_008915260.1|  hypothetical protein PPTG_18842                  92.8    5e-19   Phytophthora parasitica INRA-310
ref|WP_044468243.1|  endonuclease                                     92.0    5e-19   Bacteroides
ref|WP_022401372.1|  endonuclease/Exonuclease/phosphatase             92.0    5e-19   Bacteroides uniformis
ref|WP_003477748.1|  Nocturnin                                        92.0    5e-19   Xanthomonas translucens
ref|WP_034538364.1|  endonuclease                                     92.0    5e-19   
ref|WP_042368151.1|  endonuclease                                     92.0    5e-19   Bacteroides neonati
ref|WP_038240492.1|  endonuclease                                     92.0    6e-19   Xanthomonas translucens
dbj|GAE16806.1|  endonuclease/exonuclease/phosphatase family protein  92.0    6e-19   Bacteroides pyogenes JCM 6292
ref|WP_039421518.1|  endonuclease                                     92.0    6e-19   Xanthomonas vesicatoria
ref|WP_025126126.1|  hypothetical protein                             92.0    6e-19   Myroides odoratimimus
ref|WP_008577905.1|  MULTISPECIES: endonuclease                       92.0    6e-19   Xanthomonas
ref|WP_005830032.1|  MULTISPECIES: endonuclease                       91.7    7e-19   Bacteroides
ref|WP_005990335.1|  endonuclease                                     91.7    7e-19   Xanthomonas vesicatoria
ref|WP_006843947.1|  endonuclease                                     91.7    7e-19   Dysgonomonas mossii
ref|WP_029510235.1|  endonuclease/exonuclease/phosphatase             91.7    8e-19   
ref|WP_010343122.1|  endonuclease                                     91.7    8e-19   Xanthomonas sacchari
ref|WP_023510702.1|  hypothetical protein                             91.7    8e-19   Sporolactobacillus laevolacticus
gb|EGI55455.1|  endonuclease/Exonuclease/phosphatase family protein   91.3    8e-19   Sphingomonas sp. S17
ref|WP_037568378.1|  MULTISPECIES: endonuclease                       91.7    8e-19   
ref|WP_009779565.1|  hypothetical protein                             91.3    9e-19   Leeuwenhoekiella blandensis
ref|WP_025006681.1|  endonuclease/exonuclease/phosphatase             91.3    9e-19   
ref|WP_012915347.1|  endonuclease                                     91.3    9e-19   
ref|WP_036471376.1|  hypothetical protein                             91.3    9e-19   
ref|WP_006260163.1|  MULTISPECIES: hypothetical protein               91.3    1e-18   
ref|WP_027078081.1|  hypothetical protein                             91.3    1e-18   
ref|WP_005830588.1|  endonuclease                                     91.3    1e-18   
ref|WP_016361619.1|  hypothetical protein                             91.3    1e-18   
ref|WP_013995275.1|  metal-dependent hydrolase                        91.3    1e-18   
ref|WP_024743806.1|  endonuclease                                     91.3    1e-18   
ref|WP_008662617.1|  endonuclease                                     91.3    1e-18   
ref|WP_027885557.1|  endonuclease/exonuclease/phosphatase             91.3    1e-18   
ref|WP_006261288.1|  hypothetical protein                             91.3    1e-18   
ref|WP_009675122.1|  MULTISPECIES: endonuclease                       90.9    1e-18   
ref|WP_009130487.1|  hypothetical protein                             91.3    1e-18   
gb|ABC78274.1|  endonuclease/exonuclease/phosphatase family protein   91.3    1e-18   
ref|WP_006265365.1|  hypothetical protein                             91.3    1e-18   
ref|WP_018200478.1|  hypothetical protein                             90.9    1e-18   
ref|WP_038985770.1|  hypothetical protein                             90.9    1e-18   
ref|WP_040351427.1|  hypothetical protein                             90.9    1e-18   
ref|WP_025864375.1|  endonuclease/exonuclease/phosphatase             90.9    1e-18   
gb|EFA19337.1|  endonuclease/exonuclease/phosphatase family protein   90.5    1e-18   
dbj|GAE20209.1|  endonuclease/exonuclease/phosphatase family protein  90.5    2e-18   
ref|WP_034529535.1|  hypothetical protein                             90.5    2e-18   
ref|WP_039203741.1|  endonuclease/exonuclease/phosphatase family ...  90.5    2e-18   
ref|WP_017912981.1|  endonuclease                                     90.5    2e-18   
ref|WP_017909089.1|  endonuclease                                     90.5    2e-18   
ref|WP_017915881.1|  endonuclease                                     90.5    2e-18   
ref|WP_043094719.1|  endonuclease                                     90.1    2e-18   
ref|WP_019151888.1|  endonuclease                                     90.1    3e-18   
ref|WP_043695364.1|  endonuclease                                     89.7    3e-18   
ref|WP_028967102.1|  endonuclease                                     89.7    3e-18   
ref|WP_034543424.1|  endonuclease                                     89.7    3e-18   
ref|XP_009519932.1|  hypothetical protein PHYSODRAFT_485928           90.9    3e-18   
ref|WP_006419307.1|  endonuclease                                     89.7    3e-18   
ref|WP_021645242.1|  endonuclease/exonuclease/phosphatase family ...  89.7    3e-18   
ref|WP_010856475.1|  hypothetical protein                             89.7    3e-18   
ref|WP_009778644.1|  hypothetical protein                             89.7    3e-18   
ref|WP_024987627.1|  endonuclease                                     89.7    3e-18   
ref|WP_032565637.1|  endonuclease                                     89.7    3e-18   
ref|WP_013707398.1|  hypothetical protein                             89.4    3e-18   
ref|WP_009581048.1|  endonuclease/exonuclease/phosphatase family ...  89.7    4e-18   
ref|WP_029038501.1|  endonuclease/exonuclease/phosphatase             89.4    4e-18   
ref|WP_009129585.1|  hypothetical protein                             89.4    4e-18   
ref|WP_042238817.1|  hypothetical protein                             91.7    4e-18   
ref|WP_016776663.1|  hypothetical protein                             89.4    4e-18   
ref|WP_042235884.1|  endonuclease                                     89.4    5e-18   
ref|WP_037270474.1|  endonuclease                                     89.4    5e-18   
ref|WP_026711060.1|  hypothetical protein                             89.0    5e-18   
ref|WP_005834481.1|  MULTISPECIES: endonuclease                       89.4    5e-18   
ref|WP_035447142.1|  endonuclease                                     89.4    5e-18   
ref|WP_035215973.1|  hypothetical protein                             89.0    5e-18   
ref|WP_035254900.1|  endonuclease                                     89.0    6e-18   
ref|WP_032536629.1|  endonuclease                                     89.0    6e-18   
ref|WP_032577937.1|  endonuclease                                     89.0    6e-18   
ref|WP_022199139.1|  endonuclease/exonuclease/phosphatase             89.4    6e-18   
ref|WP_009040650.1|  endonuclease                                     89.4    6e-18   
ref|WP_018105753.1|  MULTISPECIES: hypothetical protein               89.0    6e-18   
gb|EHO11648.1|  hypothetical protein HMPREF9715_01997                 91.3    6e-18   
ref|WP_036137095.1|  endonuclease                                     89.0    6e-18   
ref|WP_044202185.1|  endonuclease                                     89.0    7e-18   
ref|WP_032542672.1|  endonuclease                                     89.0    7e-18   
ref|WP_044103563.1|  hypothetical protein                             88.6    7e-18   
ref|WP_042985956.1|  endonuclease                                     89.0    7e-18   
ref|WP_037534049.1|  endonuclease                                     88.6    8e-18   
ref|WP_007806000.1|  endonuclease                                     88.6    8e-18   
ref|WP_033391326.1|  endonuclease                                     88.6    8e-18   
ref|WP_006842818.1|  endonuclease                                     88.6    8e-18   
ref|WP_028376795.1|  endonuclease/exonuclease/phosphatase             88.6    9e-18   
ref|WP_040925073.1|  hypothetical protein                             88.2    1e-17   
ref|WP_031335088.1|  hypothetical protein                             88.6    1e-17   
ref|WP_005658080.1|  endonuclease                                     88.2    1e-17   
ref|WP_042485777.1|  endonuclease                                     88.2    1e-17   
gb|EQB37882.1|  hypothetical protein M948_04770                       88.6    1e-17   
ref|WP_034966150.1|  endonuclease/exonuclease/phosphatase             88.2    1e-17   
dbj|GAM00507.1|  hypothetical protein SP5_034_00810                   88.2    1e-17   
ref|WP_038244883.1|  hypothetical protein                             88.2    1e-17   
emb|CDQ38588.1|  mRNA deadenylase, exonuclease subunit                88.2    1e-17   
ref|WP_005833323.1|  endonuclease                                     88.2    1e-17   
ref|WP_006099883.1|  hypothetical protein                             87.8    1e-17   
ref|WP_009037893.1|  MULTISPECIES: endonuclease                       88.2    1e-17   
gb|AIC92706.1|  endonuclease/CDSuclease/phosphatase                   88.2    1e-17   
ref|WP_041891940.1|  hypothetical protein                             88.2    1e-17   
gb|EAQ82149.1|  hypothetical protein DSM3645_00505                    87.8    1e-17   
ref|WP_038485005.1|  hypothetical protein                             88.2    1e-17   
ref|WP_011697485.1|  endonuclease                                     87.8    1e-17   
ref|WP_036111106.1|  MULTISPECIES: endonuclease                       87.8    1e-17   
ref|WP_008382904.1|  metal-dependent hydrolase                        87.8    2e-17   
ref|WP_022308676.1|  endonuclease/exonuclease/phosphatase family ...  87.8    2e-17   
ref|WP_006797769.1|  endonuclease                                     87.8    2e-17   
ref|WP_034972834.1|  endonuclease/exonuclease/phosphatase             87.8    2e-17   
ref|WP_008613907.1|  metal-dependent hydrolase                        87.4    2e-17   
ref|WP_026755324.1|  endonuclease/exonuclease/phosphatase             87.4    2e-17   
ref|WP_031444626.1|  endonuclease/exonuclease/phosphatase             87.4    2e-17   
ref|WP_015725341.1|  endonuclease/exonuclease/phosphatase             87.0    2e-17   
ref|WP_032853503.1|  endonuclease                                     87.4    2e-17   
ref|WP_021254708.1|  MULTISPECIES: endonuclease/exonuclease/phosp...  87.4    2e-17   
ref|WP_002769864.1|  hypothetical protein                             87.0    2e-17   
gb|KDS54441.1|  endonuclease/exonuclease/phosphatase family protein   87.0    2e-17   
gb|EFS33279.2|  hypothetical protein BSGG_3979                        87.4    3e-17   
ref|WP_020036078.1|  hypothetical protein                             87.4    3e-17   
ref|XP_009494605.1|  hypothetical protein H696_02428                  87.4    3e-17   
ref|WP_020147683.1|  hypothetical protein                             87.4    3e-17   
ref|WP_009132485.1|  hypothetical protein                             87.0    3e-17   
ref|WP_024565371.1|  endonuclease/exonuclease/phosphatase             87.0    3e-17   
ref|WP_024567939.1|  endonuclease/exonuclease/phosphatase             87.0    3e-17   
ref|WP_002759499.1|  hypothetical protein                             86.7    3e-17   
ref|WP_021347032.1|  endonuclease/exonuclease/phosphatase             86.7    3e-17   
ref|WP_004160695.1|  hypothetical protein                             86.7    3e-17   
ref|WP_030617655.1|  endonuclease                                     87.0    3e-17   
ref|WP_009089089.1|  MULTISPECIES: hypothetical protein               86.7    3e-17   
ref|WP_002752990.1|  hypothetical protein                             86.7    3e-17   
ref|WP_012023641.1|  endonuclease/exonuclease/phosphatase             86.7    3e-17   
ref|WP_044218666.1|  hypothetical protein                             86.7    3e-17   
ref|WP_002802561.1|  hypothetical protein                             86.7    4e-17   
ref|WP_015243893.1|  endonuclease                                     86.7    4e-17   
ref|WP_026367158.1|  endonuclease                                     86.7    4e-17   
ref|WP_004161437.1|  hypothetical protein                             86.7    4e-17   
ref|WP_002799568.1|  hypothetical protein                             86.7    4e-17   
ref|WP_019065133.1|  hypothetical protein                             86.7    4e-17   
ref|WP_033278396.1|  endonuclease                                     86.7    4e-17   
ref|WP_042192889.1|  endonuclease                                     86.7    4e-17   
ref|WP_042790844.1|  endonuclease/exonuclease/phosphatase family ...  86.3    4e-17   
ref|WP_034870694.1|  endonuclease/exonuclease/phosphatase             86.7    4e-17   
ref|WP_017460506.1|  hypothetical protein                             86.7    4e-17   
ref|WP_016515935.1|  hypothetical protein                             86.3    4e-17   
ref|WP_002774727.1|  hypothetical protein                             86.3    5e-17   
emb|CEL20279.1|  endonuclease/exonuclease/phosphatase family protein  86.7    5e-17   
ref|WP_002792911.1|  hypothetical protein                             86.3    5e-17   
ref|WP_015171017.1|  endonuclease/exonuclease/phosphatase             86.3    5e-17   
ref|WP_018523594.1|  MULTISPECIES: hypothetical protein               86.3    6e-17   
ref|WP_025830617.1|  endonuclease                                     86.3    6e-17   
ref|WP_042566216.1|  endonuclease/exonuclease/phosphatase             86.3    6e-17   
ref|WP_007127944.1|  MULTISPECIES: endonuclease                       88.2    6e-17   
ref|WP_037102555.1|  endonuclease                                     85.9    7e-17   
ref|WP_035202341.1|  hypothetical protein                             85.9    7e-17   
ref|WP_007211878.1|  endonuclease                                     85.9    7e-17   
dbj|BAD62747.1|  conserved hypothetical protein                       85.9    7e-17   
ref|WP_008199922.1|  hypothetical protein                             85.9    7e-17   
ref|WP_044532359.1|  endonuclease                                     85.9    7e-17   
ref|WP_029426585.1|  endonuclease                                     85.9    7e-17   
ref|WP_019541220.1|  hypothetical protein                             85.9    8e-17   
gb|EXY27878.1|  endonuclease/exonuclease/phosphatase family protein   85.5    8e-17   
ref|WP_025725647.1|  MULTISPECIES: endonuclease                       85.5    9e-17   
ref|WP_005549220.1|  hypothetical protein                             85.9    9e-17   
dbj|GAF24362.1|  bacillopeptidase F                                   85.9    9e-17   
ref|WP_007216961.1|  endonuclease                                     85.5    9e-17   
gb|EEF90972.1|  endonuclease/exonuclease/phosphatase family protein   85.5    9e-17   
ref|WP_035398652.1|  hypothetical protein                             85.5    1e-16   
ref|WP_022209993.1|  uncharacterized protein                          85.5    1e-16   
ref|WP_009366966.1|  hypothetical protein                             85.5    1e-16   
ref|WP_028376043.1|  hypothetical protein                             85.5    1e-16   
gb|EIY61264.1|  hypothetical protein HMPREF1070_03935                 85.5    1e-16   
ref|WP_019069452.1|  hypothetical protein                             85.5    1e-16   
ref|WP_032848939.1|  endonuclease                                     85.5    1e-16   
emb|CBW22280.1|  putative endonuclease/exonuclease/phosphatase fa...  85.5    1e-16   
gb|EIL87069.1|  Metal-dependent hydrolase                             85.5    1e-16   
ref|WP_022210644.1|  hypothetical protein                             85.5    1e-16   
ref|WP_032573034.1|  endonuclease                                     85.5    1e-16   
ref|WP_005794950.1|  MULTISPECIES: endonuclease                       85.5    1e-16   
ref|WP_011202553.1|  endonuclease                                     85.1    1e-16   
ref|WP_034256712.1|  hypothetical protein                             85.5    1e-16   
ref|WP_007219440.1|  endonuclease                                     85.1    1e-16   
ref|WP_025830904.1|  endonuclease                                     85.1    1e-16   
ref|WP_008768342.1|  MULTISPECIES: endonuclease                       85.1    1e-16   
ref|WP_032588663.1|  endonuclease                                     85.1    1e-16   
ref|WP_032571805.1|  endonuclease                                     85.1    1e-16   
ref|WP_041161357.1|  endonuclease                                     85.1    1e-16   
ref|WP_008103432.1|  endonuclease/exonuclease/phosphatase family      85.1    1e-16   
ref|WP_029566437.1|  hypothetical protein                             85.1    1e-16   
ref|WP_032561189.1|  endonuclease                                     85.1    1e-16   
ref|WP_044269382.1|  endonuclease                                     85.1    1e-16   
ref|WP_035227337.1|  hypothetical protein                             84.7    2e-16   
gb|AIL47237.1|  endonuclease/exonuclease/phosphatase family protein   84.7    2e-16   
ref|WP_009589927.1|  endonuclease                                     86.7    2e-16   
ref|WP_016661022.1|  hypothetical protein                             84.7    2e-16   
ref|WP_030607078.1|  endonuclease                                     84.7    2e-16   
ref|WP_042366631.1|  endonuclease                                     84.7    2e-16   
ref|WP_037616073.1|  endonuclease                                     84.7    2e-16   
ref|WP_036664147.1|  endonuclease                                     86.7    2e-16   
ref|WP_009194734.1|  hypothetical protein                             84.7    2e-16   
ref|WP_034040517.1|  endonuclease/exonuclease/phosphatase             84.7    2e-16   
gb|EXY13631.1|  endonuclease/exonuclease/phosphatase family protein   84.3    2e-16   
ref|WP_034262757.1|  hypothetical protein                             84.7    2e-16   
ref|XP_004341877.1|  endonuclease/exonuclease/phosphatase family ...  85.9    2e-16   
ref|WP_042192690.1|  endonuclease                                     84.3    3e-16   
ref|WP_035133662.1|  endonuclease/exonuclease/phosphatase             84.3    3e-16   
emb|CEL19822.1|  FIG01132624: hypothetical protein                    84.3    3e-16   
gb|KGE14238.1|  endonuclease/exonuclease/phosphatase                  84.0    3e-16   
ref|WP_030927614.1|  endonuclease                                     84.0    3e-16   
ref|WP_034920494.1|  endonuclease/exonuclease/phosphatase             84.0    3e-16   
ref|WP_006677744.1|  hypothetical protein                             84.0    3e-16   
ref|WP_030433886.1|  endonuclease                                     84.0    3e-16   
dbj|GAK36452.1|  endonuclease/exonuclease/phosphatase family protein  84.0    3e-16   
ref|WP_007661979.1|  endonuclease                                     84.0    4e-16   
ref|WP_022834032.1|  endonuclease/exonuclease/phosphatase             84.0    4e-16   
ref|WP_032530816.1|  endonuclease                                     84.0    4e-16   
ref|WP_032542956.1|  endonuclease                                     84.0    4e-16   
ref|WP_032946117.1|  endonuclease                                     84.0    4e-16   
ref|WP_005840982.1|  MULTISPECIES: endonuclease                       84.0    4e-16   
gb|EHQ27880.1|  Endonuclease/exonuclease/phosphatase                  84.0    4e-16   
ref|WP_040627675.1|  endonuclease                                     84.0    4e-16   
ref|WP_026797634.1|  hypothetical protein                             83.6    4e-16   
ref|WP_027317900.1|  endonuclease                                     84.0    4e-16   
ref|WP_022011856.1|  hypothetical protein                             83.6    4e-16   
ref|WP_034678147.1|  endonuclease/exonuclease/phosphatase             83.6    4e-16   
ref|WP_005776030.1|  endonuclease                                     83.6    4e-16   
ref|WP_029465202.1|  hypothetical protein                             83.6    4e-16   
ref|WP_005809693.1|  MULTISPECIES: endonuclease                       83.6    4e-16   
ref|WP_012267164.1|  hypothetical protein                             83.6    4e-16   
ref|WP_029271901.1|  endonuclease/exonuclease/phosphatase             83.6    5e-16   
ref|WP_037498641.1|  endonuclease                                     83.6    5e-16   
ref|WP_027127035.1|  hypothetical protein                             83.6    5e-16   
ref|WP_039638893.1|  endonuclease                                     83.6    5e-16   
emb|CEN34831.1|  conserved exported hypothetical protein              83.6    5e-16   
ref|WP_042209122.1|  hypothetical protein                             83.2    5e-16   
gb|ELS49098.1|  endonuclease/Exonuclease/phosphatase family protein   83.2    6e-16   
ref|WP_041999605.1|  endonuclease                                     83.2    6e-16   
dbj|GAL95138.1|  endonuclease/exonuclease/phosphatase family protein  83.2    6e-16   
gb|ELP53896.1|  endonuclease/Exonuclease/phosphatase family protein   83.2    6e-16   
ref|WP_027290259.1|  hypothetical protein                             83.2    6e-16   
ref|WP_026625891.1|  endonuclease                                     83.2    6e-16   
gb|EOR95925.1|  endonuclease/exonuclease/phosphatase family protein   83.2    6e-16   
ref|WP_030661038.1|  endonuclease                                     83.2    6e-16   



>emb|CDP10236.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   239 bits (611),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNLLEDQ EDSPNSWDKRKD+C+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMTFNLLEDQAEDSPNSWDKRKDICISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
            TGY+QFGISRKG++D SDQ+CTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   TGYNQFGISRKGSEDTSDQYCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSIVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_009766071.1| PREDICTED: uncharacterized protein LOC104217495 [Nicotiana sylvestris]
Length=310

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNLLEDQPEDSPNSW+KRKDLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLSVMTFNLLEDQPEDSPNSWEKRKDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKGA+D SDQHCTIFYDK+KVELLEGGTFWLSESPSVPGSMSWGSTVPC A
Sbjct  61   QGYEQFGISRKGAEDTSDQHCTIFYDKDKVELLEGGTFWLSESPSVPGSMSWGSTVPCTA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_009605551.1| PREDICTED: uncharacterized protein LOC104100087 [Nicotiana tomentosiformis]
Length=310

 Score =   239 bits (611),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVS+++MTFNLLEDQPEDSPNSW+KRKDLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSISVMTFNLLEDQPEDSPNSWEKRKDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKGA+D SDQHCTIFYDK+KVELLEGGTFWLSESPSVPGSMSWGSTVPC A
Sbjct  61   QGYEQFGISRKGAEDTSDQHCTIFYDKDKVELLEGGTFWLSESPSVPGSMSWGSTVPCTA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_006343647.1| PREDICTED: uncharacterized protein LOC102586896 [Solanum tuberosum]
Length=310

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNLLEDQ EDSPNSW+KRKDLC+SVITSYSPMILCTQQGVKSQLDY+QQCL
Sbjct  1    MSVSLSVMTFNLLEDQLEDSPNSWEKRKDLCISVITSYSPMILCTQQGVKSQLDYIQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKGA+D SDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPC A
Sbjct  61   QGYEQFGISRKGAEDTSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCTA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_004242594.1| PREDICTED: uncharacterized protein LOC101268290 [Solanum lycopersicum]
Length=310

 Score =   236 bits (603),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNLLEDQ EDSPN+W+KRKDLC+SVITSYSPMILCTQQGVKSQLDY+QQCL
Sbjct  1    MSVSLSVMTFNLLEDQLEDSPNTWEKRKDLCISVITSYSPMILCTQQGVKSQLDYIQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKGA+D SDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPC A
Sbjct  61   QGYEQFGISRKGAEDTSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCTA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_008343896.1| PREDICTED: uncharacterized protein LOC103406687 [Malus domestica]
Length=197

 Score =   232 bits (592),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+M FNL EDQ EDSPNSWDKRKDLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMAFNLHEDQTEDSPNSWDKRKDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D +D+HCTIFYDKEKVE+LEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTADEHCTIFYDKEKVEMLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_011079409.1| PREDICTED: uncharacterized protein LOC105162931 [Sesamum indicum]
Length=308

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNLLEDQPEDSPNSW+KRKDLCV+VITSYSPMILCTQ+GVKSQLDYLQQCL
Sbjct  1    MSVSLTVMTFNLLEDQPEDSPNSWEKRKDLCVTVITSYSPMILCTQRGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG++D SDQHCTIFYDKEKVEL+EGGTFWLSESPSVPGS+SWGST PCI+
Sbjct  61   PGYEQFGISRKGSEDTSDQHCTIFYDKEKVELIEGGTFWLSESPSVPGSISWGSTEPCIS  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_008354328.1| PREDICTED: uncharacterized protein LOC103417949 isoform X3 [Malus 
domestica]
Length=275

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+M FNL EDQ EDSPNSWDKRKDLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMAFNLHEDQTEDSPNSWDKRKDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D +D+HCTIFYDKEKVE+LEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTADEHCTIFYDKEKVEMLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_008354327.1| PREDICTED: uncharacterized protein LOC103417949 isoform X2 [Malus 
domestica]
Length=310

 Score =   232 bits (591),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+M FNL EDQ EDSPNSWDKRKDLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMAFNLHEDQTEDSPNSWDKRKDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D +D+HCTIFYDKEKVE+LEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTADEHCTIFYDKEKVEMLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_008354326.1| PREDICTED: uncharacterized protein LOC103417949 isoform X1 [Malus 
domestica]
Length=344

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+M FNL EDQ EDSPNSWDKRKDLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMAFNLHEDQTEDSPNSWDKRKDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D +D+HCTIFYDKEKVE+LEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTADEHCTIFYDKEKVEMLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_009366177.1| PREDICTED: uncharacterized protein LOC103955982 isoform X3 [Pyrus 
x bretschneideri]
Length=275

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+M FNL EDQ EDSP SWDKRKDLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMAFNLHEDQTEDSPYSWDKRKDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D +D+HCTIFYDKEKVE+LEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTADEHCTIFYDKEKVEMLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_009358437.1| PREDICTED: uncharacterized protein LOC103949067 [Pyrus x bretschneideri]
Length=310

 Score =   229 bits (583),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQ EDSP SWDKR+DLC+SVITSYSP+ILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMTFNLHEDQTEDSPYSWDKRRDLCISVITSYSPIILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_008367748.1| PREDICTED: uncharacterized protein LOC103431379 [Malus domestica]
Length=310

 Score =   229 bits (583),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQ EDSP SWDKR+DLC+SVITSYSP+ILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMTFNLHEDQTEDSPYSWDKRRDLCISVITSYSPIILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_009366176.1| PREDICTED: uncharacterized protein LOC103955982 isoform X2 [Pyrus 
x bretschneideri]
Length=291

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+M FNL EDQ EDSP SWDKRKDLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMAFNLHEDQTEDSPYSWDKRKDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D +D+HCTIFYDKEKVE+LEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTADEHCTIFYDKEKVEMLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_007203657.1| hypothetical protein PRUPE_ppb007460mg [Prunus persica]
 gb|EMJ04856.1| hypothetical protein PRUPE_ppb007460mg [Prunus persica]
Length=310

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQ EDSP SW+KR+DLC+SVITSYSPMILCTQQGVKSQLDYL+QCL
Sbjct  1    MSVSLTVMTFNLHEDQTEDSPYSWEKRRDLCISVITSYSPMILCTQQGVKSQLDYLRQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSVVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_008242991.1| PREDICTED: uncharacterized protein LOC103341270 [Prunus mume]
Length=310

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQ EDSP SW+KR+DLC+SVITSYSPMILCTQQGVKSQLDYL QCL
Sbjct  1    MSVSLTVMTFNLHEDQTEDSPYSWEKRRDLCISVITSYSPMILCTQQGVKSQLDYLHQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSVVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_009366175.1| PREDICTED: uncharacterized protein LOC103955982 isoform X1 [Pyrus 
x bretschneideri]
Length=310

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+M FNL EDQ EDSP SWDKRKDLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMAFNLHEDQTEDSPYSWDKRKDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D +D+HCTIFYDKEKVE+LEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPEDTADEHCTIFYDKEKVEMLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_011033403.1| PREDICTED: uncharacterized protein LOC105131906 [Populus euphratica]
Length=315

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQ EDSPNSW+KRKDLC+SVIT+YSPMILCT+QGVK+QLDYLQQCL
Sbjct  1    MSVSLTVMTFNLHEDQAEDSPNSWEKRKDLCISVITNYSPMILCTEQGVKTQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY QFGISRKG+ D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWG+  PCIA
Sbjct  61   PGYGQFGISRKGSQDASDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGAAAPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>gb|ABK94135.1| unknown [Populus trichocarpa]
Length=315

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQ EDSPNSW+KRKDLC+SVIT+YSPMILCTQQGVK+QLDYLQQCL
Sbjct  1    MSVSLTVMTFNLHEDQAEDSPNSWEKRKDLCISVITNYSPMILCTQQGVKTQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY QFGISRKG+ D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS+SWG+  PCIA
Sbjct  61   PGYGQFGISRKGSQDASDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSLSWGAAAPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_002308403.2| hypothetical protein POPTR_0006s19790g [Populus trichocarpa]
 gb|EEE91926.2| hypothetical protein POPTR_0006s19790g [Populus trichocarpa]
Length=315

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQ EDSPNSW+KRKDLC+SVIT+YSPMILCTQQGVK+QLDYLQQCL
Sbjct  1    MSVSLTVMTFNLHEDQAEDSPNSWEKRKDLCISVITNYSPMILCTQQGVKTQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY QFGISRKG+ D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS+SWG+  PCIA
Sbjct  61   PGYGQFGISRKGSQDASDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSLSWGAAAPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>emb|CDY28225.1| BnaA01g06240D [Brassica napus]
Length=125

 Score =   221 bits (563),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNL +DQPE+SPNSWDKRKDLC+SVITSYSP+ILCTQQGVKSQLDY+QQ L
Sbjct  1    MSVSLSVMTFNLHDDQPEESPNSWDKRKDLCLSVITSYSPVILCTQQGVKSQLDYIQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +DP+D+ CTIFY+KEKVELLEGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PGYDQFGISRKGHEDPTDESCTIFYNKEKVELLEGGTFWLSESPSVPGSTAWGSEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>emb|CBI36528.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   221 bits (564),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQP+DSPNSW+KR+DLC+SVITSYSPMILCTQQGVK+QL++LQQ L
Sbjct  1    MSVSLTVMTFNLHEDQPDDSPNSWEKRRDLCISVITSYSPMILCTQQGVKTQLEFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQ GISRKG+ D SD+HCTIFYDKEKVELLE GTFWLSESPSVPGS SWGS VPCIA
Sbjct  61   PGYDQVGISRKGSQDTSDEHCTIFYDKEKVELLESGTFWLSESPSVPGSTSWGSVVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_006474001.1| PREDICTED: uncharacterized protein LOC102608798 [Citrus sinensis]
Length=312

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSV+L+LMTFNL EDQ EDSPNSW KR+DLC+SVITSYSP ILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVALSLMTFNLHEDQQEDSPNSWAKRRDLCISVITSYSPTILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFG+SRKG +D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS +WG+ VPCIA
Sbjct  61   PGYDQFGVSRKGPEDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSKAWGAEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>gb|KDO59459.1| hypothetical protein CISIN_1g021437mg [Citrus sinensis]
Length=312

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSV+L+LMTFNL EDQ EDSPNSW KR+DLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVALSLMTFNLHEDQQEDSPNSWVKRRDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFG+SRKG +D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS +WG+ VPCIA
Sbjct  61   PAYDQFGVSRKGPEDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSKAWGAEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_006453612.1| hypothetical protein CICLE_v10008980mg [Citrus clementina]
 gb|ESR66852.1| hypothetical protein CICLE_v10008980mg [Citrus clementina]
Length=312

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSV+L+LMTFNL EDQ EDSPNSW KR+DLC+SVITSYSPMILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVALSLMTFNLHEDQQEDSPNSWVKRRDLCISVITSYSPMILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFG+SRKG +D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS +WG+ VPCIA
Sbjct  61   PAYDQFGVSRKGPEDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSKAWGAEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_002529381.1| hypothetical protein RCOM_0623210 [Ricinus communis]
 gb|EEF32977.1| hypothetical protein RCOM_0623210 [Ricinus communis]
Length=258

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL +DQP+DSPNSW+ R+DLC+SVITSYSPMILCTQQGVKSQLDYLQQ L
Sbjct  1    MSVSLTVMTFNLYDDQPQDSPNSWETRRDLCISVITSYSPMILCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG+ D SD+HCTIFY+KEKVELLEGGTFWLS++PSVPGSMSWG+ VPCIA
Sbjct  61   PGYDQFGISRKGSQDTSDEHCTIFYEKEKVELLEGGTFWLSDAPSVPGSMSWGAAVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_003610317.1| hypothetical protein MTR_4g130840 [Medicago truncatula]
 gb|KEH32621.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=127

 Score =   219 bits (557),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MT NL +D+P+DSPNSWDKR+D+C+SVITSYSP+ILCTQQGVK+QLD+LQQ L
Sbjct  1    MSVSLTVMTLNLHDDEPQDSPNSWDKRRDICISVITSYSPIILCTQQGVKTQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFG+SRKG  D +D+HCTIFYDKEKVELLEGGTFWLSESPSVPGS+SWGS VPCIA
Sbjct  61   PGYDQFGVSRKGPQDTTDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSISWGSEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>gb|KDP38680.1| hypothetical protein JCGZ_04033 [Jatropha curcas]
Length=311

 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQP+DSPNSW++R+DLC+SVITSYSPMILCTQQG+KSQLD+LQQ L
Sbjct  1    MSVSLTVMTFNLHEDQPQDSPNSWERRRDLCISVITSYSPMILCTQQGIKSQLDHLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG+ D SD+HC IFYDKEKVELLEGGTFWLS+SPSVPGSMSWG+ VPCIA
Sbjct  61   PGYNQFGISRKGSQDTSDEHCNIFYDKEKVELLEGGTFWLSDSPSVPGSMSWGAAVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_003519148.1| PREDICTED: uncharacterized protein LOC100783799 [Glycine max]
Length=310

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL +D+P+DSPNSW+KR+D+C+SVITSYSP+ILCTQQGVK+QLD+LQQ L
Sbjct  1    MSVSLTVMTFNLHDDEPQDSPNSWEKRRDMCISVITSYSPIILCTQQGVKAQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG  D +DQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPQDTTDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>gb|EYU34347.1| hypothetical protein MIMGU_mgv1a010558mg [Erythranthe guttata]
Length=309

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+M FNLLEDQ EDSPNSWDKRKDLC +VITSYSP+ILCTQQGVKSQLDYLQQCL
Sbjct  1    MSVSLTVMNFNLLEDQTEDSPNSWDKRKDLCATVITSYSPIILCTQQGVKSQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY QFG+SRKG++D SDQHCTIFYDKEKVE+LEGGTFWLSESPSVPGS+SWGS+ P I+
Sbjct  61   PGYGQFGVSRKGSEDASDQHCTIFYDKEKVEVLEGGTFWLSESPSVPGSISWGSSNPSIS  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_011018034.1| PREDICTED: uncharacterized protein LOC105121182 [Populus euphratica]
Length=315

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL +DQ ED+PNSW+KRKDLC+SV+TSYSPMILCTQQGVK+QLDYLQQCL
Sbjct  1    MSVSLTVMTFNLHDDQAEDTPNSWEKRKDLCISVVTSYSPMILCTQQGVKTQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY QFGISRKG+ D  D+HCTIFYDKEKVELLE GTFWLSESPSVPGSMSWG+ VPCIA
Sbjct  61   PGYGQFGISRKGSQDSLDEHCTIFYDKEKVELLEDGTFWLSESPSVPGSMSWGAAVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_003610316.1| hypothetical protein MTR_4g130825 [Medicago truncatula]
Length=132

 Score =   217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MT NL +D+P+DSPNSWDKR+D+C+SVITSYSP+ILCTQQGVK+QLD+LQQ L
Sbjct  1    MSVSLTVMTLNLHDDEPQDSPNSWDKRRDICISVITSYSPIILCTQQGVKTQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFG+SRKG  D +D+HCTIFYDKEKVELLEGGTFWLSESPSVPGS+SWGS VPCIA
Sbjct  61   PGYDQFGVSRKGPQDTTDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSISWGSEVPCIA  120

Query  560  TW  565
            TW
Sbjct  121  TW  122



>ref|XP_009127415.1| PREDICTED: uncharacterized protein LOC103852248 [Brassica rapa]
 ref|XP_009127420.1| PREDICTED: uncharacterized protein LOC103852248 [Brassica rapa]
Length=317

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNL +DQPE+SPNSWDKRKDLC+SVITSYSP+ILCTQQGVKSQLDY+QQ L
Sbjct  1    MSVSLSVMTFNLHDDQPEESPNSWDKRKDLCLSVITSYSPVILCTQQGVKSQLDYIQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +DP+D+ CTIFY+KEKVELLEGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PGYDQFGISRKGHEDPTDESCTIFYNKEKVELLEGGTFWLSESPSVPGSTAWGSEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_003549542.1| PREDICTED: uncharacterized protein LOC100784843 isoform X1 [Glycine 
max]
Length=310

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL +D+P+DSPNSW+KR+DLC+SVITSYSP+ILCTQQGVK+QLD+LQQ L
Sbjct  1    MSVSLTVMTFNLYDDEPQDSPNSWEKRRDLCISVITSYSPIILCTQQGVKAQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG  D + +HCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  61   PGYDQFGISRKGPQDTTSEHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_008778405.1| PREDICTED: uncharacterized protein LOC103698197 isoform X1 [Phoenix 
dactylifera]
Length=307

 Score =   221 bits (563),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 1/124 (1%)
 Frame = +2

Query  200  MSVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQC  376
            MSVS+T+MTFNL E DQP DSPNSW+KR+DLC+SVITSYSP ILCTQQG+K QL+YLQQC
Sbjct  1    MSVSITVMTFNLHEGDQPSDSPNSWEKRRDLCISVITSYSPTILCTQQGLKWQLEYLQQC  60

Query  377  LTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCI  556
            L GYDQFGISRKG+ D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS+SWG+TVPCI
Sbjct  61   LPGYDQFGISRKGSQDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSISWGATVPCI  120

Query  557  ATWA  568
            ATWA
Sbjct  121  ATWA  124



>ref|XP_007011928.1| DNAse I-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY29547.1| DNAse I-like superfamily protein isoform 2 [Theobroma cacao]
Length=269

 Score =   220 bits (560),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MS+SLT+MTFNL EDQ EDSP+SW+KR+DLC+SVITSYSP+ILCTQQGVKSQLDYLQQ L
Sbjct  1    MSLSLTVMTFNLHEDQSEDSPDSWEKRRDLCISVITSYSPIILCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFG+SRKG  D SD+HCTIFYDKEKVEL+EGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PGYDQFGVSRKGPQDTSDEHCTIFYDKEKVELIEGGTFWLSESPSVPGSTAWGSVVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_010103675.1| hypothetical protein L484_002875 [Morus notabilis]
 gb|EXB96618.1| hypothetical protein L484_002875 [Morus notabilis]
Length=170

 Score =   216 bits (551),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 7/130 (5%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQ--  373
            MSVSLT+MTFNL EDQP +SPNSW+KR+DLC+SVITSY PMILCTQQGVKSQLDYLQQ  
Sbjct  1    MSVSLTVMTFNLHEDQPPESPNSWEKRRDLCLSVITSYYPMILCTQQGVKSQLDYLQQGL  60

Query  374  -----CLTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWG  538
                 C +GYDQFGISRKG  D  D+HCTIFYD+EKVE LEGGTFWLSESPSVPGSMSWG
Sbjct  61   PVDLPCSSGYDQFGISRKGPQDALDEHCTIFYDREKVEFLEGGTFWLSESPSVPGSMSWG  120

Query  539  STVPCIATWA  568
            + VPCIATWA
Sbjct  121  AAVPCIATWA  130



>ref|XP_010275824.1| PREDICTED: uncharacterized protein LOC104610749 isoform X1 [Nelumbo 
nucifera]
Length=310

 Score =   221 bits (563),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQPED PNSW+KR+DLC+SVITSYSPMILCTQQGV+SQLD+LQQ L
Sbjct  1    MSVSLTVMTFNLHEDQPEDGPNSWEKRRDLCISVITSYSPMILCTQQGVRSQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY QFGISRKG+ D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS SWGS VP IA
Sbjct  61   PGYGQFGISRKGSHDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSTSWGSVVPSIA  120

Query  560  TWA  568
            +WA
Sbjct  121  SWA  123



>gb|EPS71161.1| hypothetical protein M569_03592, partial [Genlisea aurea]
Length=310

 Score =   221 bits (562),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNLLEDQPE SPNSW+KRKDLC++VITSYSP ILCTQQG+KSQLDYLQQ L
Sbjct  1    MSVSLTVMTFNLLEDQPEGSPNSWEKRKDLCITVITSYSPAILCTQQGLKSQLDYLQQSL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG +D SDQ+C+IFYDK+KVELLEGGTFWLSESPSVPGS+SWGST PCI+
Sbjct  61   PGYEQFGISRKGFEDTSDQYCSIFYDKDKVELLEGGTFWLSESPSVPGSISWGSTEPCIS  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_007154882.1| hypothetical protein PHAVU_003G156000g [Phaseolus vulgaris]
 gb|ESW26876.1| hypothetical protein PHAVU_003G156000g [Phaseolus vulgaris]
Length=310

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL +D+P DSPNSW+KR+DLC+SVIT+YSP+ILCTQQGVK+QLD+LQQ L
Sbjct  1    MSVSLTVMTFNLHDDEPHDSPNSWEKRRDLCISVITNYSPIILCTQQGVKTQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG  D +D+HCTIFYDKEKVELLEGGTFWLSESPSVPGS+SWGS VPCIA
Sbjct  61   PGYDQFGISRKGPQDTTDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSISWGSEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_002278804.1| PREDICTED: uncharacterized protein LOC100263811 [Vitis vinifera]
Length=310

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQP+DSPNSW+KR+DLC+SVITSYSPMILCTQQGVK+QL++LQQ L
Sbjct  1    MSVSLTVMTFNLHEDQPDDSPNSWEKRRDLCISVITSYSPMILCTQQGVKTQLEFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQ GISRKG+ D SD+HCTIFYDKEKVELLE GTFWLSESPSVPGS SWGS VPCIA
Sbjct  61   PGYDQVGISRKGSQDTSDEHCTIFYDKEKVELLESGTFWLSESPSVPGSTSWGSVVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_007011929.1| DNAse I-like superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY29548.1| DNAse I-like superfamily protein isoform 3 [Theobroma cacao]
Length=312

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MS+SLT+MTFNL EDQ EDSP+SW+KR+DLC+SVITSYSP+ILCTQQGVKSQLDYLQQ L
Sbjct  1    MSLSLTVMTFNLHEDQSEDSPDSWEKRRDLCISVITSYSPIILCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFG+SRKG  D SD+HCTIFYDKEKVEL+EGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PGYDQFGVSRKGPQDTSDEHCTIFYDKEKVELIEGGTFWLSESPSVPGSTAWGSVVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_007011927.1| DNAse I-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY29546.1| DNAse I-like superfamily protein isoform 1 [Theobroma cacao]
Length=326

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MS+SLT+MTFNL EDQ EDSP+SW+KR+DLC+SVITSYSP+ILCTQQGVKSQLDYLQQ L
Sbjct  1    MSLSLTVMTFNLHEDQSEDSPDSWEKRRDLCISVITSYSPIILCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFG+SRKG  D SD+HCTIFYDKEKVEL+EGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PGYDQFGVSRKGPQDTSDEHCTIFYDKEKVELIEGGTFWLSESPSVPGSTAWGSVVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>gb|KJB27341.1| hypothetical protein B456_004G291800 [Gossypium raimondii]
Length=312

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL ED+ EDSPNSW+KR+DLC+SVITSYSP+ILCTQQGVKSQLDYLQQ L
Sbjct  1    MSVSLTVMTFNLHEDESEDSPNSWEKRRDLCISVITSYSPIILCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG  D SD+ CTIFYDKEKVEL+EGGTFWLSESPSVPGS SWGS VPCIA
Sbjct  61   PGYDQFGISRKGPQDTSDECCTIFYDKEKVELIEGGTFWLSESPSVPGSTSWGSVVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>gb|KJB27340.1| hypothetical protein B456_004G291800 [Gossypium raimondii]
Length=321

 Score =   219 bits (557),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL ED+ EDSPNSW+KR+DLC+SVITSYSP+ILCTQQGVKSQLDYLQQ L
Sbjct  1    MSVSLTVMTFNLHEDESEDSPNSWEKRRDLCISVITSYSPIILCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG  D SD+ CTIFYDKEKVEL+EGGTFWLSESPSVPGS SWGS VPCIA
Sbjct  61   PGYDQFGISRKGPQDTSDECCTIFYDKEKVELIEGGTFWLSESPSVPGSTSWGSVVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_010265582.1| PREDICTED: uncharacterized protein LOC104603285 isoform X2 [Nelumbo 
nucifera]
Length=310

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNL  DQ EDSPNSW+KR+DLC+SVITSYSPMILCTQQG+KSQL++LQQ L
Sbjct  1    MSVSLSVMTFNLHGDQLEDSPNSWEKRRDLCISVITSYSPMILCTQQGLKSQLEFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY QFGISRKG+ DPSD+HCTIFYDKEKV+LLEGGTFWLSESPSVPGS SWGS VPCIA
Sbjct  61   PGYGQFGISRKGSHDPSDEHCTIFYDKEKVDLLEGGTFWLSESPSVPGSTSWGSAVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_010908249.1| PREDICTED: uncharacterized protein LOC105034697 isoform X1 [Elaeis 
guineensis]
Length=307

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 116/124 (94%), Gaps = 1/124 (1%)
 Frame = +2

Query  200  MSVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQC  376
            MSVS+T+MTFNL E DQP +SPNSW+KR+DLC+SVITSYSP ILCTQQG+K QL++LQQC
Sbjct  1    MSVSITVMTFNLHEGDQPSESPNSWEKRRDLCISVITSYSPTILCTQQGLKWQLEHLQQC  60

Query  377  LTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCI  556
            L GYDQFG+SRKG+ D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS+SWG+TVPCI
Sbjct  61   LPGYDQFGVSRKGSQDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSISWGATVPCI  120

Query  557  ATWA  568
            ATWA
Sbjct  121  ATWA  124



>ref|XP_011462483.1| PREDICTED: uncharacterized protein LOC101314402 [Fragaria vesca 
subsp. vesca]
Length=309

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSV LT+MTFNL ED  EDS NSW+KR+DLC+SV+TSYSPMILCTQQG KSQLDYLQQCL
Sbjct  1    MSV-LTVMTFNLHEDPNEDSSNSWEKRRDLCISVVTSYSPMILCTQQGAKSQLDYLQQCL  59

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +D SD+HCTIFY+KEKVELLEGGTFWLSESPSVPGSMSWG+ VPCIA
Sbjct  60   PGYDQFGISRKGPEDTSDEHCTIFYEKEKVELLEGGTFWLSESPSVPGSMSWGAEVPCIA  119

Query  560  TWA  568
            TW 
Sbjct  120  TWV  122



>ref|XP_010436319.1| PREDICTED: uncharacterized protein LOC104720045 [Camelina sativa]
Length=320

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            M+VSL++MTFNL +DQPE+SPNSW KRKDLC+SVITSYSP++LCTQQGV+SQLDYLQQ L
Sbjct  1    MTVSLSVMTFNLHDDQPEESPNSWLKRKDLCLSVITSYSPIVLCTQQGVQSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFGISRKG  D +D+HCTIFY+KEKVELLEGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PAYDQFGISRKGPQDANDEHCTIFYNKEKVELLEGGTFWLSESPSVPGSTAWGSVVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_006412651.1| hypothetical protein EUTSA_v10025727mg [Eutrema salsugineum]
 ref|XP_006412652.1| hypothetical protein EUTSA_v10025727mg [Eutrema salsugineum]
 gb|ESQ54104.1| hypothetical protein EUTSA_v10025727mg [Eutrema salsugineum]
 gb|ESQ54105.1| hypothetical protein EUTSA_v10025727mg [Eutrema salsugineum]
Length=322

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNL +DQPE+SPNSW KRKDLC+SVITSYSP++LCTQQGVKSQLDYLQQ L
Sbjct  1    MSVSLSVMTFNLHDDQPEESPNSWQKRKDLCLSVITSYSPIVLCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFGISRKG+ D +D+ CTIFY+KEKVELLEGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PAYDQFGISRKGSQDATDESCTIFYNKEKVELLEGGTFWLSESPSVPGSTAWGSAVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_004507739.1| PREDICTED: uncharacterized protein LOC101488559 [Cicer arietinum]
Length=310

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MT NL +D+ EDSPNSW+KR+D+C+SVITSYSP+ILCTQQGVK+QLD+LQQ L
Sbjct  1    MSVSLTVMTLNLHDDEAEDSPNSWEKRRDICISVITSYSPIILCTQQGVKTQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFG+SRKG  D +D+HCTIFYDKEKVELLEGGTFWLSESPSVPGS SWGS VPCIA
Sbjct  61   PGYDQFGVSRKGPQDTTDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSFSWGSEVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_010265581.1| PREDICTED: uncharacterized protein LOC104603285 isoform X1 [Nelumbo 
nucifera]
Length=338

 Score =   217 bits (552),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNL  DQ EDSPNSW+KR+DLC+SVITSYSPMILCTQQG+KSQL++LQQ L
Sbjct  1    MSVSLSVMTFNLHGDQLEDSPNSWEKRRDLCISVITSYSPMILCTQQGLKSQLEFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY QFGISRKG+ DPSD+HCTIFYDKEKV+LLEGGTFWLSESPSVPGS SWGS VPCIA
Sbjct  61   PGYGQFGISRKGSHDPSDEHCTIFYDKEKVDLLEGGTFWLSESPSVPGSTSWGSAVPCIA  120

Query  560  TWA  568
            TW 
Sbjct  121  TWV  123



>ref|XP_010048746.1| PREDICTED: uncharacterized protein LOC104437486 [Eucalyptus grandis]
 ref|XP_010048798.1| PREDICTED: uncharacterized protein LOC104437524 [Eucalyptus grandis]
 gb|KCW81114.1| hypothetical protein EUGRSUZ_C02493 [Eucalyptus grandis]
Length=310

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MS SLT+MTFNLL+DQ EDSPNSW KR+++CVSVIT YSP+ILCTQQGVKSQLDYLQQ L
Sbjct  1    MSASLTVMTFNLLDDQGEDSPNSWLKRREMCVSVITCYSPIILCTQQGVKSQLDYLQQFL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG+ D  D+HCTIFYDKEKVELLEGGTFWLS+SPSVPGS SWGS VPCIA
Sbjct  61   PGYDQFGISRKGSQDTIDEHCTIFYDKEKVELLEGGTFWLSDSPSVPGSKSWGSAVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_010447644.1| PREDICTED: uncharacterized protein LOC104730207 [Camelina sativa]
 ref|XP_010447645.1| PREDICTED: uncharacterized protein LOC104730207 [Camelina sativa]
 ref|XP_010447646.1| PREDICTED: uncharacterized protein LOC104730207 [Camelina sativa]
Length=316

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            M+VSL++MTFNL +DQPE+SPNSW KRKDLC+SVITSYSP++LCTQQGV+SQLDYLQQ L
Sbjct  1    MTVSLSVMTFNLHDDQPEESPNSWLKRKDLCLSVITSYSPIVLCTQQGVQSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFGISRKG  D +D+HCTIFY+KEKVELLEGGTFWLSESPSVPGS +WGS VPC+A
Sbjct  61   PAYDQFGISRKGPQDANDEHCTIFYNKEKVELLEGGTFWLSESPSVPGSTAWGSAVPCVA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_006282675.1| hypothetical protein CARUB_v10005285mg [Capsella rubella]
 gb|EOA15573.1| hypothetical protein CARUB_v10005285mg [Capsella rubella]
Length=316

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNL +D+PE+SPNSW KRKDLC+SVITSYSP++LCTQQGV+SQLD+LQQ L
Sbjct  1    MSVSLSVMTFNLHDDEPEESPNSWHKRKDLCLSVITSYSPIVLCTQQGVQSQLDHLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFGISRKG  D +D+HCTIFY+KEKVELLEGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PAYDQFGISRKGPQDANDEHCTIFYNKEKVELLEGGTFWLSESPSVPGSSAWGSAVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_009387996.1| PREDICTED: uncharacterized protein LOC103974833 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 1/124 (1%)
 Frame = +2

Query  200  MSVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQC  376
            MSVS+++MTFNL E DQP DSPNSW+KRKDLCVSVITSYSP ILCTQQG+K QL++LQQC
Sbjct  1    MSVSISVMTFNLHEGDQPSDSPNSWEKRKDLCVSVITSYSPTILCTQQGLKWQLEFLQQC  60

Query  377  LTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCI  556
            L  Y+QFGISRKG+ D SD++CTIFYDK+KVELLEGGTFWLSESPSVPGSMSWG+TVPCI
Sbjct  61   LPAYEQFGISRKGSQDTSDEYCTIFYDKDKVELLEGGTFWLSESPSVPGSMSWGATVPCI  120

Query  557  ATWA  568
            ATWA
Sbjct  121  ATWA  124



>ref|XP_010438105.1| PREDICTED: uncharacterized protein LOC104721745 [Camelina sativa]
 ref|XP_010438106.1| PREDICTED: uncharacterized protein LOC104721745 [Camelina sativa]
 ref|XP_010438108.1| PREDICTED: uncharacterized protein LOC104721745 [Camelina sativa]
Length=316

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            M+VSL++MTFNL +DQPE+SPNSW KRKDLC+SVITSYSP++LCTQQGV+SQLDYLQQ L
Sbjct  1    MTVSLSVMTFNLHDDQPEESPNSWLKRKDLCLSVITSYSPIVLCTQQGVQSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFGISRKG  D +D+HCTIFY+KEKVELLEGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PVYDQFGISRKGPQDTNDEHCTIFYNKEKVELLEGGTFWLSESPSVPGSTAWGSVVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_010525805.1| PREDICTED: uncharacterized protein LOC104803560 isoform X1 [Tarenaya 
hassleriana]
Length=311

 Score =   214 bits (544),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNL +DQPE+SPNSW KR+DLC+SVI SYSP+ILCTQQGVKSQLD+LQQ L
Sbjct  1    MSVSLSVMTFNLHDDQPEESPNSWQKRRDLCLSVINSYSPIILCTQQGVKSQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFGISRKG  D SD+ CTIFY+KEKVELLEGGTFWLSESPSVPGS +WGSTVPCIA
Sbjct  61   PAYDQFGISRKGPQDASDECCTIFYNKEKVELLEGGTFWLSESPSVPGSTAWGSTVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_010525806.1| PREDICTED: uncharacterized protein LOC104803560 isoform X2 [Tarenaya 
hassleriana]
Length=310

 Score =   214 bits (544),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNL +DQPE+SPNSW KR+DLC+SVI SYSP+ILCTQQGVKSQLD+LQQ L
Sbjct  1    MSVSLSVMTFNLHDDQPEESPNSWQKRRDLCLSVINSYSPIILCTQQGVKSQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFGISRKG  D SD+ CTIFY+KEKVELLEGGTFWLSESPSVPGS +WGSTVPCIA
Sbjct  61   PAYDQFGISRKGPQDASDECCTIFYNKEKVELLEGGTFWLSESPSVPGSTAWGSTVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_008443859.1| PREDICTED: uncharacterized protein LOC103487355 [Cucumis melo]
Length=308

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSV+LT+M+FNL +DQP +S NSW+KR+DLC+SVITSYSP ILCTQQGVKSQLD+LQQ L
Sbjct  1    MSVTLTVMSFNLHDDQPPESSNSWEKRRDLCISVITSYSPAILCTQQGVKSQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG+ D SD+HCTIFY+KEKVELLEGGTFWLSESPSVPGSMSWGS  P IA
Sbjct  61   PGYDQFGISRKGSHDDSDEHCTIFYEKEKVELLEGGTFWLSESPSVPGSMSWGSIAPHIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_004146677.1| PREDICTED: uncharacterized protein LOC101208977 [Cucumis sativus]
 ref|XP_004161866.1| PREDICTED: uncharacterized LOC101208977 [Cucumis sativus]
 gb|KGN65162.1| hypothetical protein Csa_1G256710 [Cucumis sativus]
Length=308

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSV+LT+M+FNL +DQP +S NSW+KR+DLC+SVITSYSP ILCTQQGVKSQLD+LQQ L
Sbjct  1    MSVTLTVMSFNLHDDQPPESSNSWEKRRDLCISVITSYSPAILCTQQGVKSQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG+ D SD+HCTI+YDKEKVELLEGGTFWLSESPSVPGSMSWGS  P IA
Sbjct  61   PGYDQFGISRKGSHDDSDEHCTIYYDKEKVELLEGGTFWLSESPSVPGSMSWGSIAPHIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_002869355.1| hypothetical protein ARALYDRAFT_913382 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45614.1| hypothetical protein ARALYDRAFT_913382 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++M+FNL +DQPE+SPNSW KRKDLC++VITSYSP++LCTQQGVKSQLDYLQQ L
Sbjct  1    MSVSLSVMSFNLHDDQPEESPNSWLKRKDLCLTVITSYSPIVLCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFGISRKG  D +D+HCTIF++KEKVELLEGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PAYDQFGISRKGPQDANDEHCTIFFNKEKVELLEGGTFWLSESPSVPGSTAWGSAVPCIA  120

Query  560  TW  565
            TW
Sbjct  121  TW  122



>ref|XP_002325133.2| hypothetical protein POPTR_0018s11590g [Populus trichocarpa]
 gb|EEF03698.2| hypothetical protein POPTR_0018s11590g [Populus trichocarpa]
Length=304

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL +DQ EDSPNSW+KRKDLC+SV+TSYSPMILCTQQGVK+QLDYLQQCL
Sbjct  1    MSVSLTVMTFNLHDDQAEDSPNSWEKRKDLCISVVTSYSPMILCTQQGVKTQLDYLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCI  556
             GY QFGISRKG+ D  D+HCTIFYDKEKVELLE GTFWLSESPSVPGSMSWG+ VP I
Sbjct  61   PGYGQFGISRKGSQDSLDEHCTIFYDKEKVELLEDGTFWLSESPSVPGSMSWGAAVPWI  119



>gb|EEE63087.1| hypothetical protein OsJ_17895 [Oryza sativa Japonica Group]
Length=141

 Score =   203 bits (517),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S+S+T+MT NL E +QP +SPNSW++R+D+CVSVITSYSP ILCTQQG++ QLDYLQQCL
Sbjct  3    SLSITVMTLNLHEGEQPSESPNSWERRRDICVSVITSYSPTILCTQQGLRWQLDYLQQCL  62

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG++D +D++CTIFY+KEKVEL EGGTFWLSESPSVPGS+SWG+T PCIA
Sbjct  63   PGYEQFGISRKGSEDNTDEYCTIFYEKEKVELTEGGTFWLSESPSVPGSVSWGATAPCIA  122

Query  560  TWA  568
            TWA
Sbjct  123  TWA  125



>ref|NP_194819.3| endonuclease/exonuclease/phosphatase domain-containing protein 
[Arabidopsis thaliana]
 ref|NP_001119082.1| endonuclease/exonuclease/phosphatase domain-containing protein 
[Arabidopsis thaliana]
 gb|AEE85827.1| endonuclease/exonuclease/phosphatase domain-containing protein 
[Arabidopsis thaliana]
 gb|AEE85828.1| endonuclease/exonuclease/phosphatase domain-containing protein 
[Arabidopsis thaliana]
Length=316

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++M+FNL +D PE+SPNSW KRKDLC++VITSYSP++LCTQQGVKSQLDYLQQ L
Sbjct  1    MSVSLSVMSFNLHDDLPEESPNSWLKRKDLCLTVITSYSPIVLCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              YDQFGISR G  D +D+HCTIF++KEKVELLEGGTFWLSESPSVPGS +WGS VPCIA
Sbjct  61   PAYDQFGISRTGPGDANDEHCTIFFNKEKVELLEGGTFWLSESPSVPGSTAWGSAVPCIA  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>emb|CDX68702.1| BnaC01g07510D [Brassica napus]
Length=314

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSL++MTFNL +DQ E+SPNSWDKRKDLC+SVITSYSP+ILCTQQGVKSQLDY+QQ L
Sbjct  1    MSVSLSVMTFNLHDDQSEESPNSWDKRKDLCLSVITSYSPVILCTQQGVKSQLDYIQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GYDQFGISRKG +DP+D+ CTIFY+KEKVELLEGGTFWLSESPSVPGS +WGS VP   
Sbjct  61   PGYDQFGISRKGHEDPTDESCTIFYNKEKVELLEGGTFWLSESPSVPGSTAWGSEVPSAY  120

Query  560  TW  565
            T+
Sbjct  121  TF  122



>ref|XP_006655153.1| PREDICTED: uncharacterized protein LOC102699868 [Oryza brachyantha]
Length=307

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S+S+T+MT NLLE +QP +SPNSW++R+D+CVSVITSYSP ILCTQQG++ QLDYLQQCL
Sbjct  3    SLSITVMTLNLLEGEQPSESPNSWERRRDICVSVITSYSPTILCTQQGMRCQLDYLQQCL  62

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKGA D +D++CTIFY+KEKVEL EGGTFWLSESPSVPGS+SWG+T PCIA
Sbjct  63   PGYEQFGISRKGAQDNTDEYCTIFYEKEKVELTEGGTFWLSESPSVPGSISWGATAPCIA  122

Query  560  TWA  568
            TWA
Sbjct  123  TWA  125



>gb|KHN17493.1| hypothetical protein glysoja_005690 [Glycine soja]
Length=279

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL +D+P+DSPNSW+KR+DLC+SVITSYSP+ILCTQQGVK+QLD+LQQ L
Sbjct  1    MSVSLTVMTFNLYDDEPQDSPNSWEKRRDLCISVITSYSPIILCTQQGVKAQLDFLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTV  547
             GYDQFGISRKG  D + +HCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGS +
Sbjct  61   PGYDQFGISRKGPQDTTSEHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSEI  116



>gb|EMS56811.1| hypothetical protein TRIUR3_29894 [Triticum urartu]
Length=310

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S+S+T+MT NL E +QP +SPNSW+KR+D+CVSVITSYSP ILCTQQG++ QLDYLQQCL
Sbjct  3    SLSITVMTLNLHEGNQPSESPNSWEKRRDICVSVITSYSPTILCTQQGLRCQLDYLQQCL  62

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG+ D +D++CTIFY+KEKVEL EGGTFWLSESPSVPGS+SWG+T PCIA
Sbjct  63   PGYEQFGISRKGSQDTTDEYCTIFYEKEKVELTEGGTFWLSESPSVPGSISWGATAPCIA  122

Query  560  TWA  568
            TWA
Sbjct  123  TWA  125



>ref|XP_004962487.1| PREDICTED: uncharacterized protein LOC101775377 [Setaria italica]
Length=308

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S+S+T+MT NL E +QP +SPN+W+KR+D+CVSVITSYSP ILCTQQG++ QLDYLQQCL
Sbjct  3    SLSITVMTLNLHEGEQPSESPNTWEKRRDICVSVITSYSPTILCTQQGLRWQLDYLQQCL  62

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG+ D +D++CTIFY+KEKVEL EGGTFWLSESPSVPGS+SWG+T PCIA
Sbjct  63   PGYEQFGISRKGSQDTADEYCTIFYEKEKVELTEGGTFWLSESPSVPGSISWGATAPCIA  122

Query  560  TWA  568
            TWA
Sbjct  123  TWA  125



>gb|EEC78900.1| hypothetical protein OsI_19281 [Oryza sativa Indica Group]
Length=311

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S+S+T+MT NL E +QP +SPNSW++R+D+CVSVITSYSP ILCTQQG++ QLDYLQQCL
Sbjct  3    SLSITVMTLNLHEGEQPSESPNSWERRRDICVSVITSYSPTILCTQQGLRWQLDYLQQCL  62

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG++D +D++CTIFY+KEKVEL EGGTFWLSESPSVPGS+SWG+T PCIA
Sbjct  63   PGYEQFGISRKGSEDNTDEYCTIFYEKEKVELTEGGTFWLSESPSVPGSVSWGATAPCIA  122

Query  560  TWA  568
            TWA
Sbjct  123  TWA  125



>ref|XP_008663084.1| PREDICTED: uncharacterized protein LOC103641526 [Zea mays]
Length=308

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S+S+T+MT NL E +QP +SPNSW+KR+D+CVSVITSYSP ILCTQQG++ QLDYLQQCL
Sbjct  3    SLSITVMTLNLHEGEQPSESPNSWEKRRDICVSVITSYSPTILCTQQGLRWQLDYLQQCL  62

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG+ D +D++CTIFY+KEKVEL EGGTFWLSESPSVPGS+SWG+  PCIA
Sbjct  63   PGYEQFGISRKGSQDNTDEYCTIFYEKEKVELTEGGTFWLSESPSVPGSISWGANAPCIA  122

Query  560  TWA  568
            TWA
Sbjct  123  TWA  125



>ref|XP_002446198.1| hypothetical protein SORBIDRAFT_06g003360 [Sorghum bicolor]
 gb|EES10526.1| hypothetical protein SORBIDRAFT_06g003360 [Sorghum bicolor]
Length=308

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S+S+T+MT NL E +QP +SPNSW+KR+D+CVSVITSYSP ILCTQQG++ QLDYLQQCL
Sbjct  3    SLSITVMTLNLHEGEQPSESPNSWEKRRDICVSVITSYSPTILCTQQGLRWQLDYLQQCL  62

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG+ D +D++CTIFY+KEKVEL EGGTFWLSESPSVPGS+SWG+  PCIA
Sbjct  63   PGYEQFGISRKGSQDNTDEYCTIFYEKEKVELTEGGTFWLSESPSVPGSISWGANAPCIA  122

Query  560  TWA  568
            TWA
Sbjct  123  TWA  125



>ref|XP_008669587.1| PREDICTED: uncharacterized protein LOC103646656 [Zea mays]
Length=308

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S+S+T+MT NL E +QP +SPNSW+KR+D+CVSVITSYSP ILCTQQG++ QLDYLQQCL
Sbjct  3    SLSITVMTLNLHEGEQPSESPNSWEKRRDICVSVITSYSPTILCTQQGLRWQLDYLQQCL  62

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG+ D +D++CTIFY+KEKVEL EGGTFWLSESPSVPGS+SWG+  PCIA
Sbjct  63   PGYEQFGISRKGSQDNTDEYCTIFYEKEKVELTEGGTFWLSESPSVPGSISWGAKAPCIA  122

Query  560  TWA  568
            TWA
Sbjct  123  TWA  125



>gb|KHG21278.1| Uncharacterized protein F383_02575 [Gossypium arboreum]
Length=299

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL ED+ EDSPNSW+KR+DLC+SVITSYSP+ILCTQQGVKSQLDYLQQ L
Sbjct  1    MSVSLTVMTFNLHEDESEDSPNSWEKRRDLCISVITSYSPIILCTQQGVKSQLDYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGST  544
             GYDQFGISRKG  D SD+ CTIFYDKEKVEL+EGGTFWLSESPSVPGS SWGS 
Sbjct  61   PGYDQFGISRKGPQDTSDECCTIFYDKEKVELIEGGTFWLSESPSVPGSTSWGSV  115



>ref|XP_010687982.1| PREDICTED: uncharacterized protein LOC104902027 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010687983.1| PREDICTED: uncharacterized protein LOC104902027 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010687984.1| PREDICTED: uncharacterized protein LOC104902027 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=310

 Score =   200 bits (509),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MS+SLT+MTFNL  DQP DS NSW+KRKDLC+SVITSYSP ILCTQQG+K QL+YLQQ L
Sbjct  1    MSLSLTVMTFNLHNDQPADSLNSWEKRKDLCISVITSYSPTILCTQQGLKLQLEYLQQGL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY  FGISRKG +D SD+HC IF+DKEKVEL+EGGTFWLSESPSV GS+SWG+  PCI 
Sbjct  61   PGYGCFGISRKGVEDTSDEHCAIFFDKEKVELVEGGTFWLSESPSVAGSISWGAVAPCIV  120

Query  560  TWA  568
            TWA
Sbjct  121  TWA  123



>ref|XP_010228566.1| PREDICTED: uncharacterized protein LOC100833515 isoform X2 [Brachypodium 
distachyon]
Length=309

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 106/123 (86%), Gaps = 1/123 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S S+T+MT NL E DQP  SPN W+ R+D+CVSVITSY P ILCTQQG + QLDYLQQCL
Sbjct  3    SPSITVMTLNLQEGDQPSGSPNCWENRRDICVSVITSYCPAILCTQQGFRCQLDYLQQCL  62

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY+QFGISRKG++D SD++CTI Y+KEKVEL EGGTFWLSESPSVPGS+SWG+T PCIA
Sbjct  63   PGYEQFGISRKGSEDTSDEYCTILYEKEKVELTEGGTFWLSESPSVPGSISWGATAPCIA  122

Query  560  TWA  568
            TWA
Sbjct  123  TWA  125



>ref|XP_010275825.1| PREDICTED: uncharacterized protein LOC104610749 isoform X2 [Nelumbo 
nucifera]
Length=296

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 101/123 (82%), Gaps = 14/123 (11%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNL EDQPED PNSW+KR+DLC+SVITSYSPMILCTQQG            
Sbjct  1    MSVSLTVMTFNLHEDQPEDGPNSWEKRRDLCISVITSYSPMILCTQQG------------  48

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              Y QFGISRKG+ D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS SWGS VP IA
Sbjct  49   --YGQFGISRKGSHDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSTSWGSVVPSIA  106

Query  560  TWA  568
            +WA
Sbjct  107  SWA  109



>ref|XP_010908250.1| PREDICTED: uncharacterized protein LOC105034697 isoform X2 [Elaeis 
guineensis]
Length=293

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 15/124 (12%)
 Frame = +2

Query  200  MSVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQC  376
            MSVS+T+MTFNL E DQP +SPNSW+KR+DLC+SVITSYSP ILCTQQG           
Sbjct  1    MSVSITVMTFNLHEGDQPSESPNSWEKRRDLCISVITSYSPTILCTQQG-----------  49

Query  377  LTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCI  556
               YDQFG+SRKG+ D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS+SWG+TVPCI
Sbjct  50   ---YDQFGVSRKGSQDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSISWGATVPCI  106

Query  557  ATWA  568
            ATWA
Sbjct  107  ATWA  110



>ref|XP_010228565.1| PREDICTED: uncharacterized protein LOC100833515 isoform X1 [Brachypodium 
distachyon]
Length=339

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 107/153 (70%), Gaps = 31/153 (20%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S S+T+MT NL E DQP  SPN W+ R+D+CVSVITSY P ILCTQQG + QLDYLQQCL
Sbjct  3    SPSITVMTLNLQEGDQPSGSPNCWENRRDICVSVITSYCPAILCTQQGFRCQLDYLQQCL  62

Query  380  ------------------------------TGYDQFGISRKGADDPSDQHCTIFYDKEKV  469
                                          +GY+QFGISRKG++D SD++CTI Y+KEKV
Sbjct  63   PGPCSSLMDCMPHSAQVAFWVVERLARLGSSGYEQFGISRKGSEDTSDEYCTILYEKEKV  122

Query  470  ELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            EL EGGTFWLSESPSVPGS+SWG+T PCIATWA
Sbjct  123  ELTEGGTFWLSESPSVPGSISWGATAPCIATWA  155



>ref|XP_006857235.1| hypothetical protein AMTR_s00065p00210150 [Amborella trichopoda]
 gb|ERN18702.1| hypothetical protein AMTR_s00065p00210150 [Amborella trichopoda]
Length=267

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MSVSLT+MTFNLL+DQ  DSPNSW  R+D+C+SVITSYSPMILCTQQG+K QL++LQQCL
Sbjct  1    MSVSLTVMTFNLLDDQEPDSPNSWQNRRDICISVITSYSPMILCTQQGLKPQLEFLQQCL  60

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSES  508
             GY+QFGISRKG+ D +D+HC+IFYDKEK     G +F +  S
Sbjct  61   PGYEQFGISRKGSQDVTDEHCSIFYDKEKRVEPPGFSFQIVNS  103



>gb|KCW81115.1| hypothetical protein EUGRSUZ_C02493 [Eucalyptus grandis]
Length=270

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 76/123 (62%), Gaps = 40/123 (33%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MS SLT+MTFNLL+DQ EDSPNSW KR+++CVSVIT YSP+ILCTQQGVKSQLDYLQQ  
Sbjct  1    MSASLTVMTFNLLDDQGEDSPNSWLKRREMCVSVITCYSPIILCTQQGVKSQLDYLQQ--  58

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
                                                  +L +SPSVPGS SWGS VPCIA
Sbjct  59   --------------------------------------FLPDSPSVPGSKSWGSAVPCIA  80

Query  560  TWA  568
            TWA
Sbjct  81   TWA  83



>ref|XP_006600542.1| PREDICTED: uncharacterized protein LOC100784843 isoform X2 [Glycine 
max]
Length=255

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
            T YDQFGISRKG  D + +HCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGS VPCIA
Sbjct  6    TCYDQFGISRKGPQDTTSEHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSEVPCIA  65

Query  560  TWA  568
            TWA
Sbjct  66   TWA  68



>ref|XP_006453611.1| hypothetical protein CICLE_v10008980mg [Citrus clementina]
 ref|XP_006453613.1| hypothetical protein CICLE_v10008980mg [Citrus clementina]
 gb|ESR66851.1| hypothetical protein CICLE_v10008980mg [Citrus clementina]
 gb|ESR66853.1| hypothetical protein CICLE_v10008980mg [Citrus clementina]
Length=258

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             YDQFG+SRKG +D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS +WG+ VPCIAT
Sbjct  8    AYDQFGVSRKGPEDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSKAWGAEVPCIAT  67

Query  563  WA  568
            WA
Sbjct  68   WA  69



>ref|XP_007011930.1| DNAse I-like superfamily protein isoform 4 [Theobroma cacao]
 gb|EOY29549.1| DNAse I-like superfamily protein isoform 4 [Theobroma cacao]
Length=265

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 72/123 (59%), Gaps = 47/123 (38%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MS+SLT+MTFNL EDQ EDSP+SW+KR+DLC+SVITSYSP+ILCTQQ             
Sbjct  1    MSLSLTVMTFNLHEDQSEDSPDSWEKRRDLCISVITSYSPIILCTQQ-------------  47

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
                                              GGTFWLSESPSVPGS +WGS VPCIA
Sbjct  48   ----------------------------------GGTFWLSESPSVPGSTAWGSVVPCIA  73

Query  560  TWA  568
            TWA
Sbjct  74   TWA  76



>ref|XP_010275826.1| PREDICTED: uncharacterized protein LOC104610749 isoform X3 [Nelumbo 
nucifera]
Length=268

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  365  LQQCLTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGST  544
            L     GY QFGISRKG+ D SD+HCTIFYDKEKVELLEGGTFWLSESPSVPGS SWGS 
Sbjct  14   LHNMQIGYGQFGISRKGSHDTSDEHCTIFYDKEKVELLEGGTFWLSESPSVPGSTSWGSV  73

Query  545  VPCIATWA  568
            VP IA+WA
Sbjct  74   VPSIASWA  81



>gb|EIL88922.1| endonuclease-exonuclease-phosphatase family protein [Rhodanobacter 
sp. 115]
Length=270

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 77/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +MTFN+   + +D  N+W KR+DL V VI S  P IL TQ+ +  Q DYLQQ L GY 
Sbjct  13   LRVMTFNVRYGEAKDGINAWPKRRDLMVQVIRSEHPDILGTQELLSPQGDYLQQHLPGYK  72

Query  392  QFGISRKG--ADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
             FG+ R G   D   ++H  +FYD  ++++L+ G FW S++P  PGSMS+G  +P + TW
Sbjct  73   WFGMGRNGNEIDTNDNEHMGVFYDTTRLKVLKSGNFWFSDTPDKPGSMSFGQPMPRMVTW  132

Query  566  A  568
            A
Sbjct  133  A  133



>ref|WP_037101851.1| endonuclease [Rhodanobacter sp. 115]
Length=288

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 77/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +MTFN+   + +D  N+W KR+DL V VI S  P IL TQ+ +  Q DYLQQ L GY 
Sbjct  31   LRVMTFNVRYGEAKDGINAWPKRRDLMVQVIRSEHPDILGTQELLSPQGDYLQQHLPGYK  90

Query  392  QFGISRKG--ADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
             FG+ R G   D   ++H  +FYD  ++++L+ G FW S++P  PGSMS+G  +P + TW
Sbjct  91   WFGMGRNGNEIDTNDNEHMGVFYDTTRLKVLKSGNFWFSDTPDKPGSMSFGQPMPRMVTW  150

Query  566  A  568
            A
Sbjct  151  A  151



>gb|KCW81172.1| hypothetical protein EUGRSUZ_C02541 [Eucalyptus grandis]
Length=75

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            MS SLT+MTFNLL+DQ EDSPNSW KR+++CVSVIT YSP+ILCTQQGVKSQLDYLQQ L
Sbjct  1    MSASLTVMTFNLLDDQGEDSPNSWLKRREMCVSVITCYSPIILCTQQGVKSQLDYLQQFL  60

Query  380  TG-YDQFGISR  409
             G +  F ISR
Sbjct  61   PGNFRVFSISR  71



>ref|WP_040597465.1| endonuclease [Sphingomonas elodea]
Length=279

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +LT+M+ N+    P+D  N W+KR+ L ++ I +  P ++ TQ+  + Q D + + L  Y
Sbjct  26   ALTVMSLNIRYPSPDDGANLWEKRRALTIATIRAADPDLIGTQELFQRQGDDIVKALPRY  85

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FGI R+G    +D+H  +FY  ++++L+E G FWLS++P VPGS+SWG   P + TWA
Sbjct  86   RWFGIDRRGGH--ADEHMGVFYRHDRLKLIEQGQFWLSDTPEVPGSISWGHPFPRMVTWA  143



>ref|WP_025560397.1| MULTISPECIES: endonuclease [Sphingomonas]
Length=279

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D  N+W KR+++  +++   +P +  TQ+ +K Q D+L   L  Y 
Sbjct  25   LEVMSFNIRYANENDGANAWSKRREVTAAMLKKAAPDLFGTQELLKVQGDFLAARLKNYA  84

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG+ R+G ++  D+H  IFY  +++ L++ G FWLSE+P VPGS +WG+ +P +ATW 
Sbjct  85   WFGVGRRGGEE--DEHMGIFYRTDRLRLIKSGDFWLSETPEVPGSSAWGADLPRLATWG  141



>gb|AFW93615.1| hypothetical protein ANA_C10823 [Anabaena sp. 90]
Length=291

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 77/130 (59%), Gaps = 2/130 (2%)
 Frame = +2

Query  179  CQEIC*KMSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQL  358
             Q I  K+S+ +T+MTFNL  D+P+     W KR     S+I  Y P +L TQ+G   QL
Sbjct  24   VQTISLKISMQITVMTFNLRYDKPDPGVRQWKKRVGAIASLIQHYKPDLLGTQEGKSDQL  83

Query  359  DYLQQCLTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWG  538
              LQ  L  Y+  G  R G    S +HC IFY+ +  +L E   F+LS++P +PGS++WG
Sbjct  84   ADLQALLPEYNIIGGDRTGTG--SGEHCAIFYNPQSFKLQETQDFYLSDTPEIPGSITWG  141

Query  539  STVPCIATWA  568
            + +P +ATWA
Sbjct  142  TRLPRMATWA  151



>ref|WP_029724347.1| endonuclease [Sphingomonas sp. JGI 0001003-D23]
Length=279

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D  N+W KR+++  +++   +P +  TQ+ +K Q D+L   L  Y 
Sbjct  25   LEVMSFNIRYANENDGANAWSKRREVTAAMLKKAAPDLFGTQELLKVQGDFLAARLKNYA  84

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G ++  D+H  IFY  +++ L++ G FWLSE+P VPGS +WG+ +P +ATW 
Sbjct  85   WFGAGRRGGEE--DEHMGIFYRTDRLRLIKSGDFWLSETPEVPGSSAWGADLPRLATWG  141



>ref|XP_010687985.1| PREDICTED: uncharacterized protein LOC104902027 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=271

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
            GY  FGISRKG +D SD+HC IF+DKEKVEL+EGGTFWLSESPSV GS+SWG+  PCI T
Sbjct  23   GYGCFGISRKGVEDTSDEHCAIFFDKEKVELVEGGTFWLSESPSVAGSISWGAVAPCIVT  82

Query  563  WA  568
            WA
Sbjct  83   WA  84



>ref|WP_043741582.1| endonuclease [Luteimonas sp. J29]
Length=289

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 77/131 (59%), Gaps = 0/131 (0%)
 Frame = +2

Query  176  GCQEIC*KMSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQ  355
            GC+ +    + +L +M+FN+L  +  + P  W  R+D  V VI    P ++ TQ+ ++ Q
Sbjct  25   GCRTLEPAPAPALRVMSFNVLVARDIEGPARWSGRRDALVQVIADADPDLIGTQELLREQ  84

Query  356  LDYLQQCLTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSW  535
             +++   L  Y  FG  R+G     D+H  +FY +E++ L++ G FWLS++P VPGS+SW
Sbjct  85   GEFITARLPQYAWFGHGRRGDSADDDEHMGVFYHRERMRLIDSGHFWLSDTPDVPGSISW  144

Query  536  GSTVPCIATWA  568
            G+  P + TW 
Sbjct  145  GTKYPRMVTWG  155



>ref|WP_043130609.1| endonuclease [Sphingomonas phyllosphaerae]
Length=283

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +MTFN+    P D PN W  R+D+ +  +   +P ++ TQ+ +K+Q D + + L GY 
Sbjct  26   LRVMTFNVRFANPSDGPNVWPARRDVFMRTVRDANPDVIGTQELLKTQGDDIVRALPGYR  85

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R G  D   +H  +FY  ++++LL  G FWLSE+P  PG +SWG+ +P + TW 
Sbjct  86   WFGRDRLGGHD--GEHMGVFYRTDRLKLLRQGDFWLSETPETPGRISWGANLPRMVTWG  142



>ref|WP_019183219.1| endonuclease [Stenotrophomonas maltophilia]
Length=290

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+      D    W+ R+D  V++I    P ++ TQ+ V+ Q +YL   L GY
Sbjct  30   ALKVMSFNVRTPADTDPGKRWEDRRDAMVTLIREQKPEVIGTQELVRKQGEYLVAHLPGY  89

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG  R+G +  +D+H  + YD  ++++LE G FWLS++P VPGS++WG+  P + TWA
Sbjct  90   TLFGRDRRGGN--ADEHMGVLYDSARLKVLESGDFWLSDTPDVPGSITWGNLFPRMVTWA  147



>ref|WP_038688967.1| endonuclease [Stenotrophomonas rhizophila]
 gb|AHY59394.1| endonuclease [Stenotrophomonas rhizophila]
Length=288

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 73/122 (60%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +M+FN+      +    WD R+D  VS++    P +  TQ+ V+ Q DYL   L 
Sbjct  28   AAPLRVMSFNVRTPVDTEPGRRWDDRRDAMVSLLREQHPAVFGTQELVQKQADYLVAHLP  87

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
            GY  FG  R+G     D+H  +FYD  +++++E G FWLS++P VPGS++WG+ +P + T
Sbjct  88   GYRWFGKDRRGGS--GDEHMGVFYDSAQLKVVEQGDFWLSDTPDVPGSITWGNLMPRMVT  145

Query  563  WA  568
            WA
Sbjct  146  WA  147



>ref|WP_019420813.1| hypothetical protein [Paenibacillus sp. OSY-SE]
Length=263

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + +T M+FNL  ++ +D  N+W  R +    VI S+ P+++ TQ+G+   L  ++Q L  
Sbjct  1    MDVTFMSFNLRYNEIQDGENAWPYRVEKVAEVIRSHEPLVIGTQEGLHPMLLDMEQSLPQ  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y   G  R G     D+H  I+YDKE++  +E G FWLSE PS PGS+SW S++P I TW
Sbjct  61   YGFIGEGRYGGQ--QDEHNAIWYDKEQITPVESGQFWLSEQPSQPGSISWNSSLPRICTW  118

Query  566  A  568
            A
Sbjct  119  A  119



>ref|WP_044330154.1| endonuclease [Sphingomonas sp. WHSC-8]
 gb|AJP70873.1| endonuclease [Sphingomonas sp. WHSC-8]
Length=283

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 74/118 (63%), Gaps = 2/118 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D  N+W KR+D+  +++   +P I+ TQ+ +K Q D+L + L  Y 
Sbjct  29   LRVMSFNIRYANENDGANAWSKRRDVTAAMLEKAAPDIIGTQELLKEQGDFLAERLKRYA  88

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
              G+ R+G  D +D+H  +FY ++++ L++ G FWLS++P + GS+SWG   P + TW
Sbjct  89   WIGVGRRG--DDTDEHMGLFYRRDRLTLVQSGNFWLSDTPEIAGSISWGHPFPRMVTW  144



>ref|WP_012510732.1| endonuclease [Stenotrophomonas maltophilia]
 gb|ACF51277.1| Endonuclease/exonuclease/phosphatase [Stenotrophomonas maltophilia 
R551-3]
Length=284

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLPGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS+SWG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLTIEESGNFWLSDTPDVPGSISWGNLYPRMVTWA  146



>ref|WP_017356108.1| endonuclease [Stenotrophomonas maltophilia]
Length=291

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
             +L +M+FN+      D    W+ R+D  V++I    P ++ TQ+ V+ Q +YL   L G
Sbjct  29   AALKVMSFNVRTPADTDPGKRWEDRRDAMVTLIREQKPEVIGTQELVRKQGEYLVAHLPG  88

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y  FG  R+G +   D+H  + YD  ++++LE G FWLS++P VPGS++WG+  P + TW
Sbjct  89   YALFGKDRRGGN--GDEHMGVLYDTARLKVLESGDFWLSDTPDVPGSITWGNLFPRMVTW  146

Query  566  A  568
            A
Sbjct  147  A  147



>ref|WP_044569865.1| endonuclease [Stenotrophomonas maltophilia]
Length=284

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLRGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSITWGNLYPRMVTWA  146



>emb|CAQ45357.1| conserved hypothetical protein [Stenotrophomonas maltophilia 
K279a]
Length=298

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY 
Sbjct  44   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLRGYR  103

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  104  WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSITWGNLYPRMVTWA  160



>ref|WP_005416166.1| hypothetical protein [Stenotrophomonas maltophilia]
 gb|EMI50577.1| hypothetical protein C405_06436 [Stenotrophomonas maltophilia 
AU12-09]
Length=285

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ V+ Q DYL Q L GY 
Sbjct  31   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVQEQADYLAQHLPGYR  90

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  91   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSITWGNLYPRMVTWA  147



>ref|WP_021203969.1| endonuclease [Stenotrophomonas maltophilia]
 gb|EQM77727.1| endonuclease [Stenotrophomonas maltophilia MF89]
Length=284

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL   L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSGHLPGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS+SWG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSISWGNLYPRMVTWA  146



>ref|WP_019661229.1| endonuclease [Stenotrophomonas maltophilia]
Length=284

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL   L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSGHLPGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS+SWG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSISWGNLYPRMVTWA  146



>ref|WP_043399271.1| endonuclease [Stenotrophomonas maltophilia]
Length=284

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL   L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSGHLPGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS+SWG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSISWGNLYPRMVTWA  146



>ref|WP_019465881.1| hypothetical protein [Dyella japonica]
 gb|AIF49518.1| endonuclease [Dyella japonica A8]
Length=280

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D PN W+ R+DL V  I    P ++ TQ+  + Q DY+   L  Y 
Sbjct  28   LRVMSFNVRVPVAADGPNRWEARRDLMVRTIREQHPDVMGTQELHQEQGDYIVAKLPQYT  87

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FGI R+G     D+H  +FY K+K+ L + G FWLS++P  PGS++WG   P + TWA
Sbjct  88   WFGIDRRGGH--GDEHMGVFYRKDKLVLKDSGNFWLSDTPDQPGSITWGHPYPRMVTWA  144



>ref|WP_028971009.1| endonuclease [Sphingopyxis baekryungensis]
Length=275

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+ N+    P+D  N W+ R+DL V VI   +P ++ TQ+  + Q DY+ + L  Y 
Sbjct  23   LRVMSVNVRYPGPQDGENRWEARRDLLVDVIRDAAPDLIGTQELFQLQGDYITERLPAYA  82

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG+ R+G     D+H  I+Y ++++ LL+ G  WLSE P VPGS+SWG   P    W 
Sbjct  83   WFGVDRRGGH--GDEHMGIYYRRDRLTLLDSGQIWLSERPDVPGSISWGHPFPRTLAWG  139



>ref|WP_019338351.1| endonuclease [Stenotrophomonas maltophilia]
Length=284

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL   L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSGHLPGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSITWGNLYPRMVTWA  146



>ref|WP_014776142.1| endonuclease [Alistipes finegoldii]
 gb|AFL78923.1| metal-dependent hydrolase [Alistipes finegoldii DSM 17242]
Length=279

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            + SL++MTFN+  D PED  N+W  R++    VI +    +L TQ+ + +Q + L   LT
Sbjct  19   ATSLSVMTFNMRYDNPEDGQNNWRFRRERVAGVIKAQEVDVLGTQELLSNQFNDLSGLLT  78

Query  383  GYDQFGISR-KGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
            GY   G+ R  GA+  S ++C +F+ K++  LL+ GTFWLSE+P V GS+ W      IA
Sbjct  79   GYQGVGVGRLDGAE--SGEYCAVFFRKDRFTLLDSGTFWLSETPEVVGSLGWDGACERIA  136

Query  560  TW  565
            TW
Sbjct  137  TW  138



>ref|WP_010484417.1| endonuclease [[Pseudomonas] geniculata]
Length=284

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL   L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSGHLPGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSITWGNLYPRMVTWA  146



>ref|WP_033833096.1| endonuclease [Stenotrophomonas maltophilia]
Length=283

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 68/117 (58%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY  F
Sbjct  32   VMSFNVRTPADTEPGKRWPDRRDAMVKVILDARPAVIGTQELVKEQADYLSEHLPGYHWF  91

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G     D+H  +FYD + + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  92   GEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSITWGNLYPRMVTWA  146



>ref|WP_022043979.1| metal-dependent hydrolase [Alistipes finegoldii CAG:68]
 emb|CCZ75459.1| metal-dependent hydrolase [Alistipes finegoldii CAG:68]
Length=279

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            + SL++MTFN+  D PED  N+W  R++    VI +    +L TQ+ + +Q + L   LT
Sbjct  19   ATSLSVMTFNMRYDNPEDGQNNWRFRRERIAGVIKAQEVDVLGTQELLSNQFNDLSGLLT  78

Query  383  GYDQFGISR-KGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
            GY   G+ R  GA+  S ++C +F+ K++  LL+ GTFWLSE+P V GS+ W      IA
Sbjct  79   GYQGVGVGRLDGAE--SGEYCAVFFRKDRFTLLDSGTFWLSETPEVVGSLGWDGACERIA  136

Query  560  TW  565
            TW
Sbjct  137  TW  138



>ref|WP_023977954.1| endonuclease [Asaia sp. SF2.1]
 gb|ETC99229.1| endonuclease [Asaia sp. SF2.1]
Length=290

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            ++++M+FN+    P D  N WDKRK L +  I    P ++ TQ+  +SQ D + + L  Y
Sbjct  29   TVSVMSFNVRFPSPNDGSNIWDKRKSLFIETIRRAHPDVIGTQEIFQSQADAVIKALPKY  88

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG+ R GA   + +H  IFYD  ++ LLE G FWLS++P  PGS+ WG+ +P  A WA
Sbjct  89   RWFGLDRFGAH--TSEHMGIFYDPTRLCLLEHGQFWLSKTPDKPGSLGWGAPLPRSANWA  146



>emb|CCA23669.1| conserved hypothetical protein [Albugo laibachii Nc14]
 emb|CCA25330.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=291

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 70/122 (57%), Gaps = 5/122 (4%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
             + L +MTFNL     ED P  W  RKD  + +I  Y P I+ TQ+G+  QLD + + L 
Sbjct  20   GMPLKIMTFNLRYANTEDGPRGWIYRKDHVIDIINRYHPAIMGTQEGLADQLDDIDKNLI  79

Query  383  G-YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
              Y +FGI R    +P+ +H  IFYD   VEL++GG FWLSE+P   G++ W +    + 
Sbjct  80   HPYKRFGIER----EPNGEHEEIFYDTSVVELIKGGNFWLSETPDTFGTLGWDADCVRLV  135

Query  560  TW  565
            TW
Sbjct  136  TW  137



>ref|WP_015954319.1| hypothetical protein [Cyanothece sp. PCC 7424]
 gb|ACK70714.1| Endonuclease/exonuclease/phosphatase [Cyanothece sp. PCC 7424]
Length=262

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L L+TFN+  D+P+   ++W  R+    SVIT YSP ++ TQ+G   QL  L + L  Y 
Sbjct  3    LKLITFNIRYDKPDPDDHNWKVRRKAIASVITHYSPDLIGTQEGKAHQLLDLHRMLPHYQ  62

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSM--SWGSTVPCIATW  565
              G  R G    S++HC+IFY  +++  LE G F+LSE+P +PGS+  SWG+  P + TW
Sbjct  63   SVGGDRTGTR--SNEHCSIFYHSQRLNCLETGDFFLSETPEIPGSITESWGNPHPRMVTW  120

Query  566  A  568
            A
Sbjct  121  A  121



>ref|WP_041457662.1| endonuclease/exonuclease/phosphatase family protein [Anabaena 
sp. 90]
Length=259

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + +T+MTFNL  D+P+     W KR     S+I  Y P +L TQ+G   QL  LQ  L  
Sbjct  1    MQITVMTFNLRYDKPDPGVRQWKKRVGAIASLIQHYKPDLLGTQEGKSDQLADLQALLPE  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y+  G  R G    S +HC IFY+ +  +L E   F+LS++P +PGS++WG+ +P +ATW
Sbjct  61   YNIIGGDRTGTG--SGEHCAIFYNPQSFKLQETQDFYLSDTPEIPGSITWGTRLPRMATW  118

Query  566  A  568
            A
Sbjct  119  A  119



>ref|WP_004153210.1| Nocturnin [Stenotrophomonas maltophilia]
 emb|CCP16081.1| Nocturnin [Stenotrophomonas maltophilia RA8]
Length=284

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLPGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VP S+SWG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPDSISWGNLYPRMVTWA  146



>ref|WP_040008000.1| endonuclease [Stenotrophomonas sp. SKA14]
Length=284

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLPGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + +   G FWLS++P VPGS++WG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAIEASGNFWLSDTPDVPGSITWGNLYPRMVTWA  146



>ref|WP_005409116.1| endonuclease [Stenotrophomonas maltophilia]
 gb|EJP77020.1| hypothetical protein A1OC_01829 [Stenotrophomonas maltophilia 
Ab55555]
 gb|AIL08737.1| endonuclease/Exonuclease/phosphatase family protein [Stenotrophomonas 
maltophilia]
Length=284

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      ++   W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY  F
Sbjct  32   VMSFNVRTPADTEAGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLPGYRWF  91

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G     D+H  +FYD + + + E G FWLS++P  PGS++WG+  P + TWA
Sbjct  92   GEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDAPGSITWGNLYPRMVTWA  146



>gb|EED38962.1| endonuclease/exonuclease/phosphatase family protein [Stenotrophomonas 
sp. SKA14]
Length=291

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY 
Sbjct  37   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLPGYR  96

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + +   G FWLS++P VPGS++WG+  P + TWA
Sbjct  97   WFGEGRRGGS--GDEHMGVFYDSKVLAIEASGNFWLSDTPDVPGSITWGNLYPRMVTWA  153



>ref|WP_032128269.1| endonuclease [Stenotrophomonas maltophilia]
 gb|KGM24273.1| endonuclease [Stenotrophomonas maltophilia]
Length=284

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q D+L   L GY 
Sbjct  30   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADFLSGHLPGYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPEVPGSITWGNLYPRMVTWA  146



>ref|WP_009598084.1| endonuclease [Alistipes sp. HGB5]
 gb|EFR57427.1| endonuclease/exonuclease/phosphatase family protein [Alistipes 
sp. HGB5]
Length=279

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            + SL++MTFN+  D PED  N+W  R++    VI +    +L TQ+ + +Q + L   LT
Sbjct  19   ATSLSVMTFNMRYDNPEDGQNNWRFRRERVAGVIKAQEVDVLGTQELLSNQFNDLSGLLT  78

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
            GY   G+ R    + S ++C +F+ K++  LL+ GTFWLSE+P V GS+ W      IAT
Sbjct  79   GYQGVGVGRLDGVE-SGEYCAVFFRKDRFTLLDSGTFWLSETPEVVGSLGWDGACERIAT  137

Query  563  W  565
            W
Sbjct  138  W  138



>ref|WP_043035472.1| endonuclease [Stenotrophomonas maltophilia]
 gb|KIS37269.1| hypothetical protein WJ66_01715 [Stenotrophomonas maltophilia 
WJ66]
Length=283

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY  F
Sbjct  32   VMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLPGYRWF  91

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G     D+H  +FYD + + + E G FWLS++P  PGS++WG+  P + TWA
Sbjct  92   GEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDAPGSITWGNLYPRMVTWA  146



>ref|WP_036380102.1| endonuclease/exonuclease/phosphatase [Muricauda sp. MAR_2010_75]
Length=280

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L ++++N+  D P D PN WD RK+  ++ +  Y+P +  TQ+G+  QL  +   L  Y
Sbjct  21   NLEVISYNIRYDNPNDKPNHWDNRKEFLIAQLNFYAPDVFGTQEGLVHQLKAIDDGLDKY  80

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG+ R   DD   +   IFY+K+K+++L+  TFWLSE+P VP S  W + +P I T+ 
Sbjct  81   TYFGVGRDHGDDRG-EFTAIFYNKDKLKVLDESTFWLSETPKVP-SKGWDAALPRICTYG  138



>ref|WP_032966628.1| endonuclease [Stenotrophomonas maltophilia]
Length=284

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY  F
Sbjct  32   VMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLPGYRWF  91

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G     D+H  +FYD + + + E G FWLS++P  PGS++WG+  P + TWA
Sbjct  92   GEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDAPGSITWGNLYPRMVTWA  146



>gb|EMF59043.1| Hypothetical protein EPM1_4313 [Stenotrophomonas maltophilia 
EPM1]
Length=291

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      +    W  R+D  V VI    P ++ TQ+ VK Q DYL + L GY  F
Sbjct  39   VMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVKEQADYLSEHLPGYRWF  98

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G     D+H  +FYD + + + E G FWLS++P  PGS++WG+  P + TWA
Sbjct  99   GEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDAPGSITWGNLYPRMVTWA  153



>ref|WP_026690547.1| hypothetical protein [Bacillus aurantiacus]
Length=261

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 65/121 (54%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + L +MTFNL  D   D  NSW  RKD    VI    P I+ TQ+     +  L + L  
Sbjct  1    MDLNVMTFNLRIDLESDGENSWIHRKDFVADVIRKLQPDIMGTQEATADMISDLNERLPD  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y+  G  R+G  +  D+HC +F++ +K+ L    TFWLSE+P   GS SWGS  P I TW
Sbjct  61   YEAAGEGRRGGHE--DEHCAVFFNTKKINLRFHHTFWLSETPEKKGSKSWGSAYPRICTW  118

Query  566  A  568
             
Sbjct  119  V  119



>ref|WP_029902879.1| endonuclease [Prevotella sp. 10(H)]
Length=284

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 1/126 (1%)
 Frame = +2

Query  191  C*KMSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQ  370
            C +  V L +M+FN+  D P DS N+W  RKD+   +I  Y+  I+ TQ+ + +QL+ L+
Sbjct  17   CKEKPVELNVMSFNIRYDNPADSLNNWQYRKDVAARIIKDYNSDIVGTQEVLVNQLNDLK  76

Query  371  QCLTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVP  550
              L  Y+  G+ R+   +   ++C I Y K+K + ++ G FWLSE+P V GS  W     
Sbjct  77   AGLPEYNAIGVGRQDGKEKG-EYCAILYKKDKFKEIKSGYFWLSETPEVAGSKGWDGACE  135

Query  551  CIATWA  568
             IATWA
Sbjct  136  RIATWA  141



>ref|WP_010035080.1| endonuclease [Gemmata obscuriglobus]
Length=290

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 72/118 (61%), Gaps = 1/118 (1%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            + +M+FN+     +D  N WDKRK+     + ++ P +L TQ+ +  Q D+L Q LTGY+
Sbjct  27   VRVMSFNIRYGTAKDGENHWDKRKEFLADTVKAFGPDLLGTQETLIFQRDFLSQKLTGYE  86

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
              G+ R+   +  +    +++ K + E  +GG FWLSE+P+V GS SW S++P +ATW
Sbjct  87   GLGVGREDGKEKGET-TALYWRKARFEKTDGGHFWLSETPNVAGSKSWDSSLPRMATW  143



>ref|WP_013191422.1| hypothetical protein [Trichormus azollae]
 gb|ADI64405.1| Endonuclease/exonuclease/phosphatase ['Nostoc azollae' 0708]
Length=256

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + +T+M+FNL  D+P+     W+KR     SVI  Y P ++ TQ+G   QL  LQ  L  
Sbjct  1    MKITVMSFNLRYDKPDSGVRQWEKRIGAIASVIQHYQPDLIGTQEGKTPQLSNLQALLPE  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y   G  R G  +   +HC +FY+ +++EL +   F+LS++P +PGS++W + +P +ATW
Sbjct  61   YKFIGGDRTGTGE--GEHCAVFYNPQRLELQQTKDFYLSDTPEIPGSITWDTRLPRMATW  118

Query  566  A  568
            A
Sbjct  119  A  119



>tpg|DAA38364.1| TPA: hypothetical protein ZEAMMB73_818223 [Zea mays]
Length=64

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLE-DQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            S+S+T+MT NL E +QP +SPNSW+KR+D+CVSVITSYSP ILCTQQG++ QLDYLQQCL
Sbjct  3    SLSITVMTLNLHEGEQPSESPNSWEKRRDICVSVITSYSPTILCTQQGLRWQLDYLQQCL  62

Query  380  TG  385
             G
Sbjct  63   PG  64



>ref|WP_032959133.1| endonuclease [Stenotrophomonas maltophilia]
 gb|KDE89989.1| endonuclease [Stenotrophomonas maltophilia M30]
Length=285

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ V+ Q +YL   L GY 
Sbjct  31   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVQEQAEYLAGHLPGYR  90

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  91   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSITWGNLYPRMVTWA  147



>ref|WP_007127566.1| endonuclease [Paenibacillus lactis]
 gb|EHB68264.1| Endonuclease/exonuclease/phosphatase [Paenibacillus lactis 154]
Length=260

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            +++  MTFNL  +   D  N+W  RK    +VIT  SP +  TQ+G  + L  L + L  
Sbjct  1    MNVITMTFNLRVNVDSDGSNAWPHRKHRAAAVITDASPDLFGTQEGSGAMLRDLDEALPE  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y + G  R G  D   +HC I+Y +    +L+ G FWLSE+P  PGS+ W  + P I TW
Sbjct  61   YGRIGTGRMGQGDRDGEHCAIYYKQADFSILQEGQFWLSETPEKPGSLGWDGSYPRICTW  120

Query  566  A  568
             
Sbjct  121  G  121



>ref|WP_028406035.1| endonuclease [Bacillus sp. J13]
Length=260

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            +++  MTFNL  +   D  N+W  RK    +VIT  SP +  TQ+G  + L  L + L  
Sbjct  1    MNVITMTFNLRVNVDSDGSNAWPHRKHRAAAVITDASPDLFGTQEGSGAMLRDLDEALPE  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y + G  R G  D   +HC I+Y +    +L+ G FWLSE+P  PGS+ W  + P I TW
Sbjct  61   YGRIGTGRMGQGDRDGEHCAIYYKQADFSILQEGQFWLSETPEKPGSLGWDGSYPRICTW  120

Query  566  A  568
             
Sbjct  121  G  121



>ref|WP_013321917.1| hypothetical protein [Cyanothece sp. PCC 7822]
 gb|ADN13810.1| Endonuclease/exonuclease/phosphatase [Cyanothece sp. PCC 7822]
Length=262

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L ++TFNL  D+P+ + N+W  R+    S++  YSP ++ TQ+G   QL  L + L  Y 
Sbjct  3    LKIITFNLRYDKPDPAQNNWRVRRAAIASLLNYYSPDLMGTQEGKAHQLLDLHRMLPEYQ  62

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSM--SWGSTVPCIATW  565
              G  R G    +++HC IFY + +++ LE G F+LSE+P +PGS+  SWG+  P + TW
Sbjct  63   SVGGDRTGTG--TNEHCAIFYHRRRLKCLETGDFFLSETPEIPGSITASWGNPHPRMVTW  120

Query  566  A  568
            A
Sbjct  121  A  121



>gb|AHX14743.1| endonuclease [Dyella jiangningensis]
Length=284

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 71/120 (59%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+      D PN W+ R+D+ V  +    P ++ TQ+  + Q DY+   L  Y
Sbjct  27   TLRVMSFNVRTPVAADGPNRWEARRDIFVRTVREQHPDLMGTQELHQEQGDYVVSKLPEY  86

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FGI R G    +D+H  +FY K+ + L + G+FWLS++P  PGS++WG  +P + TWA
Sbjct  87   TWFGIDRFGGH--ADEHMGVFYRKDVLRLKDSGSFWLSDTPDKPGSITWGHPLPRMVTWA  144



>ref|WP_036139157.1| endonuclease [Lysobacter daejeonensis]
 gb|KGM53521.1| endonuclease [Lysobacter daejeonensis GH1-9]
Length=286

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 71/123 (58%), Gaps = 2/123 (2%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            ++ +L +MTFN+      D  N W  R++  V ++ +  P ++ TQ+    Q DYL + L
Sbjct  25   VAPALRVMTFNVRLPTDADGDNRWVLRREQMVRLLAAQQPDVIGTQELYAEQGDYLAEHL  84

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY  FG  R+G   P D+H  + Y  +++ +L  G FWLS++P VPGS++W    P +A
Sbjct  85   RGYAWFGEGRRGG--PGDEHVGVLYRHDRLRVLASGDFWLSDTPDVPGSITWNHLYPRLA  142

Query  560  TWA  568
            TWA
Sbjct  143  TWA  145



>emb|CCH12316.1| hypothetical protein SMD_1770 [Stenotrophomonas maltophilia D457]
Length=292

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ V+ Q +YL   L GY 
Sbjct  38   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVQEQAEYLAGHLPGYR  97

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  98   WFGEGRRGGS--GDEHMGVFYDSKVLAIEESGNFWLSDTPDVPGSITWGNLYPRMVTWA  154



>ref|WP_038621472.1| endonuclease [Dyella jiangningensis]
Length=286

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 71/120 (59%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+      D PN W+ R+D+ V  +    P ++ TQ+  + Q DY+   L  Y
Sbjct  29   TLRVMSFNVRTPVAADGPNRWEARRDIFVRTVREQHPDLMGTQELHQEQGDYVVSKLPEY  88

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FGI R G    +D+H  +FY K+ + L + G+FWLS++P  PGS++WG  +P + TWA
Sbjct  89   TWFGIDRFGGH--ADEHMGVFYRKDVLRLKDSGSFWLSDTPDKPGSITWGHPLPRMVTWA  146



>ref|WP_043100597.1| endonuclease [Xanthomonadaceae bacterium 3.5X]
 gb|KGI78097.1| endonuclease [Xanthomonadaceae bacterium 3.5X]
Length=280

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +MTFN+      D  N+W KR+ L V VI +  P +L TQ+  + Q  Y+   L GY 
Sbjct  26   LRVMTFNVRVPVASDGINAWPKRRALLVRVIKTQHPDVLGTQELTEEQGTYIAAHLPGYA  85

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G      +H  +FY  +++E+L+ G FWLS++PSV GS +WG  +P + TWA
Sbjct  86   WFGQGREGGT--KGEHMGVFYRTDRLEVLKSGDFWLSDTPSVVGSKTWGQPLPRMVTWA  142



>ref|WP_037293166.1| hypothetical protein [Saccharibacillus sacchari]
Length=275

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +MTFNL      D  N W +R    V  + +++P I   Q+     L+ LQQ L 
Sbjct  10   AFKLKVMTFNLRTHTANDEGNEWVQRAPWAVETVAAHAPAIFGVQEAYVLMLEDLQQGLP  69

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y   G  R+GA++  D+HC IFY  ++ E LE G FWLSE+P V GS+ W S  P I T
Sbjct  70   DYRWIGQGRRGANE--DEHCAIFYRHDEYEELEQGQFWLSETPDVVGSLGWDSDYPRICT  127

Query  563  WA  568
            W 
Sbjct  128  WG  129



>ref|WP_014036832.1| endonuclease [Stenotrophomonas maltophilia]
 gb|AEM50949.1| Endonuclease/exonuclease/phosphatase [Stenotrophomonas maltophilia 
JV3]
Length=285

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+D  V VI    P ++ TQ+ V+ Q +YL   L GY 
Sbjct  31   LKVMSFNVRTPADTEPGKRWPDRRDAMVKVILDAHPAVIGTQELVQEQAEYLSAHLPGYR  90

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD   + + E G FWLS++P VPGS++WG+  P + TWA
Sbjct  91   WFGEGRRGGS--GDEHMGVFYDSTVLAVEESGNFWLSDTPDVPGSITWGNLYPRMVTWA  147



>ref|WP_042464443.1| endonuclease/exonuclease/phosphatase family protein [Anabaena 
cylindrica]
Length=258

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + +T+M+FNL  D+P+     W KR     S+I  Y P +L TQ+G   QL  LQ  L  
Sbjct  1    MKITVMSFNLRYDKPDPGVRQWKKRVGAIASLIQHYQPDLLGTQEGKSHQLLDLQALLPE  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y   G  R G      +HC +FY+ ++++L +   F+LS++P +PGS++WG+ +P +ATW
Sbjct  61   YKFIGSDRTGTG--QGEHCAVFYNPQRLKLQQTQDFYLSDTPEIPGSITWGTRLPRMATW  118

Query  566  A  568
            A
Sbjct  119  A  119



>ref|WP_025834044.1| endonuclease [Bacteroides rodentium]
Length=289

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            ++ +M+FN+  D PEDS N+W  RKD   + I  Y   I+ TQ+ + +QL  LQQ L  Y
Sbjct  30   TMNVMSFNIRYDNPEDSLNNWQYRKDRAANAIRFYDADIVGTQEVLHNQLQDLQQRLPDY  89

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
               G+ R    +   ++  ++Y KE+ E+L+ GTFWLSE+P V GS  W      +A+WA
Sbjct  90   GVIGVGRTDGKEKG-EYSALWYKKERFEVLDSGTFWLSETPEVAGSKGWDGACERVASWA  148



>ref|WP_025852029.1| endonuclease [Paenibacillus ehimensis]
Length=261

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 71/125 (57%), Gaps = 4/125 (3%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + L +MTFNL  +   D  N+W  R     + I   +P+++ TQ+G  + L  L + L G
Sbjct  1    MELNVMTFNLRVNTSVDGDNAWPYRIRHAAAAIKKTAPLVVGTQEGTNAMLLDLDRELPG  60

Query  386  YDQFGISRKG----ADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPC  553
            Y + G  R G     D   D+ C I+Y ++++ L+  G FWLSE+P VPGS SW S++P 
Sbjct  61   YGRLGEGRSGPLSEEDRLRDEGCAIYYRQDRLALVSNGQFWLSETPDVPGSKSWDSSLPR  120

Query  554  IATWA  568
            I TWA
Sbjct  121  ICTWA  125



>ref|WP_020475720.1| hypothetical protein [Zavarzinella formosa]
Length=292

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  + +M+FN+     +D  N WDKRKD     + ++ P +L TQ+ +  Q D+L + LT
Sbjct  28   TADIKVMSFNVRYGTAKDGDNHWDKRKDFLADTVKAFGPDLLGTQETLGFQRDFLAEKLT  87

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
            GY+  G+ R    +  +    I++ K++ E  +GG FWLSE+P   GS SW +++P +AT
Sbjct  88   GYEFMGLGRDDGKEKGEM-MAIYWKKDRFEKTDGGHFWLSETPEKAGSKSWDTSLPRMAT  146

Query  563  W  565
            W
Sbjct  147  W  147



>ref|WP_036742048.1| hypothetical protein, partial [Paenibacillus sp. URHA0014]
Length=252

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 66/116 (57%), Gaps = 2/116 (2%)
 Frame = +2

Query  221  MTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQFG  400
            MTFNL  ++P+D  N+W  R      +I  + P++  TQ+G  + L  L   L  Y   G
Sbjct  1    MTFNLRYNEPKDGGNAWPYRVKRVARIIKEHDPILFGTQEGYHNMLLELHGELDAYSWLG  60

Query  401  ISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            + R G  +  D+HC IFY K+++E+L+ G FWLS++P VP S  W S  P + TW 
Sbjct  61   MGRFGGHE--DEHCAIFYKKDQLEVLDEGQFWLSDTPEVPASTCWDSMFPRMCTWV  114



>ref|WP_009094936.1| endonuclease/exonuclease/phosphatase family protein [Rhodopirellula 
sp. SWK7]
 gb|EMI46082.1| endonuclease/exonuclease/phosphatase family protein [Rhodopirellula 
sp. SWK7]
Length=303

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FNL      D  N WDKRK+     I ++SP +L TQ+ +  Q DYL + L  Y 
Sbjct  23   LRVMSFNLRYGTARDGGNHWDKRKEFVAETIAAFSPDLLGTQETLGFQKDYLNEKLPAYT  82

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
              G+ R    D + +   +FY  E+ E L+ G FWLSE+P V GS+SW S++  +A+W
Sbjct  83   SLGVGRDDGGD-AGEMTALFYKTERFEKLDEGHFWLSETPDVTGSISWDSSLTRMASW  139



>ref|WP_025878848.1| endonuclease [Stenotrophomonas maltophilia]
Length=284

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W+ R+D  V VI    P ++ TQ+ V  Q +YL + L  Y 
Sbjct  30   LKVMSFNVRTPADTDPGKRWEDRRDAMVKVIQQAHPAVIGTQELVLEQANYLAEHLPDYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P V GS+SWG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAVEESGNFWLSDTPEVAGSISWGNLFPRMVTWA  146



>gb|EVT72121.1| endonuclease [Stenotrophomonas maltophilia 5BA-I-2]
Length=291

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W+ R+D  V VI    P ++ TQ+ V  Q +YL + L  Y 
Sbjct  37   LKVMSFNVRTPADTDPGKRWEDRRDAMVKVIQQAHPAVIGTQELVLEQANYLAEHLPDYR  96

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P V GS+SWG+  P + TWA
Sbjct  97   WFGEGRRGGS--GDEHMGVFYDSKVLAVEESGNFWLSDTPEVAGSISWGNLFPRMVTWA  153



>ref|WP_035444113.1| hypothetical protein [Asaia platycodi]
 emb|CDG39715.1| hypothetical protein ASAP_1670 [Asaia platycodi SF2.1]
Length=1264

 Score =   101 bits (251),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +2

Query  209   SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
             ++++M+FN+    P D  N WDKRK L +  I    P ++ TQ+  +SQ D + + L  Y
Sbjct  1003  TVSVMSFNVRFPSPNDGSNIWDKRKSLFIETIRRAHPDVIGTQEIFQSQADAVIKALPKY  1062

Query  389   DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
               FG+ R GA   + +H  IFYD  ++ LLE G FWLS++P  PGS+ WG+ +P  A WA
Sbjct  1063  RWFGLDRFGAH--TSEHMGIFYDPTRLCLLEHGQFWLSKTPDKPGSLGWGAPLPRSANWA  1120



>ref|WP_042597078.1| endonuclease [Xanthomonas campestris]
 gb|KIQ26337.1| endonuclease [Xanthomonas campestris]
Length=288

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   VSVI    P +  TQ+ V  Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDTDGDKRWQARRGAMVSVIKQTHPNVFGTQELVSEQAGYLTAQLPNYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   + ++E G FWLS++P V GS++WG+ +P + TWA
Sbjct  95   WFGQGRRGDD--SDEHMGVFYDTRALNVVESGNFWLSDTPEVAGSITWGNVLPRMVTWA  151



>ref|WP_031339241.1| endonuclease [Xanthomonas sp. M97]
Length=288

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +M+FN+      D    W  R+   V+++    P +  TQ+ V+ Q DYL + L 
Sbjct  32   AAPLRVMSFNVRVPVDTDGDKRWKVRRSAMVALLRQTHPDVFGTQELVREQADYLTRQLP  91

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y  FG  R+G D  SD+H  +FYD   ++++E G FWLS++P V GS++WG  +P + T
Sbjct  92   HYRWFGQGRRGDD--SDEHMGVFYDTRALKVIESGNFWLSDTPEVAGSITWGQPLPRMVT  149

Query  563  WA  568
            WA
Sbjct  150  WA  151



>ref|WP_033830850.1| endonuclease [Stenotrophomonas maltophilia]
Length=284

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W+ R+D  V VI    P ++ TQ+ V  Q +YL + L  Y 
Sbjct  30   LKVMSFNVRTPADTDPGKRWEDRRDAMVKVIQQAHPAVIGTQELVLEQANYLAEHLPDYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P V GS+SWG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAVEESGNFWLSDTPEVAGSISWGNLFPRMVTWA  146



>ref|WP_032977829.1| endonuclease [Stenotrophomonas sp. RIT309]
 gb|EZP43213.1| Endonuclease/exonuclease/phosphatase family protein [Stenotrophomonas 
sp. RIT309]
Length=284

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W+ R+D  V VI    P ++ TQ+ V  Q +YL + L  Y 
Sbjct  30   LKVMSFNVRTPADTDPGKRWEDRRDAMVKVIQQAHPAVIGTQELVLEQANYLAEHLPDYR  89

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G     D+H  +FYD + + + E G FWLS++P V GS+SWG+  P + TWA
Sbjct  90   WFGEGRRGGS--GDEHMGVFYDSKVLAVEESGNFWLSDTPEVAGSISWGNLFPRMVTWA  146



>ref|WP_011038545.1| endonuclease [Xanthomonas campestris]
 ref|NP_638793.1| hypothetical protein XCC3447 [Xanthomonas campestris pv. campestris 
str. ATCC 33913]
 gb|AAM42717.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris 
str. ATCC 33913]
 gb|AAY47795.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris 
str. 8004]
Length=288

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   VSVI    P +  TQ+ V  Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDTDGDKRWQARRGAMVSVIKQTHPDVFGTQELVSEQAGYLAAQLPNYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   + ++E G FWLS++P V GS++WG+ +P + TWA
Sbjct  95   WFGQGRRGDD--SDEHMGVFYDTRTLNVVESGNFWLSDTPEVAGSITWGNVLPRMVTWA  151



>ref|WP_043921954.1| endonuclease [Xanthomonas campestris]
Length=288

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   VSVI    P +  TQ+ V  Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDTDGDKRWQARRGAMVSVIKQTHPDVFGTQELVSEQAGYLTAQLPNYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   + ++E G FWLS++P V GS++WG+ +P + TWA
Sbjct  95   WFGQGRRGDD--SDEHMGVFYDTRALNVVESGNFWLSDTPEVAGSITWGNVLPRMVTWA  151



>ref|WP_014031508.1| endonuclease/exonuclease/phosphatase [Muricauda ruestringensis]
 gb|AEM69224.1| Endonuclease/exonuclease/phosphatase [Muricauda ruestringensis 
DSM 13258]
Length=276

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            ++ ++++N+  D P+D+PN+WD RK+  +S +  Y+P +   Q+G+  Q+  + + L  Y
Sbjct  21   TIDVISYNIRYDNPDDAPNNWDNRKEFLISQLNFYNPDVFGIQEGLIHQVKEIDEGLEDY  80

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG+ R   D+   +H  IFYDK++V+L+E  TFWLS +P  P S  W + +P   T+ 
Sbjct  81   AYFGVGRDYGDERG-EHTAIFYDKKRVKLIEQSTFWLSLTPDKP-SKGWDAALPRTCTYG  138



>gb|AEL08647.1| endonuclease-exonuclease-phosphatase family [Xanthomonas campestris 
pv. raphani 756C]
Length=326

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   VSVI    P +  TQ+ V  Q  YL   L  Y 
Sbjct  73   LRVMSFNVRVPVDTDGDKRWQARRGAMVSVIKQTHPDVFGTQELVSEQAGYLTAQLPNYR  132

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   + ++E G FWLS++P V GS++WG+ +P + TWA
Sbjct  133  WFGQGRRGDD--SDEHMGVFYDTRALNVVESGNFWLSDTPEVAGSITWGNVLPRMVTWA  189



>ref|WP_040431966.1| endonuclease, partial [Actinoplanes globisporus]
Length=258

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL-TGY  388
            L +MTFNL     + +PNSW +R+ +  +++T   P ++ TQ+G+ +QL  ++  L  GY
Sbjct  2    LDVMTFNL-RYAGDTAPNSWAQRRPVMRALLTKERPDLIGTQEGLPAQLRDIRSDLGAGY  60

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
               G+ R G D  + +H  IF+DK ++  LE G FWLSE+P+VPGS+SWG+    + TW
Sbjct  61   AYIGMGRDGGD--AGEHMAIFFDKARLLPLESGNFWLSETPAVPGSVSWGAGHTRMVTW  117



>ref|WP_012437370.1| endonuclease [Xanthomonas campestris]
 emb|CAP50088.1| putative exported protein [Xanthomonas campestris pv. campestris]
Length=288

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   VSVI    P +  TQ+ V  Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDTDGDKRWQARRGAMVSVIKQTHPDVFGTQELVSEQAGYLTAQLPNYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   + ++E G FWLS++P V GS++WG+ +P + TWA
Sbjct  95   WFGQGRRGDD--SDEHMGVFYDTRALNVVESGNFWLSDTPEVAGSITWGNVLPRMVTWA  151



>gb|KGK56424.1| endonuclease [Xanthomonas sp. Nyagatare]
Length=287

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      +    W  R+   V++I    P +  TQ+ V  Q  YL   L  Y 
Sbjct  34   LRVMSFNVRVPADTEGDKRWQVRRSAMVALIRQTHPDVFGTQELVSEQAGYLAAQLPNYR  93

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD  K++++E G FWLS++P VP S++WG+ +P + TWA
Sbjct  94   WFGQGRRGDD--SDEHMGVFYDTRKLDVVESGNFWLSDTPEVPASITWGNVLPRMVTWA  150



>ref|WP_041047002.1| hypothetical protein [Paenibacillus sp. VKM B-2647]
 gb|KIL41299.1| hypothetical protein SD70_07505 [Paenibacillus sp. VKM B-2647]
Length=267

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 68/121 (56%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            +  ++MT NL  + P D  N+W  R +  V+++  Y P+++ TQ+G+   L  L + L  
Sbjct  1    MDFSVMTLNLRYNNPGDGDNAWPHRYEQVVALLRRYDPLVIGTQEGLHDMLLSLGEGLPE  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y   G  R G  D  D+H  IFY K ++ L   G FWLSE P  PGS+SW S++P I  W
Sbjct  61   YGWIGEGRYGGHD--DEHNAIFYKKTELGLAGQGQFWLSEHPDRPGSVSWESSLPRICVW  118

Query  566  A  568
            A
Sbjct  119  A  119



>ref|WP_041740053.1| endonuclease, partial [Echinicola vietnamensis]
Length=252

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            +T+ TFN+  D P D+PN WD RK++ V++I  +   I   Q+G+  Q+ YL + L  +D
Sbjct  12   MTVATFNIRYDNPGDAPNHWDHRKEVVVNLIQFHGFDIFGIQEGLHHQVQYLDEHLPTFD  71

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              G+ R    +   ++  IFY+KEK  +LE  TFWLS   + P +  W + +P I TWA
Sbjct  72   YVGVGRDNGQEKG-EYSAIFYNKEKFNVLESNTFWLSTDTTQP-NKGWDAALPRICTWA  128



>ref|WP_039573221.1| endonuclease [Xanthomonas axonopodis]
 gb|KGT53281.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD63362.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD67637.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD70052.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS24443.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS26821.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS35180.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS38064.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KIJ01312.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
Length=287

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L 
Sbjct  31   AAPLRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLP  90

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y  FG  R+G D  SD+H  +FYD   ++++E G FWLS++P  PGS++WG+ +P +AT
Sbjct  91   DYRWFGQGRRGDD--SDEHMGVFYDARVLKVVESGNFWLSDTPERPGSITWGNVLPRMAT  148

Query  563  WA  568
            WA
Sbjct  149  WA  150



>ref|WP_010500150.1| endonuclease [Paenibacillus elgii]
Length=261

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + L LMTFNL  + P D  N+W  R     + I   +P+++ TQ+G  + L  L + L G
Sbjct  1    MELNLMTFNLRVNTPVDGSNAWPYRIRQAAAAIKKTAPLVVGTQEGTNAMLLDLDRELPG  60

Query  386  YDQFGISRKGA----DDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPC  553
            Y + G  R G+    D   D+ C I+Y  + +  +  G FWLSE+P VPGS SW S++P 
Sbjct  61   YSRLGEGRSGSTNEEDRLHDECCAIYYRYDALAPVASGQFWLSETPDVPGSKSWDSSLPR  120

Query  554  IATWA  568
            I TWA
Sbjct  121  ICTWA  125



>ref|WP_017159070.1| endonuclease [Xanthomonas axonopodis]
Length=287

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L 
Sbjct  31   AAPLRVMSFNVRVPADTDGDKRWQVRRAAMVTLIKQTHPDVFGTQELVSEQAAFLAEQLP  90

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y  FG  R+G D  SD+H  +FYD   ++++E G FWLS++P  PGS++WG+ +P +AT
Sbjct  91   DYRWFGQGRRGDD--SDEHMGVFYDARVLKVVESGNFWLSDTPERPGSITWGNVLPRMAT  148

Query  563  WA  568
            WA
Sbjct  149  WA  150



>ref|WP_017155348.1| endonuclease [Xanthomonas axonopodis]
Length=287

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L 
Sbjct  31   AAPLRVMSFNVRVPADTDGDKRWQVRRAAMVTLIKQTHPDVFGTQELVSEQAAFLAEQLP  90

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y  FG  R+G D  SD+H  +FYD   ++++E G FWLS++P  PGS++WG+ +P +AT
Sbjct  91   DYRWFGQGRRGDD--SDEHMGVFYDARVLKVVESGNFWLSDTPERPGSITWGNVLPRMAT  148

Query  563  WA  568
            WA
Sbjct  149  WA  150



>gb|AGA80207.1| metal-dependent hydrolase [Echinicola vietnamensis DSM 17526]
Length=290

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            +T+ TFN+  D P D+PN WD RK++ V++I  +   I   Q+G+  Q+ YL + L  +D
Sbjct  33   MTVATFNIRYDNPGDAPNHWDHRKEVVVNLIQFHGFDIFGIQEGLHHQVQYLDEHLPTFD  92

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              G+ R    +   ++  IFY+KEK  +LE  TFWLS   + P    W + +P I TWA
Sbjct  93   YVGVGRDNGQEKG-EYSAIFYNKEKFNVLESNTFWLSTDTTQPNK-GWDAALPRICTWA  149



>ref|WP_026009056.1| endonuclease [Sphingomonas sp. ATCC 31555]
Length=280

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
             LT+M+ N+     +D  N W+KR+ L ++ I + +P ++ TQ+  + Q D + + L  Y
Sbjct  27   GLTVMSLNIRYPGKDDGANLWEKRRALTIATIRAAAPDLIGTQELFQRQGDDVVRALPQY  86

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG  R G     D+H  +FY  ++++++E G FWLS++P V GS+SWG  +P + TWA
Sbjct  87   RWFGTDRYGGH--KDEHMGVFYRHDRLKIVEQGQFWLSDTPEVAGSISWGHPLPRMVTWA  144



>gb|KDO23506.1| hypothetical protein SPRG_11428 [Saprolegnia parasitica CBS 223.65]
Length=341

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 69/119 (58%), Gaps = 5/119 (4%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG-Y  388
            L +MTFNL      D  NSWD RK     ++  Y P+I+ TQ+G+K QL  L   L G Y
Sbjct  69   LAIMTFNLRFAGANDGYNSWDYRKQHVYDLVNRYHPVIMGTQEGLKDQLAELHANLAGNY  128

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            ++FG+ R    +P+ +   IFYD + +E L+G  +WLS++P VP   +WG+    + TW
Sbjct  129  ERFGVER----EPNGEFEQIFYDADVLERLDGDNYWLSDTPEVPHETAWGAPCVRMVTW  183



>ref|WP_039530895.1| endonuclease [Xanthomonas arboricola]
 gb|KER80172.1| endonuclease [Xanthomonas arboricola pv. celebensis]
Length=288

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y  F
Sbjct  37   VMSFNVRVPVDTDGDKRWSVRRTAMVALIEQAHPDVFGTQELVQEQAQYLAAQLPDYRWF  96

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G D  SD+H  +FYD   V ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  97   GKGRRGDD--SDEHMGVFYDSRAVSVVESGDFWLSETPQVPGSSSWNTDLPRMVTWA  151



>ref|WP_020742136.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_008156649.1| hypothetical protein SCE1572_51570 [Sorangium cellulosum So0157-2]
 gb|AGP42216.1| hypothetical protein SCE1572_51570 [Sorangium cellulosum So0157-2]
Length=274

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 75/122 (61%), Gaps = 4/122 (3%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + L LMTFN+      D  N+W KR+++   VI   +P +L  Q+ ++SQLD L+  L  
Sbjct  1    MDLDLMTFNIRYANRRDGVNAWPKRREMAYEVIRDANPDVLGLQEALRSQLDDLRGALP-  59

Query  386  YDQFGISRK-GADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
            Y + G+ R  GA+  + ++  I Y+ ++ ++ E GTFWLS++P VPGS S+G+ V  I T
Sbjct  60   YAELGVGRNDGAE--TGEYAAILYNADRFDVDESGTFWLSDTPEVPGSRSFGNVVVRICT  117

Query  563  WA  568
            WA
Sbjct  118  WA  119



>ref|WP_016661564.1| hypothetical protein [Bacteroides stercoris]
 gb|EPH20714.1| hypothetical protein HMPREF1181_01343 [Bacteroides stercoris 
CC31F]
Length=287

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 71/122 (58%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            S+ + +M+FN+  D P DS NSW  R+D   + I  Y   IL TQ+ + +QL+ L+Q L 
Sbjct  26   SLPVNVMSFNIRYDNPGDSLNSWQYRRDRAATAIHFYDADILGTQEVLHNQLEDLKQRLP  85

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             YD  G+ R+   +   ++  ++Y KE+  LL+ G FWLSE+P V GS  W      +A+
Sbjct  86   EYDVVGVGREDGKEKG-EYSALWYKKERFVLLDSGNFWLSETPEVAGSKGWDGACERMAS  144

Query  563  WA  568
            WA
Sbjct  145  WA  146



>ref|WP_036882259.1| hypothetical protein [Porphyromonas sp. COT-239 OH1446]
 gb|KGN67201.1| hypothetical protein HQ37_08235 [Porphyromonas sp. COT-239 OH1446]
Length=280

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 69/118 (58%), Gaps = 1/118 (1%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+  D P+D+PN W  RKD   ++I +YSP +L TQ+ +  QL  L++ L  Y+
Sbjct  20   LLVMSFNIRYDNPDDAPNDWTHRKDSLAALIRTYSPDLLGTQEVLHQQLTDLKERLPEYE  79

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
             +G+ R        ++  I Y +++  + + G FWLS+ P V GSM W +    IATW
Sbjct  80   AYGVGRLDGRQQG-EYAAILYRRDRFSVEDAGYFWLSDQPEVAGSMGWDAACERIATW  136



>ref|WP_041326973.1| endonuclease/exonuclease/phosphatase [Robiginitalea biformata]
Length=286

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            LT M++N+  D P D  +SWD+RK+  ++ I  ++P ++ TQ+G+  QL  ++  L GY 
Sbjct  29   LTAMSYNIRYDNPGDGRDSWDQRKEFLIAQIAYHAPDVVGTQEGLLHQLRDMEVALEGYA  88

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R   DD   +H  +FY+  ++ELLE  TFWLSE+P VP S  W + +  + T+ 
Sbjct  89   FFGKGRDQGDD-QGEHTAVFYNTGQLELLEEETFWLSETPEVP-SKGWDAALNRVCTYG  145



>ref|WP_016851472.1| endonuclease [Xanthomonas axonopodis]
 gb|EWC51062.1| endonuclease [Xanthomonas axonopodis pv. glycines str. 8ra]
Length=287

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L  Y 
Sbjct  34   LRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLPDYR  93

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   +EL+E G FWLS++P   GS++WG+ +P +ATWA
Sbjct  94   WFGQGRRGDD--SDEHMGVFYDARVLELVESGDFWLSDTPERAGSITWGNVLPRMATWA  150



>ref|WP_013545729.1| endonuclease [Bacteroides helcogenes]
 gb|ADV42091.1| Endonuclease/exonuclease/phosphatase [Bacteroides helcogenes 
P 36-108]
Length=287

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 69/119 (58%), Gaps = 1/119 (1%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            + +M+FN+  D PEDS N+W  RKD   + I  Y   +L TQ+ + +QL  LQ+CL  Y 
Sbjct  29   VNVMSFNIRYDNPEDSLNNWRYRKDRVATAIRFYDTDLLGTQEVLHNQLKDLQECLPEYG  88

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              G+ R+   +   ++  ++Y K++  LL+ G FWLSE+P V GS  W      IA+WA
Sbjct  89   VVGVGREDGKEKG-EYSALWYKKDRFVLLDSGNFWLSETPGVAGSKGWDGACERIASWA  146



>ref|WP_009606291.1| putative exported protein [Xanthomonas translucens]
 gb|EKU24220.1| putative exported protein [Xanthomonas translucens pv. graminis 
ART-Xtg29]
Length=292

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+      D    W+ R+    ++I +  P +  TQ+ VK Q DYL   L  Y
Sbjct  38   TLKVMSFNVRVPVDSDGDKRWEIRRSAMAALIRAQHPDVFGTQELVKRQADYLAAQLPDY  97

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
              FG SR G++D   +   +FYD  +++LLE G FWLS++P+V GS+SWG  +P +  W
Sbjct  98   RWFGRSRDGSED--GERMGVFYDSRRLKLLESGDFWLSDTPAVVGSISWGHPLPRMVNW  154



>ref|WP_007968534.1| endonuclease [Xanthomonas fuscans]
 gb|EFF42132.1| conserved hypothetical protein [Xanthomonas fuscans subsp. aurantifolii 
str. ICPB 11122]
 gb|EFF46754.1| conserved hypothetical protein [Xanthomonas fuscans subsp. aurantifolii 
str. ICPB 10535]
Length=287

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 69/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L 
Sbjct  31   AAPLRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLP  90

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y  FG  R+G D  SD+H  +FYD   +E++E G FWLS++P   GS++WG+ +P +AT
Sbjct  91   DYRWFGQGRRGDD--SDEHMGVFYDARVLEVVESGNFWLSDTPERAGSITWGNVLPRMAT  148

Query  563  WA  568
            WA
Sbjct  149  WA  150



>ref|WP_022558232.1| MULTISPECIES: hypothetical protein [Xanthomonas]
 ref|YP_008637522.1| hypothetical protein XFF4834R_chr06810 [Xanthomonas fuscans subsp. 
fuscans]
 emb|CDF60317.1| hypothetical protein XFF4834R_chr06810 [Xanthomonas fuscans subsp. 
fuscans]
 gb|KGK66153.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP26931.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP27393.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP28194.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP35784.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KGT56223.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU41343.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU44711.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU45750.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU53310.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHF73991.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KIF10993.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KII99647.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
Length=287

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 69/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L 
Sbjct  31   AAPLRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLP  90

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y  FG  R+G D  SD+H  +FYD   +E++E G FWLS++P   GS++WG+ +P +AT
Sbjct  91   DYRWFGQGRRGDD--SDEHMGVFYDARVLEVVESGNFWLSDTPERAGSITWGNVLPRMAT  148

Query  563  WA  568
            WA
Sbjct  149  WA  150



>ref|WP_036688201.1| endonuclease [Paenibacillus sp. MSt1]
 gb|KEQ23589.1| endonuclease [Paenibacillus sp. MSt1]
Length=261

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + L LMTFNL  + P D  N+W  R     + I   +P+++ TQ+G  + L  L + L  
Sbjct  1    MELNLMTFNLRVNTPVDGGNAWPYRIRHAAAAIKKTAPLVVGTQEGTNAMLLDLDRELPA  60

Query  386  YDQFGISRKGA----DDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPC  553
            Y + G  R G+    D   D+ C I+Y  + +  +  G FWLSE+P VPGS SW S++P 
Sbjct  61   YSRLGEGRSGSTNEEDRLHDECCAIYYRHDALAPVASGQFWLSETPYVPGSKSWDSSLPR  120

Query  554  IATWA  568
            I TWA
Sbjct  121  ICTWA  125



>gb|AFZ55928.1| Endonuclease/exonuclease/phosphatase [Anabaena cylindrica PCC 
7122]
Length=253

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 2/116 (2%)
 Frame = +2

Query  221  MTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQFG  400
            M+FNL  D+P+     W KR     S+I  Y P +L TQ+G   QL  LQ  L  Y   G
Sbjct  1    MSFNLRYDKPDPGVRQWKKRVGAIASLIQHYQPDLLGTQEGKSHQLLDLQALLPEYKFIG  60

Query  401  ISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              R G      +HC +FY+ ++++L +   F+LS++P +PGS++WG+ +P +ATWA
Sbjct  61   SDRTGTG--QGEHCAVFYNPQRLKLQQTQDFYLSDTPEIPGSITWGTRLPRMATWA  114



>ref|WP_009343891.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA72350.1| hypothetical protein CRD_01893 [Raphidiopsis brookii D9]
Length=257

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 70/121 (58%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + +T+MTFNL  D+P+     W KR      +I +Y P +  TQ+G   QL  LQ  L  
Sbjct  1    MQITVMTFNLRCDKPDPGERCWQKRVGAIACMIQNYQPELWGTQEGQPHQLRDLQVLLPD  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y+  G  R G      +HC IFY + K++L E   F+LS++P +PGS++WG+ +P + TW
Sbjct  61   YEFVGGDRTGTG--KGEHCAIFYKRGKLQLRETQDFYLSDTPEIPGSITWGTRLPRMVTW  118

Query  566  A  568
            A
Sbjct  119  A  119



>ref|WP_023905149.1| hypothetical protein [Xanthomonas hortorum]
 gb|ETC86598.1| hypothetical protein XHC_3652 [Xanthomonas hortorum pv. carotae 
str. M081]
Length=292

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W+ R+   V++I    P +  TQ+ VK Q  YL   L  Y 
Sbjct  39   LRVMSFNVRVPVDTDCDKRWEVRRTAMVALIEQAHPDVFGTQELVKEQAQYLAAQLPDYR  98

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D SD+H  +FYD   + ++E G FWLSE+P +PGS SW + +P +ATWA
Sbjct  99   WFGKGRRA--DGSDEHMGVFYDSSVLTVVESGDFWLSETPEIPGSSSWNTDLPRMATWA  155



>ref|WP_027485814.1| endonuclease [Rhodanobacter sp. OR87]
Length=283

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+    P+D  N W+ R+DL V  I    P ++ TQ+  K Q DYL   LT Y
Sbjct  24   TLRVMSFNVRLPSPDDGANRWELRRDLMVRTIREQQPDLIGTQELYKLQGDYLVGKLTHY  83

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG  R+G D   D+H  +FY  ++++L+E G +WLS++P VPGS+SWG   P + TWA
Sbjct  84   TWFGRGRRGDD--GDEHMGVFYRTDRLKLVESGDYWLSDTPDVPGSISWGHPFPRMVTWA  141



>ref|XP_008603913.1| hypothetical protein SDRG_00223 [Saprolegnia diclina VS20]
 gb|EQC42490.1| hypothetical protein SDRG_00223 [Saprolegnia diclina VS20]
Length=348

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 69/119 (58%), Gaps = 5/119 (4%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG-Y  388
            L +MTFNL      D  NSWD RK     ++  Y P+I+ TQ+G+K QL  L   L G Y
Sbjct  69   LAIMTFNLRFAGANDGYNSWDYRKQHVYDLVDRYHPVIMGTQEGLKDQLAELHANLAGNY  128

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            ++FG+ R    +P+ +   IFYD + +E ++G  +WLS++P VP   +WG+    + TW
Sbjct  129  ERFGVER----EPNGEFEQIFYDADVLERVDGDNYWLSDTPEVPHETAWGAPCVRMVTW  183



>ref|WP_040940640.1| endonuclease [Xanthomonas campestris]
Length=288

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   VSVI    P +  TQ+ V  Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDTDGDKRWQARRGAMVSVIKQTHPDVFGTQELVSEQAGYLTAQLPSYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  + YD   + ++E G FWLS++P V GS++WG+ +P + TWA
Sbjct  95   WFGQGRRGDD--SDEHMGVLYDTRALNVVESGNFWLSDTPEVAGSITWGNVLPRMVTWA  151



>ref|WP_015446695.1| MULTISPECIES: endonuclease [Rhodanobacter]
 gb|AGG87627.1| metal-dependent hydrolase [Rhodanobacter denitrificans]
Length=283

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+    P+D  N W+ R+DL V  I    P ++ TQ+  K Q DYL   LT Y
Sbjct  24   TLRVMSFNVRLPSPDDGANRWELRRDLMVRTIREQQPDLIGTQELYKLQGDYLVGKLTHY  83

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG  R+G D   D+H  +FY  ++++L+E G +WLS++P VPGS+SWG   P + TWA
Sbjct  84   TWFGRGRRGDD--GDEHMGVFYRTDRLKLVESGDYWLSDTPDVPGSISWGHPFPRMVTWA  141



>ref|WP_026634180.1| endonuclease [Dyella japonica]
Length=276

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +MTFN+     +D PN+WDKR++L    I    P ++ TQ+  K Q D   + L  Y 
Sbjct  25   LKVMTFNVRTLAAQDGPNAWDKRRELFADTIRQVHPDVIGTQELFKQQGDDTVERLPEYT  84

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R G    +++H  IFY K++++L++ G FWLS+SP    S++WG+  P +  WA
Sbjct  85   WFGRDRFGKH--AEEHMGIFYRKDRLKLVKSGDFWLSDSPDKVASITWGNVFPRMVNWA  141



>ref|WP_006276313.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA70693.1| hypothetical protein CRC_00757 [Cylindrospermopsis raciborskii 
CS-505]
Length=256

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 69/121 (57%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + +T+MTFNL  D+P+     W KR      +I  Y P +  TQ+G   QL  LQ  L  
Sbjct  1    MQITVMTFNLRCDKPDPGERCWQKRVGAIACMIQHYQPELWGTQEGQPHQLRDLQVLLPD  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y+  G  R G      +HC IFY + K++L E   F+LS++P +PGS++WG+ +P + TW
Sbjct  61   YEFVGGDRTGTG--KGEHCAIFYKRGKLQLRETQDFYLSDTPEIPGSITWGTRLPRMVTW  118

Query  566  A  568
            A
Sbjct  119  A  119



>ref|WP_016900841.1| endonuclease [Xanthomonas arboricola]
Length=288

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y  F
Sbjct  37   VMSFNVRVPVDTDGDKRWSVRRTAMVALIEQAHPDVFGTQELVQEQAQYLAAQLPDYRWF  96

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G D  SD+H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  97   GKGRRGDD--SDEHMGVFYDSRALSVVESGDFWLSETPQVPGSSSWNTDLPRMVTWA  151



>ref|WP_043910723.1| endonuclease [Xanthomonas gardneri]
Length=292

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 66/117 (56%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      D    W+ R+   V++I    P +  TQ+ V+ Q  YL   L  Y  F
Sbjct  41   VMSFNVRVPVDTDGDKRWEVRRTAMVALIEQAHPDVFGTQELVEEQAQYLAAHLPAYRWF  100

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+   D SD+H  +FYD   + ++E G FWLSE+P +PGS SW + +P +ATWA
Sbjct  101  GKGRRA--DGSDEHMGVFYDSRVLTVVESGDFWLSETPEIPGSSSWNTDLPRMATWA  155



>ref|WP_041781060.1| endonuclease/exonuclease/phosphatase family protein, partial 
[Microcoleus sp. PCC 7113]
Length=258

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 73/123 (59%), Gaps = 4/123 (3%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + + +M+FNL  D+P+   ++W  RK    ++IT YSP ++ TQ+G   QL  L + L  
Sbjct  1    MEIRVMSFNLRYDKPDPGNHAWKVRKQAVAALITHYSPDLIGTQEGQSHQLLDLHRLLPN  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMS--WGSTVPCIA  559
            Y   G  R G D  + ++C IFY  E++  L    F LS++P +PGS+S  WG+ +P +A
Sbjct  61   YQSVGSDRTGTD--TGEYCAIFYRTERLRCLRTQDFVLSDTPEIPGSISPAWGNPIPRMA  118

Query  560  TWA  568
            +WA
Sbjct  119  SWA  121



>gb|EGD17029.1| metal-dependent hydrolase [Xanthomonas gardneri ATCC 19865]
Length=251

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = +2

Query  221  MTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQFG  400
            M+FN+      D    W+ R+   V++I    P +  TQ+ V+ Q  YL   L  Y  FG
Sbjct  1    MSFNVRVPVDTDGDKRWEVRRTAMVALIEQAHPDVFGTQELVEEQAQYLAAHLPAYRWFG  60

Query  401  ISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              R+   D SD+H  +FYD   + ++E G FWLSE+P +PGS SW + +P +ATWA
Sbjct  61   KGRRA--DGSDEHMGVFYDSRVLTVVESGDFWLSETPEIPGSSSWNTDLPRMATWA  114



>ref|WP_022103807.1| endonuclease/Exonuclease/phosphatase [Bacteroides stercoris CAG:120]
 emb|CDA49882.1| endonuclease/Exonuclease/phosphatase [Bacteroides stercoris CAG:120]
Length=287

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 1/121 (1%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            S+ + +M+FN+  D P DS N W  R+D   + I  Y   IL TQ+ + +QL+ L+Q L 
Sbjct  26   SLPVNVMSFNIRYDNPGDSLNGWQYRRDRAATAIHFYDADILGTQEVLHNQLEDLKQRLP  85

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             YD  G+ R+   +   ++  ++Y KE+  LL+ G FWLSE+P V GS  W      IA+
Sbjct  86   EYDVVGVGREDGKEKG-EYSALWYKKERFALLDSGNFWLSETPEVAGSKGWDGACERIAS  144

Query  563  W  565
            W
Sbjct  145  W  145



>gb|AFZ19845.1| metal-dependent hydrolase [Microcoleus sp. PCC 7113]
Length=273

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 73/123 (59%), Gaps = 4/123 (3%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + + +M+FNL  D+P+   ++W  RK    ++IT YSP ++ TQ+G   QL  L + L  
Sbjct  1    MEIRVMSFNLRYDKPDPGNHAWKVRKQAVAALITHYSPDLIGTQEGQSHQLLDLHRLLPN  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMS--WGSTVPCIA  559
            Y   G  R G D  + ++C IFY  E++  L    F LS++P +PGS+S  WG+ +P +A
Sbjct  61   YQSVGSDRTGTD--TGEYCAIFYRTERLRCLRTQDFVLSDTPEIPGSISPAWGNPIPRMA  118

Query  560  TWA  568
            +WA
Sbjct  119  SWA  121



>gb|ABL97825.1| hypothetical protein ALOHA_HF1049E08.0013 [uncultured marine 
bacterium HF10_49E08]
Length=255

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 69/115 (60%), Gaps = 1/115 (1%)
 Frame = +2

Query  221  MTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQFG  400
            M+FN+      D  N WDKRK+L +  I ++ P +L  Q+    Q +YL++ L+ Y  +G
Sbjct  1    MSFNIRLGVANDGENHWDKRKELVLKTIQNFGPDLLGLQEVWHMQEEYLKEQLSNYAYYG  60

Query  401  ISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
             SR+      +Q C + Y K++ E+++G TFWLSE+P V  S SW S++P IA W
Sbjct  61   RSRRMEPVEGEQ-CAVMYRKDRFEIVKGETFWLSETPEVIESKSWDSSLPRIANW  114



>ref|WP_028551272.1| hypothetical protein [Paenibacillus sp. UNC451MF]
Length=263

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            ++ T+MTFNL  + P D  N+W  R +    +I  + P+++ TQ+G  S L  LQ+ L  
Sbjct  1    MNYTMMTFNLRCNTPSDGDNAWPNRIERAADMIKEHDPILVGTQEGYFSMLTELQEHLEE  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y   G+ R G  +  D+H  IFY K+ +++++ G FWLSE+P    + SWGS  P + TW
Sbjct  61   YTWIGVGRFGGFE--DEHNAIFYKKDCLDVVDQGHFWLSETPDEAATKSWGSYFPRMCTW  118

Query  566  A  568
            A
Sbjct  119  A  119



>ref|WP_003482709.1| endonuclease [Xanthomonas citri]
 emb|CCG35546.1| endonuclease/Exonuclease/phosphatase family protein [Xanthomonas 
citri pv. mangiferaeindicae LMG 941]
Length=287

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L  Y 
Sbjct  34   LRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQAHPDVFGTQELVSEQAAFLAEQLPDYR  93

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   +E++E G FWLS++P   GS++WG+ +P +ATWA
Sbjct  94   WFGQGRRGDD--SDEHMGVFYDARVLEVVESGDFWLSDTPERAGSITWGNVLPRMATWA  150



>ref|WP_011409451.1| endonuclease [Xanthomonas oryzae]
 dbj|BAE70481.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae 
MAFF 311018]
Length=319

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  66   LRVMSFNVRVPMDSDGDKRWTVRRTSMVALIKQAHPDVFGTQELVQEQAQYLASHLPAYR  125

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D SD+H  +FYD   + ++E G FWLSE+P +PGS SW + +P + TWA
Sbjct  126  WFGKGRRA--DGSDEHMGVFYDSNALSVIESGDFWLSETPEIPGSSSWNTDLPRMVTWA  182



>ref|XP_008870790.1| hypothetical protein H310_07222 [Aphanomyces invadans]
 gb|ETW00655.1| hypothetical protein H310_07222 [Aphanomyces invadans]
Length=356

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 70/119 (59%), Gaps = 5/119 (4%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG-Y  388
            +++MTFN+      D  NSWD RK+  + +I  Y P ++ TQ+G+K QL  +   L G Y
Sbjct  77   MSVMTFNIRFASANDGWNSWDHRKEHLIDLINRYKPTVMGTQEGLKDQLAEIHSKLHGNY  136

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            D+FG+ R+     + +   IFYD + V  L+GG +WLS++P VPG  +W +    + TW
Sbjct  137  DRFGVEREA----NGEFEQIFYDTDVVTKLDGGNYWLSDNPEVPGVTAWDAPCVRMVTW  191



>ref|WP_011050469.1| MULTISPECIES: endonuclease [Xanthomonas]
 gb|AAM35561.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri 
str. 306]
 gb|AGH76213.1| hypothetical protein XAC29_03415 [Xanthomonas axonopodis Xac29-1]
 gb|AGI09674.1| Metal-dependent hydrolase [Xanthomonas citri subsp. citri Aw12879]
 emb|CDN18240.1| endonuclease/Exonuclease/phosphatase family protein [Xanthomonas 
campestris pv. viticola]
 emb|CEH51637.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH63242.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH40078.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH87406.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI36927.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH54841.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH36786.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH52748.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH41828.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH36485.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI13661.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI19401.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI04078.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI04281.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI01310.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH85038.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH96980.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEJ26604.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEJ22014.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 gb|AJD67262.1| metal-dependent hydrolase [Xanthomonas citri subsp. citri A306]
 emb|CEL43178.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEL40988.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEL50159.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEL36051.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
Length=287

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L  Y 
Sbjct  34   LRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLPDYR  93

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   +E++E G FWLS++P   GS++WG+ +P +ATWA
Sbjct  94   WFGQGRRGDD--SDEHMGVFYDARVLEVVESGDFWLSDTPERAGSITWGNVLPRMATWA  150



>ref|WP_039579858.1| endonuclease [Xanthomonas axonopodis]
 gb|KGU58082.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHF49430.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS06219.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS29978.1| endonuclease [Xanthomonas axonopodis pv. phaseoli]
Length=287

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L  Y 
Sbjct  34   LRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLPDYR  93

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   +E++E G FWLS++P   GS++WG+ +P +ATWA
Sbjct  94   WFGQGRRGDD--SDEHMGVFYDARVLEVVESGDFWLSDTPERAGSITWGNVLPRMATWA  150



>ref|WP_008436752.1| endonuclease [Rhodanobacter thiooxydans]
 gb|EIL98774.1| hypothetical protein UUA_10846 [Rhodanobacter thiooxydans LCS2]
Length=283

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+    P+D  N W+ R+DL V  I   +P ++ TQ+  K Q DYL   LT Y
Sbjct  24   TLRVMSFNVRLPSPDDGANRWELRRDLMVRTIREQAPDLIGTQELYKLQGDYLVGQLTHY  83

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG  R+G D   D+H  +FY  ++++++E G +WLS++P VPGS+SWG   P + TWA
Sbjct  84   AWFGRGRRGGD--GDEHMGVFYRTDRLKVVESGDYWLSDTPDVPGSISWGHPFPRMVTWA  141



>ref|WP_005911153.1| MULTISPECIES: hypothetical protein [Xanthomonas]
 gb|EKQ58591.1| hypothetical protein WS7_20488 [Xanthomonas axonopodis pv. malvacearum 
str. GSPB2388]
 gb|EKQ66542.1| hypothetical protein MOU_00985 [Xanthomonas axonopodis pv. malvacearum 
str. GSPB1386]
Length=287

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L  Y 
Sbjct  34   LRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLPDYR  93

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   +E++E G FWLS++P   GS++WG+ +P +ATWA
Sbjct  94   WFGQGRRGDD--SDEHMGVFYDARVLEVVESGDFWLSDTPERAGSITWGNVLPRMATWA  150



>ref|WP_005925093.1| endonuclease [Xanthomonas axonopodis]
 emb|CCF66725.1| endonuclease/Exonuclease/phosphatase family protein [Xanthomonas 
axonopodis pv. punicae str. LMG 859]
Length=287

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L  Y 
Sbjct  34   LRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLPDYR  93

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   +E++E G FWLS++P   GS++WG+ +P +ATWA
Sbjct  94   WFGQGRRGDD--SDEHMGVFYDARVLEVVESGDFWLSDTPERAGSITWGNVLPRMATWA  150



>ref|WP_019303951.1| endonuclease [Xanthomonas oryzae]
Length=311

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDSDGDKRWTVRRTSMVALIKQTHPDVFGTQELVQEQAQYLASHLPAYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D SD+H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  95   WFGKGRRA--DGSDEHMGVFYDSNALSVIESGDFWLSETPEVPGSRSWNTDLPRMVTWA  151



>ref|WP_031420993.1| endonuclease [Xanthomonas axonopodis]
Length=287

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 69/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L 
Sbjct  31   AAPLRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLP  90

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y  FG  R+G D  SD+H  +FYD   ++++E G FWLS++P   GS++WG+ +P +AT
Sbjct  91   DYRWFGRGRRGDD--SDEHMGVFYDARVLKVVESGNFWLSDTPERAGSITWGNVLPRMAT  148

Query  563  WA  568
            WA
Sbjct  149  WA  150



>ref|WP_022333457.1| MULTISPECIES: metal-dependent hydrolase [Alistipes]
 emb|CDD25050.1| metal-dependent hydrolase [Alistipes sp. CAG:29]
Length=280

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            + +L++MTFN+  D PED  ++W  R+     VI S+   +  TQ+ + +QL  L++ L 
Sbjct  19   ATTLSVMTFNMRYDNPEDGADNWRFRRGRVAEVIASHGVDVFGTQELLANQLGDLKRLLP  78

Query  383  GYDQFGISRK-GADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
            GY   G+ R+ GA+  + +   +FY +++   LE GTFWLSE+P V GS  W      +A
Sbjct  79   GYAAVGVGREDGAE--AGEFSAVFYRRDRFTPLESGTFWLSETPDVAGSKGWDGACERVA  136

Query  560  TW  565
            TW
Sbjct  137  TW  138



>ref|WP_039811162.1| endonuclease [Xanthomonas arboricola]
Length=288

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 64/117 (55%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      D    W  R+   V+++    P +  TQ+ V+ Q  YL   L  Y  F
Sbjct  37   VMSFNVRVPVDTDGDKRWSVRRTAMVALVEQAHPDVFGTQELVQEQAQYLAAQLPDYRWF  96

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G D  SD+H  +FYD   V ++E G FWLSE+P  PGS SW + +P + TWA
Sbjct  97   GKGRRGDD--SDEHMGVFYDSRAVSVVESGDFWLSETPQAPGSSSWNTDLPRMVTWA  151



>ref|WP_014501890.1| endonuclease [Xanthomonas oryzae]
 gb|AEQ94937.1| endonuclease-exonuclease-phosphatase family [Xanthomonas oryzae 
pv. oryzicola BLS256]
 gb|AJQ89192.1| endonuclease [Xanthomonas oryzae pv. oryzicola]
Length=288

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDSDGDKRWTVRRTSMVALIKQTHPDVFGTQELVQEQAQYLASHLPAYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D SD+H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  95   WFGKGRRA--DGSDEHMGVFYDSNALSVIESGDFWLSETPEVPGSSSWNTDLPRMVTWA  151



>ref|WP_011346346.1| MULTISPECIES: endonuclease [Xanthomonas]
 emb|CAJ22364.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria 
str. 85-10]
 gb|AEO40982.1| Metal-dependent hydrolase [Xanthomonas axonopodis pv. citrumelo 
F1]
 gb|KHL61931.1| endonuclease [Xanthomonas euvesicatoria]
 gb|KHL62048.1| endonuclease [Xanthomonas euvesicatoria]
Length=287

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 69/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            +  L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  +L + L 
Sbjct  31   AAPLRVMSFNVRVPADTDGDKRWQVRRAAMVALIKQTHPDVFGTQELVSEQAAFLAEQLP  90

Query  383  GYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y  FG  R+G D  SD+H  +FYD   ++++E G FWLS++P   GS++WG+ +P +AT
Sbjct  91   DYRWFGQGRRGDD--SDEHMGVFYDARVLQVVESGNFWLSDTPERAGSITWGNVLPRMAT  148

Query  563  WA  568
            WA
Sbjct  149  WA  150



>ref|WP_039523427.1| endonuclease [Xanthomonas arboricola]
 gb|KER80991.1| endonuclease [Xanthomonas arboricola pv. celebensis]
Length=288

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 64/117 (55%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      D    W  R+    +++    P +  TQ+ V+ Q  YL   L  Y  F
Sbjct  37   VMSFNVRVPVDTDGDKRWSVRRTAMAALVEQAHPDVFGTQELVQEQAQYLAAQLPDYRWF  96

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G D  SD+H  +FYD   V ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  97   GKGRRGDD--SDEHMGVFYDSRAVSVVESGDFWLSETPQVPGSSSWNTDLPRMVTWA  151



>ref|WP_019301163.1| endonuclease [Xanthomonas oryzae]
Length=311

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDSDGDKRWTVRRTSMVALIKQTHPDVFGTQELVQEQAQYLASHLPAYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D SD+H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  95   WFGKGRRA--DGSDEHMGVFYDSNALSVIESGDFWLSETPEVPGSRSWNTDLPRMVTWA  151



>emb|CBX31373.1| hypothetical protein N47_E48850 [uncultured Desulfobacterium 
sp.]
Length=335

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 2/123 (2%)
 Frame = +2

Query  200  MSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCL  379
            +S++L +M+FN+      D  N W  R+ L   ++  Y P +L  Q+ +  Q+  +   L
Sbjct  45   ISLNLKIMSFNIRRGTARDGKNHWKYRRSLVHEILDLYCPDVLGLQEALDFQIPEISAML  104

Query  380  TGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
             GY   GI   G       H TIFYD  + EL E GTFWLS++P +P S  WG+ +P I 
Sbjct  105  PGYKNVGIGDLGGS--KRLHNTIFYDANRFELSEEGTFWLSDTPDIPRSKGWGNIMPRIC  162

Query  560  TWA  568
            TW 
Sbjct  163  TWV  165



>ref|WP_044756430.1| endonuclease [Xanthomonas oryzae]
Length=319

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  YL   L  Y 
Sbjct  66   LRVMSFNVRVPMDSDGDKRWTVRRTSMVALIKQAHPDVFGTQELVPEQAQYLASHLPAYR  125

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D SD+H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  126  WFGKGRRA--DGSDEHMGVFYDSNALSVIESGDFWLSETPEVPGSSSWNTDLPRMVTWA  182



>ref|WP_012444111.1| endonuclease [Xanthomonas oryzae]
 gb|ACD57568.1| endonuclease/exonuclease/phosphatase family [Xanthomonas oryzae 
pv. oryzae PXO99A]
Length=319

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V  Q  YL   L  Y 
Sbjct  66   LRVMSFNVRVPMDSDGDKRWTVRRTSMVALIKQAHPDVFGTQELVPEQAQYLASHLPAYR  125

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D SD+H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  126  WFGKGRRA--DGSDEHMGVFYDSNALSVIESGDFWLSETPEVPGSSSWNTDLPRMVTWA  182



>ref|WP_026318556.1| endonuclease [Alistipes onderdonkii]
Length=280

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = +2

Query  203  SVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLT  382
            + +L++MTFN+  D PED  ++W  R+     VI S+   +  TQ+ + +QL  L++ L 
Sbjct  19   ATTLSVMTFNMRYDNPEDGADNWRFRRGRVAEVIASHGVDVFGTQELLANQLGDLKRLLP  78

Query  383  GYDQFGISRK-GADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIA  559
            GY   G+ R+ GA+  + +   +FY +++   LE GTFWLSE+P V GS  W      +A
Sbjct  79   GYAAVGVGREDGAE--AGEFSAVFYRRDRFTPLESGTFWLSETPDVAGSKGWDGACERVA  136

Query  560  TW  565
            TW
Sbjct  137  TW  138



>ref|WP_040269324.1| endonuclease [Xanthomonas citri]
 emb|CEH86332.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
Length=287

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   +++I    P +  TQ+ V  Q  +L + L  Y 
Sbjct  34   LRVMSFNVRVPADTDGDKRWQVRRAAMIALIKQTHPDVFGTQELVSEQAAFLAEQLPDYR  93

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+G D  SD+H  +FYD   +E++E G FWLS++P   GS++WG+ +P +ATWA
Sbjct  94   WFGQGRRGDD--SDEHMGVFYDARVLEVVESGDFWLSDTPERAGSITWGNVLPRMATWA  150



>ref|WP_024939679.1| endonuclease [Xanthomonas arboricola]
Length=288

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      D    W  R+   V+++    P +  TQ+ V+ Q  YL   L  Y  F
Sbjct  37   VMSFNVRVPVDTDGDKRWSVRRTAMVALVEQVHPDVFGTQELVQEQAQYLAAQLPDYRWF  96

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G D  SD+H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  97   GKGRRGDD--SDEHMGVFYDSRALSVVESGDFWLSETPQVPGSSSWDTDLPRMVTWA  151



>ref|WP_009125678.1| endonuclease [Bacteroides fluxus]
 gb|EGF56021.1| endonuclease/exonuclease/phosphatase family protein [Bacteroides 
fluxus YIT 12057]
Length=287

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 69/119 (58%), Gaps = 1/119 (1%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            + +M+FN+  D PEDS ++W  RKD   + I  Y   IL TQ+ + +QL+ L+Q L  Y 
Sbjct  29   VNVMSFNIRYDNPEDSLDNWKYRKDRAANAIRFYDVDILGTQEVLHNQLEDLKQRLPEYG  88

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              G+ R+   +   ++  ++Y KE+  LL+ G FWLSE+P V GS  W      IA+WA
Sbjct  89   VIGVGREDGKEKG-EYSALWYKKERFNLLDSGYFWLSETPEVAGSKGWDGACERIASWA  146



>ref|WP_010263318.1| endonuclease [Alistipes timonensis]
Length=279

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 3/119 (3%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            LT+MT N+  D PED  N+W  R++    +I S +  +L TQ+ + +Q D LQ  L GY 
Sbjct  22   LTVMTLNMRYDNPEDGANNWRFRRERIAELIRSEAVDLLGTQEVLANQFDDLQALLPGYR  81

Query  392  QFGISRK-GADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
              G+ R+ GA   + +   +F+  ++ ELL+ G FWLSE+P  PGS  W      +ATW
Sbjct  82   AVGVGREDGAR--AGEFNAVFFRSDRFELLDSGVFWLSENPETPGSKGWDGACERLATW  138



>ref|WP_007080670.1| endonuclease [Rhodanobacter fulvus]
 gb|EIL90638.1| Metal-dependent hydrolase [Rhodanobacter fulvus Jip2]
Length=279

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  173  LGCQEIC*KMSVSLTLMTFNLLEDQPEDSP-NSWDKRKDLCVSVITSYSPMILCTQQGVK  349
            LG  +        L +MTFN+    P D+  N+W  R++L V VI +  P +L TQ+  +
Sbjct  16   LGMADTSAAAEAPLKVMTFNV--RVPVDTGMNAWANRRELMVKVILAEHPDVLGTQELTE  73

Query  350  SQLDYLQQCLTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSM  529
             Q +YL   L GY  FG  R G      +H  +FY  +++++   G FWLS++P VPGS 
Sbjct  74   EQGEYLAAHLPGYAWFGQGRDGGS--KGEHMGVFYRTDRLQVERSGDFWLSDTPGVPGSK  131

Query  530  SWGSTVPCIATWA  568
            +WG   P + TWA
Sbjct  132  TWGQPYPRMVTWA  144



>ref|WP_007511681.1| endonuclease [Rhodanobacter denitrificans]
 gb|EIM01697.1| hypothetical protein UUC_10889 [Rhodanobacter denitrificans]
Length=283

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+    P+D  N W++R+DL V  I    P ++ TQ+  K Q DYL   LT Y
Sbjct  24   TLRVMSFNVRLPSPDDGANRWEQRRDLMVRTIREQQPDLIGTQELYKLQGDYLVGKLTHY  83

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG  R+G D   D+H  +FY  ++++L+E G +WLS++P  PGS+SWG   P + TWA
Sbjct  84   AWFGRGRRGDD--GDEHMGVFYRTDRLKLVESGDYWLSDTPDQPGSISWGHPFPRMVTWA  141



>gb|AGU11283.1| Endonuclease/Exonuclease/phosphatase family [uncultured organism]
Length=283

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            S+ +MTFN+     ++ P  W  R+ + ++++    P ++ TQ+ ++ Q D + + L GY
Sbjct  23   SVKVMTFNV-RYASDEGPQRWPVRRPVLLALLERSRPDVIGTQELLQRQGDDIVRALPGY  81

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG  R G    +D+H  +FY  +++ LL  G FWLS++P  P SMSWG+ +P +ATWA
Sbjct  82   RWFGRDRAGGH--ADEHMGVFYRPDRLRLLRSGDFWLSDTPDQPNSMSWGADLPRMATWA  139



>ref|WP_027493355.1| endonuclease [Rhodanobacter sp. OR444]
Length=283

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+    P+D  N W+ R+DL V  I   +P ++ TQ+  K Q DYL   LT Y
Sbjct  24   TLRVMSFNVRLPSPDDGANRWELRRDLMVRTIREQAPDLIGTQELYKLQGDYLVSKLTHY  83

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG  R+G D   D+H  + Y  ++++L+E G +WLS++P VPGS+SWG   P + TWA
Sbjct  84   AWFGRGRRGDD--GDEHMGVLYRTDRLKLVESGDYWLSDTPDVPGSISWGHPFPRMVTWA  141



>gb|AFN73654.1| endonuclease/exonuclease/phosphatase family protein [Melioribacter 
roseus P3M-2]
Length=297

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 69/124 (56%), Gaps = 1/124 (1%)
 Frame = +2

Query  197  KMSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQC  376
            K +V + +MTFN+     +D  NSWD RKD+   VI +Y P +L  Q+ +K QLD     
Sbjct  33   KDAVPIKVMTFNIRYGGADDGINSWDNRKDITFEVIRNYYPDLLGMQEALKFQLDETLNQ  92

Query  377  LTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCI  556
               Y+  G+ R        ++  + Y +++  +   GTFW SE+P +PGS SWG+ +  I
Sbjct  93   FPYYNYVGVGRDNGKTEG-EYAPVLYLRDRFIVDTSGTFWFSETPDIPGSKSWGNEITRI  151

Query  557  ATWA  568
            ++WA
Sbjct  152  SSWA  155



>ref|WP_015847775.1| endonuclease/exonuclease/phosphatase [Paenibacillus sp. JDR-2]
 gb|ACT04839.1| Endonuclease/exonuclease/phosphatase [Paenibacillus sp. JDR-2]
Length=264

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + +++MTFNL   + +D  + W +R D   +VI  + P+++ TQ+G  S L  L+  L  
Sbjct  2    LEISVMTFNLRYPEIQDGSDYWPERVDRATNVIRKHHPLLIGTQEGYHSMLKDLEIELYE  61

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            YD  G  R G  +  ++H  IFY+++++ + E G FWLSE+P    S+SW S+ P I TW
Sbjct  62   YDWVGRGRFGEHE--NEHNAIFYNRDELTVEENGQFWLSETPESEASVSWDSSFPRICTW  119

Query  566  A  568
            A
Sbjct  120  A  120



>ref|WP_039128836.1| hypothetical protein [Flavihumibacter sp. ZG627]
 gb|KIC91628.1| hypothetical protein HY58_05165 [Flavihumibacter sp. ZG627]
Length=281

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 5/121 (4%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+  + P DS N+W  RK      +      +L  Q+ +  Q+  L   L GY 
Sbjct  21   LHVMSFNIRLNTPADSANAWPYRKAFVAEQVLKNKVHLLGVQEALHEQMTDLASLLPGYK  80

Query  392  QFGISRKGADDPSD--QHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
              G   KG DD  +  ++  IFYD  ++E++   TFWLSE+P +PGS SW + +  +ATW
Sbjct  81   YVG---KGRDDGREKGEYSAIFYDTARIEVINSATFWLSETPEIPGSKSWDAAITRVATW  137

Query  566  A  568
            A
Sbjct  138  A  138



>ref|WP_041182274.1| endonuclease [Xanthomonas oryzae]
Length=319

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 64/119 (54%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  66   LRVMSFNVRVPMDSDGDKRWTVRRTSMVALIKQAHPDVFGTQELVQEQAQYLASHLPAYR  125

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D SD+H  +FYD   + ++E G FWLSE P +PGS SW + +P + TWA
Sbjct  126  WFGKGRRA--DGSDEHMGVFYDSNALSVIESGDFWLSEIPEIPGSSSWNTDLPRMVTWA  182



>ref|WP_041356193.1| hypothetical protein [Melioribacter roseus]
Length=290

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 69/124 (56%), Gaps = 1/124 (1%)
 Frame = +2

Query  197  KMSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQC  376
            K +V + +MTFN+     +D  NSWD RKD+   VI +Y P +L  Q+ +K QLD     
Sbjct  26   KDAVPIKVMTFNIRYGGADDGINSWDNRKDITFEVIRNYYPDLLGMQEALKFQLDETLNQ  85

Query  377  LTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCI  556
               Y+  G+ R        ++  + Y +++  +   GTFW SE+P +PGS SWG+ +  I
Sbjct  86   FPYYNYVGVGRDNGKTEG-EYAPVLYLRDRFIVDTSGTFWFSETPDIPGSKSWGNEITRI  144

Query  557  ATWA  568
            ++WA
Sbjct  145  SSWA  148



>ref|WP_029951286.1| hypothetical protein, partial [Hydrogenedentes bacterium JGI 
0000077-D07]
Length=213

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 82/155 (53%), Gaps = 12/155 (8%)
 Frame = +2

Query  110  QSFFLGNLTMF---PESNTM*LRDLGCQEIC*KMSVSLTLMTFNLLEDQPEDSPNSWDKR  280
            Q+ FL NLT+F     SN +   + G  E       ++ +MTFNL      D PN W+KR
Sbjct  3    QTVFL-NLTIFCFLMISNIVFFAEQGFAE------ETIKVMTFNLRYGTAMDGPNHWNKR  55

Query  281  KDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQFGISRKGADDPSDQHCTIFYDK  460
            KD+ V VI +Y P +L TQ+ +  Q  Y+ + +  Y   G  R+   D S +   +FY K
Sbjct  56   KDILVEVIKNYDPDLLGTQECLDFQAKYIAEQIPSYLYVGKGRE--KDGSSEQTAVFYKK  113

Query  461  EKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            +  E+L+   FW+SE+P  PGS SW +    I TW
Sbjct  114  DLWEVLDTKYFWISETPEEPGSKSWDTVCTRIVTW  148



>gb|AAW77203.1| Metal-dependent hydrolase [Xanthomonas oryzae pv. oryzae KACC 
10331]
Length=342

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 64/119 (54%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  89   LRVMSFNVRVPMDSDGDKRWTVRRTSMVALIKQAHPDVFGTQELVQEQAQYLASHLPAYR  148

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D SD+H  +FYD   + ++E G FWLSE P +PGS SW + +P + TWA
Sbjct  149  WFGKGRRA--DGSDEHMGVFYDSNALSVIESGDFWLSEIPEIPGSSSWNTDLPRMVTWA  205



>gb|EAR16692.1| hypothetical protein RB2501_07320 [Robiginitalea biformata HTCC2501]
Length=255

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 2/116 (2%)
 Frame = +2

Query  221  MTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQFG  400
            M++N+  D P D  +SWD+RK+  ++ I  ++P ++ TQ+G+  QL  ++  L GY  FG
Sbjct  1    MSYNIRYDNPGDGRDSWDQRKEFLIAQIAYHAPDVVGTQEGLLHQLRDMEVALEGYAFFG  60

Query  401  ISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              R   DD   +H  +FY+  ++ELLE  TFWLSE+P VP S  W + +  + T+ 
Sbjct  61   KGRDQGDD-QGEHTAVFYNTGQLELLEEETFWLSETPEVP-SKGWDAALNRVCTYG  114



>gb|KFA03412.1| endonuclease, partial [Xanthomonas vasicola pv. vasculorum NCPPB 
890]
Length=176

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +2

Query  221  MTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQFG  400
            M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y  FG
Sbjct  1    MSFNVRVPVDRDGDKRWAVRRTSMVALIKQTHPDVFGTQELVQEQAQYLASHLPAYRWFG  60

Query  401  ISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              R+   D S++H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  61   KGRRA--DGSEEHMGVFYDSNALSVIESGDFWLSETPEVPGSSSWNTDLPRMVTWA  114



>ref|WP_039444134.1| endonuclease [Xanthomonas vasicola]
 gb|KGR48275.1| endonuclease [Xanthomonas vasicola]
 gb|KGR56380.1| endonuclease [Xanthomonas vasicola]
 gb|KGR62290.1| endonuclease [Xanthomonas vasicola]
 gb|KGT82479.1| endonuclease [Xanthomonas vasicola]
Length=288

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDRDGDKRWAVRRTSMVALIKQTHPDVFGTQELVQEQAQYLASHLPAYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D S++H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  95   WFGKGRRA--DGSEEHMGVFYDSNALSVIESGDFWLSETPEVPGSSSWNTDLPRMVTWA  151



>gb|KGP56038.1| endonuclease [Xanthomonas campestris pv. arecae]
Length=288

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDRDGDKRWAVRRTSMVALIKQTHPDVFGTQELVQEQAQYLASHLPAYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D S++H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  95   WFGKGRRA--DGSEEHMGVFYDSNALSVIESGDFWLSETPEVPGSSSWNTDLPRMVTWA  151



>gb|EPR65521.1| endonuclease/exonuclease/phosphatase family protein [Cyclobacterium 
qasimii M12-11B]
Length=296

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 1/126 (1%)
 Frame = +2

Query  191  C*KMSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQ  370
            C    +S+ +++FN+  D PED  N W  R  +  S +TS  P I+  Q+ + SQ   LQ
Sbjct  20   CSSKELSMKIVSFNIRYDNPEDGINRWQARIPIVKSYLTSEKPDIIGMQEVLHSQTLDLQ  79

Query  371  QCLTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVP  550
            + L+ Y   G  R   +  + ++  IFY+K K +L++   FWLSE+P +PGS SW +++ 
Sbjct  80   EMLSDYAFVGTGRND-NKTAGEYAPIFYNKNKFKLIDHSQFWLSETPDIPGSKSWDASLT  138

Query  551  CIATWA  568
             I TWA
Sbjct  139  RIVTWA  144



>ref|WP_039431767.1| endonuclease [Xanthomonas vasicola]
 gb|KGR44069.1| endonuclease [Xanthomonas vasicola]
 gb|KGR45259.1| endonuclease [Xanthomonas vasicola]
 gb|KGR47479.1| endonuclease [Xanthomonas vasicola]
 gb|KGR60863.1| endonuclease [Xanthomonas vasicola]
Length=288

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDRDGDKRWAVRRTSMVALIKQTHPDVFGTQELVQEQAQYLASHLPAYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D S++H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  95   WFGKGRRA--DGSEEHMGVFYDSNALSVIESGDFWLSETPEVPGSSSWNTDLPRMVTWA  151



>emb|CCI44541.1| unnamed protein product [Albugo candida]
Length=266

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 63/116 (54%), Gaps = 5/116 (4%)
 Frame = +2

Query  221  MTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQL-DYLQQCLTGYDQF  397
            MTFNL     ED P +W  RK+  + +I  Y P I+ TQ+G+K QL D     +  Y +F
Sbjct  1    MTFNLRFASVEDGPRNWTYRKNHVIDIINRYHPTIMGTQEGLKDQLADIDSNLMHPYKRF  60

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            G+ R    + + +H  IFYD   VE L GG FWLSE+P   G+  W +    + TW
Sbjct  61   GVER----ELNGEHEEIFYDTNIVEFLNGGNFWLSETPDAFGTKGWDAACVRLVTW  112



>ref|WP_040417921.1| hypothetical protein [Cyclobacterium qasimii]
Length=292

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 1/126 (1%)
 Frame = +2

Query  191  C*KMSVSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQ  370
            C    +S+ +++FN+  D PED  N W  R  +  S +TS  P I+  Q+ + SQ   LQ
Sbjct  16   CSSKELSMKIVSFNIRYDNPEDGINRWQARIPIVKSYLTSEKPDIIGMQEVLHSQTLDLQ  75

Query  371  QCLTGYDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVP  550
            + L+ Y   G  R   +  + ++  IFY+K K +L++   FWLSE+P +PGS SW +++ 
Sbjct  76   EMLSDYAFVGTGRND-NKTAGEYAPIFYNKNKFKLIDHSQFWLSETPDIPGSKSWDASLT  134

Query  551  CIATWA  568
             I TWA
Sbjct  135  RIVTWA  140



>ref|WP_035082784.1| endonuclease/exonuclease/phosphatase family protein, partial 
[Aphanizomenon flos-aquae]
Length=264

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            + +T+MTFNL  D+P+     W KR     S+I  Y P +L TQ+G   QL  LQ  L  
Sbjct  1    MQITVMTFNLRYDKPDPGVRQWKKRVGAIASLIQHYKPDLLGTQEGKSHQLADLQALLPE  60

Query  386  YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATW  565
            Y+   I        + +HC +FY+ + ++L E   F+LS++P +PGS++WG+ +P +ATW
Sbjct  61   YN--IIGGDRTGTGTGEHCAVFYNPQCLKLQETQDFYLSDTPEIPGSITWGTRLPRMATW  118

Query  566  A  568
            A
Sbjct  119  A  119



>ref|WP_010368226.1| MULTISPECIES: endonuclease [Xanthomonas]
 gb|KEZ98364.1| endonuclease [Xanthomonas vasicola pv. vasculorum NCPPB 895]
 gb|KFA05425.1| endonuclease [Xanthomonas campestris pv. musacearum NCPPB 4379]
 gb|KFA08056.1| endonuclease [Xanthomonas campestris pv. musacearum NCPPB 2005]
 gb|KFA14406.1| endonuclease [Xanthomonas campestris pv. musacearum NCPPB 4380]
 gb|KFA21797.1| endonuclease [Xanthomonas campestris pv. musacearum NCPPB 4392]
 gb|KFA22062.1| endonuclease [Xanthomonas campestris pv. musacearum NCPPB 4394]
 gb|KFA27449.1| endonuclease [Xanthomonas vasicola pv. vasculorum NCPPB 1381]
 gb|KFA31642.1| endonuclease [Xanthomonas vasicola pv. vasculorum NCPPB 1326]
 gb|KFA33325.1| endonuclease [Xanthomonas vasicola pv. vasculorum NCPPB 206]
 gb|KFA39493.1| endonuclease [Xanthomonas campestris pv. musacearum NCPPB 4384]
Length=288

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  212  LTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYD  391
            L +M+FN+      D    W  R+   V++I    P +  TQ+ V+ Q  YL   L  Y 
Sbjct  35   LRVMSFNVRVPVDRDGDKRWAVRRTSMVALIKQTHPDVFGTQELVQEQAQYLASHLPAYR  94

Query  392  QFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
             FG  R+   D S++H  +FYD   + ++E G FWLSE+P VPGS SW + +P + TWA
Sbjct  95   WFGKGRRA--DGSEEHMGVFYDSNALSVIESGDFWLSETPEVPGSSSWNTDLPRMVTWA  151



>ref|WP_039514957.1| endonuclease [Xanthomonas arboricola]
 dbj|GAE57393.1| hypothetical protein XPR_4028 [Xanthomonas arboricola pv. pruni 
MAFF 301420]
 dbj|GAE52294.1| endonuclease/exonuclease/phosphatase family protein [Xanthomonas 
arboricola pv. pruni str. MAFF 311562]
 dbj|GAE58385.1| hypothetical protein XPN_0291 [Xanthomonas arboricola pv. pruni 
MAFF 301427]
 gb|KCX00451.1| endonuclease [Xanthomonas arboricola pv. pruni]
Length=288

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 64/117 (55%), Gaps = 2/117 (2%)
 Frame = +2

Query  218  LMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGYDQF  397
            +M+FN+      D    W  R+   V+++    P +  TQ+ V+ Q  YL   L  Y  F
Sbjct  37   VMSFNVRVPVDTDGDKRWSVRRTAMVALVEQAHPDVFGTQELVQEQAQYLAAQLPDYRWF  96

Query  398  GISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
            G  R+G D  SD+H  +FYD   + ++E G FWLSE+P  PGS SW + +P + TWA
Sbjct  97   GKGRRGDD--SDEHMGVFYDSRALSVVESGDFWLSETPQAPGSSSWNTDLPRMVTWA  151



>ref|XP_002908683.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY57497.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=388

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = +2

Query  206  VSLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTG  385
            +SL +MTFNL      D  NSW  RKD    +I  Y P I+ TQ+G+K+QL  L+  L  
Sbjct  109  LSLKIMTFNLRFAGTGDGLNSWRYRKDHVADIIDRYHPAIMGTQEGLKAQLAELESLLNH  168

Query  386  -YDQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIAT  562
             Y++FG+ R    + + +   IFYD   +E L+ G FWLSE P  PG+  W +    + T
Sbjct  169  PYERFGVER----EENGEFEQIFYDAAVLERLDDGNFWLSEEPDTPGTQGWDAACVRMVT  224

Query  563  WA  568
            W 
Sbjct  225  WG  226



>ref|WP_039006050.1| endonuclease [Xanthomonas translucens]
Length=292

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 68/120 (57%), Gaps = 2/120 (2%)
 Frame = +2

Query  209  SLTLMTFNLLEDQPEDSPNSWDKRKDLCVSVITSYSPMILCTQQGVKSQLDYLQQCLTGY  388
            +L +M+FN+      D    W+ R+    ++I +  P +  TQ+ VK Q DYL   L  Y
Sbjct  38   TLKVMSFNVRVPVDSDGDKRWEIRRSAMAALIRAQHPDVFGTQELVKRQADYLAAQLPDY  97

Query  389  DQFGISRKGADDPSDQHCTIFYDKEKVELLEGGTFWLSESPSVPGSMSWGSTVPCIATWA  568
              FG SR  ++D   +   +FYD  +++LLE G FWLS++P+V GS+SWG  +P +  W 
Sbjct  98   RWFGRSRDSSED--GERMGVFYDSRRLKLLESGDFWLSDTPAVVGSISWGHPLPRMVNWG  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960