BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I08

Length=485
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI32808.3|  unnamed protein product                                274   2e-89   Vitis vinifera
emb|CAL46265.1|  beta-tubulin 6                                         268   3e-89   Oryza sativa Indica Group [Indian rice]
ref|XP_010673063.1|  PREDICTED: tubulin beta-6 chain isoform X1         279   6e-89   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU18601.1|  hypothetical protein MIMGU_mgv1a005215mg                279   2e-88   Erythranthe guttata [common monkey flower]
gb|KHG13886.1|  Tubulin beta-3 chain                                    269   2e-88   Gossypium arboreum [tree cotton]
emb|CDP06213.1|  unnamed protein product                                278   7e-88   Coffea canephora [robusta coffee]
ref|XP_002283056.1|  PREDICTED: tubulin beta-5 chain                    275   8e-88   Vitis vinifera
ref|XP_011079080.1|  PREDICTED: tubulin beta-5 chain-like               275   9e-88   Sesamum indicum [beniseed]
ref|XP_003568202.1|  PREDICTED: tubulin beta-5 chain-like               275   9e-88   Brachypodium distachyon [annual false brome]
tpg|DAA54230.1|  TPA: hypothetical protein ZEAMMB73_283964              275   1e-87   
ref|XP_011075465.1|  PREDICTED: tubulin beta-5 chain isoform X2         275   1e-87   Sesamum indicum [beniseed]
sp|Q9ZRA8.1|TBB5_WHEAT  RecName: Full=Tubulin beta-5 chain; AltNa...    275   1e-87   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003567397.1|  PREDICTED: tubulin beta-4 chain                    275   1e-87   Brachypodium distachyon [annual false brome]
ref|NP_001105458.1|  tubulin beta-5 chain                               275   1e-87   Zea mays [maize]
ref|XP_004967662.1|  PREDICTED: tubulin beta-5 chain-like               275   1e-87   Setaria italica
ref|XP_003568451.1|  PREDICTED: tubulin beta-2 chain                    275   1e-87   Brachypodium distachyon [annual false brome]
emb|CAM58984.1|  beta tubulin 6                                         275   1e-87   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q9ZPN7.1|TBB4_ELEIN  RecName: Full=Tubulin beta-4 chain; AltNa...    275   1e-87   Eleusine indica [crabgrass]
gb|AFW79504.1|  hypothetical protein ZEAMMB73_908177                    275   1e-87   
ref|XP_011075464.1|  PREDICTED: tubulin beta-5 chain isoform X1         275   1e-87   
sp|Q9ZRB2.1|TBB1_WHEAT  RecName: Full=Tubulin beta-1 chain; AltNa...    275   1e-87   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006644071.1|  PREDICTED: tubulin beta-1 chain-like               275   1e-87   Oryza brachyantha
ref|XP_008654521.1|  PREDICTED: uncharacterized protein LOC100272...    275   1e-87   Zea mays [maize]
ref|XP_004249322.1|  PREDICTED: tubulin beta-5 chain                    275   1e-87   Solanum lycopersicum
ref|NP_001042761.1|  Os01g0282800                                       275   2e-87   
gb|AFR42145.1|  beta-tubulin                                            264   2e-87   Populus alba [abele]
ref|XP_009588441.1|  PREDICTED: tubulin beta-1 chain                    275   2e-87   Nicotiana tomentosiformis
gb|ABK95893.1|  unknown                                                 274   2e-87   Populus trichocarpa [western balsam poplar]
gb|AFR42136.1|  beta-tubulin                                            264   2e-87   Populus trichocarpa [western balsam poplar]
ref|XP_010922039.1|  PREDICTED: tubulin beta-5 chain                    274   2e-87   Elaeis guineensis
ref|XP_006387232.1|  hypothetical protein POPTR_1455s00200g             274   2e-87   
gb|AFR42164.1|  beta-tubulin                                            263   3e-87   Populus nigra [black poplar]
gb|AFR42167.1|  beta-tubulin                                            263   3e-87   Populus nigra [black poplar]
gb|AGH08225.1|  beta-tubulin 18                                         274   3e-87   Salix arbutifolia
ref|XP_002322609.1|  hypothetical protein POPTR_0016s03300g             274   3e-87   Populus trichocarpa [western balsam poplar]
ref|XP_010673064.1|  PREDICTED: tubulin beta-6 chain isoform X2         274   3e-87   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011036386.1|  PREDICTED: tubulin beta-5 chain                    274   3e-87   Populus euphratica
ref|NP_001055546.1|  Os05g0413200                                       274   3e-87   
ref|XP_010271905.1|  PREDICTED: tubulin beta-1 chain                    274   3e-87   Nelumbo nucifera [Indian lotus]
ref|XP_010243823.1|  PREDICTED: tubulin beta-4 chain-like               274   3e-87   Nelumbo nucifera [Indian lotus]
ref|XP_011040743.1|  PREDICTED: tubulin beta-5 chain-like               274   4e-87   Populus euphratica
ref|XP_011041397.1|  PREDICTED: tubulin beta-5 chain-like               274   4e-87   Populus euphratica
ref|XP_006836258.1|  hypothetical protein AMTR_s00101p00135960          272   4e-87   
ref|XP_006339255.1|  PREDICTED: tubulin beta-1 chain-like               274   4e-87   Solanum tuberosum [potatoes]
ref|XP_004962088.1|  PREDICTED: tubulin beta-2 chain-like               273   4e-87   Setaria italica
gb|AGH08229.1|  beta-tubulin 17                                         274   4e-87   Salix arbutifolia
gb|AGZ90159.1|  tubulin beta                                            273   4e-87   Litsea cubeba [may chang]
ref|XP_006430521.1|  hypothetical protein CICLE_v10011719mg             273   5e-87   Citrus clementina [clementine]
ref|XP_006482055.1|  PREDICTED: tubulin beta-1 chain-like               273   5e-87   Citrus sinensis [apfelsine]
ref|XP_003624926.1|  Tubulin beta chain                                 273   6e-87   Medicago truncatula
ref|XP_002307960.1|  hypothetical protein POPTR_0006s03390g             273   7e-87   Populus trichocarpa [western balsam poplar]
ref|NP_001289666.1|  tubulin beta-5 chain                               273   7e-87   Eucalyptus grandis [rose gum]
ref|XP_002523246.1|  tubulin beta chain, putative                       272   7e-87   
ref|XP_008788536.1|  PREDICTED: tubulin beta-5 chain-like               273   8e-87   Phoenix dactylifera
ref|XP_011036385.1|  PREDICTED: tubulin beta-1 chain-like               273   8e-87   Populus euphratica
ref|XP_002314014.2|  hypothetical protein POPTR_0009s07150g             273   8e-87   
ref|XP_007028241.1|  Beta-6 tubulin                                     273   9e-87   
gb|ACM89775.1|  beta-tubulin 3                                          273   9e-87   Gossypium hirsutum [American cotton]
ref|XP_003624927.1|  Tubulin beta chain                                 275   1e-86   
emb|CDM85842.1|  unnamed protein product                                273   1e-86   Triticum aestivum [Canadian hard winter wheat]
sp|Q6VAF8.1|TBB3_GOSHI  RecName: Full=Tubulin beta-3 chain; AltNa...    272   1e-86   Gossypium hirsutum [American cotton]
ref|XP_004493370.1|  PREDICTED: tubulin beta-6 chain-like               273   1e-86   Cicer arietinum [garbanzo]
sp|Q9ZRB1.1|TBB2_WHEAT  RecName: Full=Tubulin beta-2 chain; AltNa...    273   1e-86   Triticum aestivum [Canadian hard winter wheat]
gb|AGH08237.1|  beta-tubulin 16                                         273   1e-86   Salix arbutifolia
ref|XP_010232467.1|  PREDICTED: tubulin beta chain                      273   1e-86   
sp|P93176.1|TBB_HORVU  RecName: Full=Tubulin beta chain; AltName:...    273   1e-86   Hordeum vulgare [barley]
ref|XP_002456503.1|  hypothetical protein SORBIDRAFT_03g037490          272   1e-86   
ref|XP_010088982.1|  Tubulin beta-1 chain                               272   1e-86   Morus notabilis
ref|NP_001239638.1|  beta-tubulin                                       272   1e-86   Glycine max [soybeans]
sp|Q9ZPN9.1|TBB2_ELEIN  RecName: Full=Tubulin beta-2 chain; AltNa...    272   2e-86   Eleusine indica [crabgrass]
ref|XP_009420971.1|  PREDICTED: tubulin beta-4 chain                    272   2e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003554108.1|  PREDICTED: tubulin beta-4 chain-like               272   2e-86   Glycine max [soybeans]
gb|KHN08902.1|  Tubulin beta-1 chain                                    272   2e-86   Glycine soja [wild soybean]
ref|XP_007015369.1|  Beta-6 tubulin isoform 1                           272   2e-86   
ref|XP_010909062.1|  PREDICTED: tubulin beta-1 chain                    272   2e-86   Elaeis guineensis
ref|NP_001105426.1|  tubulin beta-2 chain                               272   2e-86   Zea mays [maize]
ref|XP_008798348.1|  PREDICTED: tubulin beta-1 chain                    272   2e-86   Phoenix dactylifera
ref|XP_010536143.1|  PREDICTED: tubulin beta-4 chain                    272   2e-86   Tarenaya hassleriana [spider flower]
ref|XP_002270069.1|  PREDICTED: tubulin beta-4 chain                    272   2e-86   Vitis vinifera
gb|EMT00232.1|  Tubulin beta-2 chain                                    272   2e-86   
sp|Q41785.1|TBB8_MAIZE  RecName: Full=Tubulin beta-8 chain; AltNa...    272   2e-86   Zea mays [maize]
ref|XP_010909929.1|  PREDICTED: tubulin beta-1 chain-like               271   3e-86   Elaeis guineensis
ref|XP_006387289.1|  hypothetical protein POPTR_1327s00200g             266   3e-86   
ref|XP_006649228.1|  PREDICTED: tubulin beta-2 chain-like               271   3e-86   Oryza brachyantha
ref|XP_006644872.1|  PREDICTED: tubulin beta-4 chain-like               271   3e-86   Oryza brachyantha
gb|KDP36971.1|  hypothetical protein JCGZ_08563                         271   3e-86   Jatropha curcas
ref|XP_002523247.1|  tubulin beta chain, putative                       271   3e-86   Ricinus communis
gb|EYU20815.1|  hypothetical protein MIMGU_mgv1a006356mg                271   4e-86   Erythranthe guttata [common monkey flower]
ref|XP_008227321.1|  PREDICTED: tubulin beta-4 chain                    271   4e-86   Prunus mume [ume]
gb|ADE76978.1|  unknown                                                 271   4e-86   Picea sitchensis
gb|ABK92780.1|  unknown                                                 271   4e-86   Populus trichocarpa [western balsam poplar]
emb|CAA55022.1|  beta tubulin                                           271   5e-86   Oryza sativa Japonica Group [Japonica rice]
gb|AAA66495.1|  beta-tubulin                                            271   5e-86   Oryza sativa [red rice]
ref|XP_006826860.1|  hypothetical protein AMTR_s00010p00119100          271   5e-86   Amborella trichopoda
ref|NP_001105317.1|  tubulin beta-6 chain                               271   5e-86   
tpg|DAA57202.1|  TPA: beta tubulin6                                     272   5e-86   
ref|NP_001044565.1|  Os01g0805900                                       271   5e-86   
ref|XP_009403832.1|  PREDICTED: tubulin beta-1 chain-like               271   5e-86   Musa acuminata subsp. malaccensis [pisang utan]
pir||JC2510  beta-tubulin R1623 - rice                                  271   5e-86
ref|NP_001167651.1|  uncharacterized protein LOC100381281               272   5e-86   Zea mays [maize]
ref|XP_007201980.1|  hypothetical protein PRUPE_ppa004851mg             272   5e-86   
ref|XP_007015368.1|  Beta-6 tubulin isoform 2                           271   5e-86   
ref|XP_007015367.1|  Beta-6 tubulin isoform 1                           271   6e-86   Theobroma cacao [chocolate]
ref|XP_008450322.1|  PREDICTED: tubulin beta-6 chain                    271   6e-86   Cucumis melo [Oriental melon]
ref|XP_010419814.1|  PREDICTED: tubulin beta-6 chain-like               271   6e-86   Camelina sativa [gold-of-pleasure]
ref|NP_196786.1|  beta-6 tubulin                                        271   6e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289933.1|  hypothetical protein CARUB_v10003555mg             271   6e-86   Capsella rubella
emb|CAE52516.1|  beta tubulin                                           271   6e-86   Setaria viridis
ref|XP_009393896.1|  PREDICTED: tubulin beta chain                      271   6e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004139067.1|  PREDICTED: tubulin beta-2 chain-like               271   6e-86   Cucumis sativus [cucumbers]
ref|XP_004970293.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    272   7e-86   
ref|XP_010491982.1|  PREDICTED: tubulin beta-6 chain-like               270   8e-86   Camelina sativa [gold-of-pleasure]
gb|AGH08240.1|  beta-tubulin 15                                         270   8e-86   Salix arbutifolia
gb|KDP21557.1|  hypothetical protein JCGZ_03665                         270   9e-86   Jatropha curcas
gb|KJB09278.1|  hypothetical protein B456_001G132500                    270   9e-86   Gossypium raimondii
gb|AGH08239.1|  beta-tubulin 13                                         270   1e-85   Salix arbutifolia
gb|ABY86657.1|  beta-tubulin 10                                         270   1e-85   Gossypium hirsutum [American cotton]
gb|EEC79224.1|  hypothetical protein OsI_19960                          275   2e-85   Oryza sativa Indica Group [Indian rice]
gb|EEE63725.1|  hypothetical protein OsJ_18543                          275   2e-85   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71666.1|  hypothetical protein OsI_04129                          271   2e-85   Oryza sativa Indica Group [Indian rice]
ref|XP_009404699.1|  PREDICTED: tubulin beta-1 chain                    270   2e-85   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIS84173.1|  beta-tubulin 6b                                         269   2e-85   Linum usitatissimum
gb|AIS84172.1|  beta-tubulin 6a                                         269   2e-85   Linum usitatissimum
ref|NP_001168511.1|  hypothetical protein                               269   2e-85   Zea mays [maize]
ref|XP_006399740.1|  hypothetical protein EUTSA_v10013524mg             269   2e-85   Eutrema salsugineum [saltwater cress]
ref|XP_010274718.1|  PREDICTED: tubulin beta-6 chain-like               269   3e-85   Nelumbo nucifera [Indian lotus]
emb|CDX69693.1|  BnaA10g20420D                                          270   3e-85   
ref|XP_009121863.1|  PREDICTED: tubulin beta-6 chain                    269   3e-85   Brassica rapa
ref|XP_002298455.1|  hypothetical protein POPTR_0001s27960g             269   3e-85   
ref|XP_009401585.1|  PREDICTED: tubulin beta-1 chain-like               269   3e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654403.1|  PREDICTED: tubulin beta-1 chain-like               269   3e-85   Oryza brachyantha
gb|ACG32188.1|  tubulin beta-4 chain                                    268   5e-85   Zea mays [maize]
ref|XP_010673793.1|  PREDICTED: tubulin beta-4 chain                    268   5e-85   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX97180.1|  BnaC09g44450D                                          269   5e-85   
gb|AFW84815.1|  hypothetical protein ZEAMMB73_647337                    269   6e-85   
gb|EMS63710.1|  Tubulin beta-2 chain                                    273   7e-85   Triticum urartu
ref|XP_010521570.1|  PREDICTED: tubulin beta-5 chain-like               268   8e-85   Tarenaya hassleriana [spider flower]
ref|XP_010036380.1|  PREDICTED: tubulin beta-1 chain-like               268   9e-85   Eucalyptus grandis [rose gum]
ref|XP_008790003.1|  PREDICTED: tubulin beta-1 chain-like               267   1e-84   Phoenix dactylifera
dbj|BAC42563.1|  putative tubulin beta-6 chain                          267   1e-84   Arabidopsis thaliana [mouse-ear cress]
gb|KDP23921.1|  hypothetical protein JCGZ_27081                         264   1e-84   Jatropha curcas
ref|XP_011025004.1|  PREDICTED: tubulin beta-4 chain-like               267   1e-84   Populus euphratica
dbj|BAP59013.1|  beta tubulin                                           267   2e-84   Taxus cuspidata [ichii]
ref|XP_003604816.1|  Tubulin beta chain                                 266   5e-84   Medicago truncatula
gb|AAK32919.1|AF367332_1  AT5g62700/MRG21_12                            262   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001048679.2|  Os03g0105600                                       254   1e-83   
gb|ACJ84610.1|  unknown                                                 265   1e-83   Medicago truncatula
ref|XP_003604818.1|  Tubulin beta chain                                 265   1e-83   Medicago truncatula
gb|KFK34015.1|  hypothetical protein AALP_AA5G090900                    265   1e-83   Arabis alpina [alpine rockcress]
gb|KFK28005.1|  hypothetical protein AALP_AA8G459200                    265   2e-83   Arabis alpina [alpine rockcress]
ref|XP_002321512.2|  hypothetical protein POPTR_0015s04560g             264   2e-83   Populus trichocarpa [western balsam poplar]
gb|KHG21955.1|  Tubulin beta-8 chain -like protein                      258   2e-83   Gossypium arboreum [tree cotton]
ref|XP_010926477.1|  PREDICTED: tubulin beta-5 chain-like               264   2e-83   Elaeis guineensis
ref|XP_004234396.1|  PREDICTED: tubulin beta-1 chain                    264   2e-83   Solanum lycopersicum
gb|KHG16112.1|  Tubulin beta-1 chain                                    257   2e-83   Gossypium arboreum [tree cotton]
ref|XP_011009715.1|  PREDICTED: tubulin beta chain-like                 264   2e-83   Populus euphratica
ref|XP_006353299.1|  PREDICTED: tubulin beta-1 chain-like isoform X1    264   2e-83   Solanum tuberosum [potatoes]
ref|XP_006404432.1|  hypothetical protein EUTSA_v10010368mg             264   2e-83   Eutrema salsugineum [saltwater cress]
gb|AGN95064.1|  putative tubulin beta-2-like protein                    264   2e-83   Physaria fendleri
ref|XP_010908105.1|  PREDICTED: tubulin beta-2 chain-like               264   2e-83   Elaeis guineensis
gb|KHG02753.1|  Tubulin beta-2/beta-3 chain -like protein               257   3e-83   Gossypium arboreum [tree cotton]
ref|XP_008804937.1|  PREDICTED: tubulin beta-2 chain                    264   3e-83   Phoenix dactylifera
ref|XP_010521908.1|  PREDICTED: tubulin beta-2 chain-like               263   3e-83   Tarenaya hassleriana [spider flower]
gb|AIZ74332.1|  beta-tubulin                                            263   4e-83   Pinus massoniana [Chinese red pine]
tpg|DAA51373.1|  TPA: hypothetical protein ZEAMMB73_041268              254   4e-83   
emb|CDY21784.1|  BnaA06g20530D                                          263   4e-83   Brassica napus [oilseed rape]
ref|XP_006657241.1|  PREDICTED: tubulin beta-3 chain-like               253   5e-83   
gb|EYU38358.1|  hypothetical protein MIMGU_mgv1a007077mg                262   5e-83   Erythranthe guttata [common monkey flower]
gb|KHG25436.1|  Tubulin beta-8 chain -like protein                      258   5e-83   Gossypium arboreum [tree cotton]
gb|KHG21113.1|  Tubulin beta-9 chain                                    256   5e-83   Gossypium arboreum [tree cotton]
ref|NP_568959.1|  tubulin beta-2/beta-3 chain                           263   5e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877519.1|  tubulin beta-2                                     263   5e-83   
ref|XP_009149954.1|  PREDICTED: tubulin beta-2 chain-like               263   5e-83   Brassica rapa
ref|NP_001289924.1|  tubulin beta-2 chain                               263   6e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010459234.1|  PREDICTED: tubulin beta-2 chain-like               263   6e-83   Camelina sativa [gold-of-pleasure]
gb|KFK44234.1|  hypothetical protein AALP_AA1G232100                    263   6e-83   Arabis alpina [alpine rockcress]
ref|XP_006291122.1|  hypothetical protein CARUB_v10017235mg             263   6e-83   Capsella rubella
ref|XP_002864813.1|  tubulin beta-2                                     263   6e-83   
gb|AGQ43300.1|  TUBB3                                                   253   6e-83   Oryza sativa f. spontanea
ref|XP_010542657.1|  PREDICTED: tubulin beta-2 chain-like               263   6e-83   Tarenaya hassleriana [spider flower]
ref|XP_004506645.1|  PREDICTED: tubulin beta-2 chain-like               263   7e-83   Cicer arietinum [garbanzo]
emb|CDX88051.1|  BnaA06g26420D                                          262   7e-83   
emb|CDY67078.1|  BnaAnng23580D                                          261   7e-83   Brassica napus [oilseed rape]
ref|XP_010483981.1|  PREDICTED: tubulin beta-2 chain-like               263   7e-83   Camelina sativa [gold-of-pleasure]
ref|XP_007133955.1|  hypothetical protein PHAVU_010G006400g             263   8e-83   Phaseolus vulgaris [French bean]
gb|ACU22866.1|  unknown                                                 261   8e-83   Glycine max [soybeans]
ref|XP_009150568.1|  PREDICTED: tubulin beta-2 chain-like               263   8e-83   Brassica rapa
ref|XP_010255421.1|  PREDICTED: tubulin beta-2 chain                    263   9e-83   Nelumbo nucifera [Indian lotus]
emb|CDX80390.1|  BnaC07g30540D                                          263   9e-83   
ref|XP_009150907.1|  PREDICTED: tubulin beta-8 chain                    263   9e-83   Brassica rapa
ref|XP_010557230.1|  PREDICTED: tubulin beta-2 chain-like               262   1e-82   Tarenaya hassleriana [spider flower]
ref|XP_003516925.1|  PREDICTED: tubulin beta-2 chain-like               262   1e-82   Glycine max [soybeans]
ref|XP_003520939.1|  PREDICTED: tubulin beta-2 chain-like               262   1e-82   
emb|CAM58986.1|  beta tubulin 8                                         262   1e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006827680.1|  hypothetical protein AMTR_s00009p00255970          262   1e-82   Amborella trichopoda
ref|XP_002271992.1|  PREDICTED: tubulin beta-2 chain                    262   1e-82   Vitis vinifera
ref|XP_004158094.1|  PREDICTED: tubulin beta chain-like                 253   1e-82   
ref|XP_006429261.1|  hypothetical protein CICLE_v10011723mg             262   2e-82   Citrus clementina [clementine]
gb|EMT08428.1|  Tubulin beta-1 chain                                    262   2e-82   
ref|XP_008782284.1|  PREDICTED: tubulin beta-6 chain-like               262   2e-82   Phoenix dactylifera
gb|AGE44289.1|  beta-tubulin                                            262   2e-82   Dimocarpus longan [longan]
ref|XP_006404194.1|  hypothetical protein EUTSA_v10010366mg             262   2e-82   Eutrema salsugineum [saltwater cress]
ref|XP_002282157.1|  PREDICTED: tubulin beta chain                      261   2e-82   Vitis vinifera
ref|XP_006481398.1|  PREDICTED: tubulin beta-2 chain                    261   2e-82   Citrus sinensis [apfelsine]
ref|XP_008806874.1|  PREDICTED: tubulin beta-2 chain                    261   2e-82   Phoenix dactylifera
ref|XP_011039129.1|  PREDICTED: tubulin beta-5 chain-like               261   2e-82   Populus euphratica
ref|XP_010035138.1|  PREDICTED: tubulin beta-1 chain                    261   2e-82   Eucalyptus grandis [rose gum]
ref|XP_004496560.1|  PREDICTED: tubulin beta-1 chain-like               261   2e-82   Cicer arietinum [garbanzo]
ref|XP_003592284.1|  Tubulin beta chain                                 261   2e-82   Medicago truncatula
ref|XP_002509780.1|  tubulin beta chain, putative                       261   2e-82   Ricinus communis
gb|AFC88825.1|  putative tubulin beta-7 chain                           257   2e-82   Miscanthus sinensis
ref|XP_011072483.1|  PREDICTED: tubulin beta-8 chain-like               261   2e-82   Sesamum indicum [beniseed]
ref|XP_002532094.1|  tubulin beta chain, putative                       261   2e-82   Ricinus communis
ref|XP_009144365.1|  PREDICTED: tubulin beta-7 chain                    261   2e-82   Brassica rapa
emb|CDY45452.1|  BnaA05g12490D                                          261   2e-82   Brassica napus [oilseed rape]
gb|KJB21246.1|  hypothetical protein B456_003G126300                    259   2e-82   Gossypium raimondii
ref|XP_010469941.1|  PREDICTED: tubulin beta-7 chain-like               261   2e-82   Camelina sativa [gold-of-pleasure]
gb|AGV54374.1|  tubulin beta-2 chain-like protein                       261   2e-82   Phaseolus vulgaris [French bean]
ref|XP_010510475.1|  PREDICTED: tubulin beta-7 chain isoform X1         261   3e-82   Camelina sativa [gold-of-pleasure]
ref|XP_011072460.1|  PREDICTED: tubulin beta-8 chain-like               261   3e-82   Sesamum indicum [beniseed]
ref|XP_002318519.1|  hypothetical protein POPTR_0012s04500g             261   3e-82   Populus trichocarpa [western balsam poplar]
emb|CDP05193.1|  unnamed protein product                                261   3e-82   Coffea canephora [robusta coffee]
ref|XP_006421924.1|  hypothetical protein CICLE_v10004755mg             263   3e-82   
emb|CDP09135.1|  unnamed protein product                                260   3e-82   Coffea canephora [robusta coffee]
gb|AFR42222.1|  beta-tubulin                                            250   3e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010940464.1|  PREDICTED: tubulin beta-2 chain                    261   4e-82   Elaeis guineensis
gb|AAK96884.1|  beta tubulin                                            261   4e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535429.1|  PREDICTED: tubulin beta-2 chain                    261   4e-82   Tarenaya hassleriana [spider flower]
ref|NP_568437.1|  tubulin beta-8 chain                                  261   4e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287738.1|  hypothetical protein CARUB_v10000948mg             261   4e-82   Capsella rubella
ref|XP_010676480.1|  PREDICTED: tubulin beta-1 chain                    261   4e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002510784.1|  tubulin beta chain, putative                       261   4e-82   Ricinus communis
gb|KJB34131.1|  hypothetical protein B456_006G049000                    261   4e-82   Gossypium raimondii
ref|XP_011076163.1|  PREDICTED: tubulin beta-1 chain                    261   5e-82   Sesamum indicum [beniseed]
ref|XP_006490393.1|  PREDICTED: tubulin beta-1 chain-like               261   5e-82   Citrus sinensis [apfelsine]
gb|AIS84176.1|  beta-tubulin 7c                                         261   5e-82   Linum usitatissimum
gb|AIS84175.1|  beta-tubulin 7b                                         261   5e-82   Linum usitatissimum
ref|XP_002872076.1|  tubulin beta-8                                     260   6e-82   
gb|EYU38453.1|  hypothetical protein MIMGU_mgv1a006387mg                260   6e-82   Erythranthe guttata [common monkey flower]
ref|XP_009767718.1|  PREDICTED: tubulin beta-1 chain                    260   6e-82   Nicotiana sylvestris
gb|KHG11026.1|  Tubulin beta-8 chain -like protein                      254   6e-82   Gossypium arboreum [tree cotton]
ref|NP_001289638.1|  tubulin beta-9 chain                               260   6e-82   Eucalyptus grandis [rose gum]
ref|XP_004172853.1|  PREDICTED: tubulin beta-1 chain-like               249   6e-82   
ref|XP_009596463.1|  PREDICTED: tubulin beta-1 chain                    260   7e-82   Nicotiana tomentosiformis
gb|KJB25808.1|  hypothetical protein B456_004G210600                    259   7e-82   Gossypium raimondii
gb|AIS84174.1|  beta-tubulin 7a                                         260   7e-82   Linum usitatissimum
ref|XP_009141007.1|  PREDICTED: tubulin beta-7 chain-like               260   7e-82   Brassica rapa
ref|XP_009626214.1|  PREDICTED: tubulin beta-2 chain-like               260   7e-82   Nicotiana tomentosiformis
ref|XP_007040195.1|  Tubulin beta 8                                     260   7e-82   Theobroma cacao [chocolate]
ref|XP_010530505.1|  PREDICTED: tubulin beta-8 chain                    260   8e-82   
ref|XP_002267380.1|  PREDICTED: tubulin beta-1 chain                    260   8e-82   Vitis vinifera
emb|CDY51360.1|  BnaA04g28540D                                          260   8e-82   Brassica napus [oilseed rape]
ref|XP_010540645.1|  PREDICTED: tubulin beta chain                      260   9e-82   Tarenaya hassleriana [spider flower]
gb|ABK94893.1|  unknown                                                 253   9e-82   Populus trichocarpa [western balsam poplar]
emb|CAN64745.1|  hypothetical protein VITISV_041322                     260   9e-82   Vitis vinifera
tpg|DAA42820.1|  TPA: beta tubulin1                                     259   9e-82   
gb|KFK27675.1|  hypothetical protein AALP_AA8G414100                    260   9e-82   Arabis alpina [alpine rockcress]
ref|XP_004240734.1|  PREDICTED: tubulin beta-1 chain                    260   9e-82   Solanum lycopersicum
ref|XP_006424984.1|  hypothetical protein CICLE_v10028436mg             260   1e-81   Citrus clementina [clementine]
ref|XP_006294210.1|  hypothetical protein CARUB_v10023206mg             260   1e-81   Capsella rubella
ref|NP_001274811.1|  uncharacterized protein LOC102577679               260   1e-81   Solanum tuberosum [potatoes]
ref|XP_007209134.1|  hypothetical protein PRUPE_ppa005674mg             260   1e-81   Prunus persica
gb|AFR42233.1|  beta-tubulin                                            249   1e-81   Populus fremontii
gb|ABY86665.1|  beta-tubulin 19                                         259   1e-81   Gossypium hirsutum [American cotton]
gb|ABY86664.1|  beta-tubulin 18                                         259   1e-81   Gossypium hirsutum [American cotton]
ref|XP_004249588.1|  PREDICTED: tubulin beta-2 chain-like               259   1e-81   Solanum lycopersicum
gb|AGH08232.1|  beta-tubulin 3                                          259   1e-81   Salix arbutifolia
ref|XP_007016239.1|  Tubulin beta 8                                     259   1e-81   Theobroma cacao [chocolate]
ref|XP_008644456.1|  PREDICTED: tubulin beta-7 chain                    259   1e-81   Zea mays [maize]
ref|XP_008811481.1|  PREDICTED: tubulin beta-8 chain-like               259   1e-81   Phoenix dactylifera
gb|AIY99978.1|  tubulin beta 2                                          259   1e-81   Marchantia polymorpha
ref|XP_002468688.1|  hypothetical protein SORBIDRAFT_01g050310          259   1e-81   Sorghum bicolor [broomcorn]
ref|XP_008377500.1|  PREDICTED: tubulin beta-1 chain                    259   1e-81   Malus domestica [apple tree]
ref|XP_006410627.1|  hypothetical protein EUTSA_v10016629mg             259   1e-81   Eutrema salsugineum [saltwater cress]
ref|XP_007143420.1|  hypothetical protein PHAVU_007G070800g             259   1e-81   Phaseolus vulgaris [French bean]
gb|AIX10967.1|  tubulin                                                 259   1e-81   Ornithogalum longebracteatum [sea-onion]
gb|EYU19549.1|  hypothetical protein MIMGU_mgv1a006353mg                259   1e-81   Erythranthe guttata [common monkey flower]
ref|XP_009371335.1|  PREDICTED: tubulin beta-1 chain                    259   2e-81   Pyrus x bretschneideri [bai li]
ref|XP_007218003.1|  hypothetical protein PRUPE_ppa005698mg             259   2e-81   Prunus persica
ref|XP_003556108.1|  PREDICTED: tubulin beta-1 chain-like               259   2e-81   
ref|XP_010108341.1|  Tubulin beta-1 chain                               259   2e-81   
ref|XP_010520236.1|  PREDICTED: tubulin beta-2 chain-like               259   2e-81   
gb|ABY86655.1|  beta-tubulin 4                                          259   2e-81   
ref|XP_003536467.1|  PREDICTED: tubulin beta-1 chain-like               259   2e-81   
gb|AFR42156.1|  beta-tubulin                                            248   2e-81   
ref|XP_009803077.1|  PREDICTED: tubulin beta-1 chain-like               259   2e-81   
ref|XP_007026823.1|  Tubulin beta 8                                     259   2e-81   
ref|XP_010539847.1|  PREDICTED: tubulin beta-1 chain                    259   2e-81   
ref|XP_009793967.1|  PREDICTED: tubulin beta-2 chain-like               259   2e-81   
gb|KJB20687.1|  hypothetical protein B456_003G159400                    258   2e-81   
ref|XP_011022718.1|  PREDICTED: tubulin beta-5 chain-like               259   2e-81   
gb|ABK94073.1|  unknown                                                 259   2e-81   
ref|XP_004986075.1|  PREDICTED: tubulin beta-2 chain-like               259   2e-81   
ref|XP_002304488.1|  hypothetical protein POPTR_0003s12540g             259   2e-81   
gb|AAL92026.1|AF484959_1  tubulin beta-1                                259   2e-81   
gb|AGV54311.1|  tubulin beta chain                                      259   2e-81   
ref|XP_009396166.1|  PREDICTED: tubulin beta-1 chain                    259   2e-81   
ref|XP_008376592.1|  PREDICTED: tubulin beta-1 chain-like               259   2e-81   
ref|XP_006410629.1|  hypothetical protein EUTSA_v10016629mg             259   2e-81   
ref|XP_007038700.1|  Tubulin beta 8                                     259   2e-81   
sp|Q6VAF4.1|TBB9_GOSHI  RecName: Full=Tubulin beta-9 chain; AltNa...    259   2e-81   
ref|XP_009794774.1|  PREDICTED: tubulin beta-2 chain                    259   2e-81   
emb|CDY53366.1|  BnaC04g54460D                                          259   2e-81   
ref|XP_009629036.1|  PREDICTED: tubulin beta-2 chain                    259   2e-81   
ref|XP_010934750.1|  PREDICTED: tubulin beta-2 chain-like               259   2e-81   
ref|XP_002313404.1|  hypothetical protein POPTR_0009s04500g             259   2e-81   
ref|XP_004249594.1|  PREDICTED: tubulin beta-2 chain                    259   2e-81   
ref|XP_006410628.1|  hypothetical protein EUTSA_v10016629mg             259   2e-81   
ref|XP_004981550.1|  PREDICTED: tubulin beta-7 chain-like               259   2e-81   
ref|XP_006650676.1|  PREDICTED: tubulin beta-7 chain-like               259   2e-81   
sp|Q8H7U1.1|TBB2_ORYSJ  RecName: Full=Tubulin beta-2 chain; AltNa...    259   2e-81   
ref|XP_010228968.1|  PREDICTED: tubulin beta-4 chain                    259   3e-81   
gb|AIA09927.1|  beta-tubulin                                            259   3e-81   
gb|AFR42253.1|  beta-tubulin                                            248   3e-81   
ref|XP_002466356.1|  hypothetical protein SORBIDRAFT_01g006310          259   3e-81   
ref|XP_004951797.1|  PREDICTED: tubulin beta-3 chain-like               259   3e-81   
ref|XP_009763987.1|  PREDICTED: tubulin beta-8 chain-like               259   3e-81   
ref|XP_010519051.1|  PREDICTED: tubulin beta chain-like                 259   3e-81   
tpg|DAA51374.1|  TPA: hypothetical protein ZEAMMB73_041268              258   3e-81   
gb|AAA32886.1|  beta-8 tubulin                                          258   3e-81   
gb|AGH08227.1|  beta-tubulin 4                                          258   3e-81   
ref|XP_010905373.1|  PREDICTED: tubulin beta-8 chain-like               258   4e-81   
ref|XP_002299541.1|  hypothetical protein POPTR_0001s09180g             258   4e-81   
gb|KDP46576.1|  hypothetical protein JCGZ_08548                         258   4e-81   
ref|XP_010042213.1|  PREDICTED: tubulin beta chain-like                 248   4e-81   
ref|XP_009590874.1|  PREDICTED: tubulin beta-8 chain-like               258   4e-81   
gb|KJB20686.1|  hypothetical protein B456_003G159400                    258   4e-81   
ref|XP_006394642.1|  hypothetical protein EUTSA_v10004208mg             258   4e-81   
ref|XP_008442483.1|  PREDICTED: tubulin beta chain-like                 258   4e-81   
emb|CAM58980.1|  beta tubulin 2                                         258   4e-81   
sp|Q9ZRB0.1|TBB3_WHEAT  RecName: Full=Tubulin beta-3 chain; AltNa...    258   4e-81   
ref|XP_010273068.1|  PREDICTED: tubulin beta-1 chain-like               258   4e-81   
sp|P37392.1|TBB1_LUPAL  RecName: Full=Tubulin beta-1 chain; AltNa...    258   4e-81   
ref|XP_003569962.1|  PREDICTED: tubulin beta-3 chain                    258   5e-81   
ref|XP_008364655.1|  PREDICTED: tubulin beta chain-like                 258   5e-81   
gb|ABA46752.1|  unknown                                                 258   5e-81   
ref|XP_004161837.1|  PREDICTED: tubulin beta-1 chain-like               258   5e-81   
ref|XP_008355572.1|  PREDICTED: tubulin beta chain                      251   5e-81   
ref|XP_004137501.1|  PREDICTED: tubulin beta-1 chain-like               258   5e-81   
ref|XP_004137743.1|  PREDICTED: tubulin beta-1 chain-like               258   5e-81   
gb|KEH28915.1|  tubulin beta-1 chain                                    258   5e-81   
ref|XP_008777278.1|  PREDICTED: tubulin beta-8 chain-like               258   5e-81   
gb|AGH08238.1|  beta-tubulin 2                                          258   5e-81   
sp|P29500.1|TBB1_PEA  RecName: Full=Tubulin beta-1 chain; AltName...    258   5e-81   
gb|KHN27008.1|  Tubulin beta-1 chain                                    258   6e-81   
ref|XP_008464297.1|  PREDICTED: tubulin beta chain-like                 258   6e-81   
gb|AAU14217.1|  TUB8                                                    258   6e-81   
ref|XP_004302651.1|  PREDICTED: tubulin beta-1 chain-like               258   6e-81   
ref|XP_009398811.1|  PREDICTED: tubulin beta-2 chain-like               258   6e-81   
ref|XP_004308083.1|  PREDICTED: tubulin beta-1 chain                    258   6e-81   
ref|XP_011032195.1|  PREDICTED: tubulin beta-2 chain-like               258   6e-81   
sp|Q9ZRA9.1|TBB4_WHEAT  RecName: Full=Tubulin beta-4 chain; AltNa...    258   7e-81   
gb|KJB36870.1|  hypothetical protein B456_006G179900                    258   7e-81   
emb|CAM58983.1|  beta tubulin 5                                         258   7e-81   
ref|XP_008355135.1|  PREDICTED: tubulin beta chain-like                 251   7e-81   
sp|Q9ZPP0.1|TBB1_ELEIN  RecName: Full=Tubulin beta-1 chain; AltNa...    258   7e-81   
gb|EMS61990.1|  Tubulin beta-4 chain                                    258   7e-81   
dbj|BAA82637.1|  Beta-tubulin                                           258   7e-81   
ref|XP_003563397.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    258   8e-81   
ref|XP_002451606.1|  hypothetical protein SORBIDRAFT_04g004520          258   8e-81   
ref|XP_006339000.1|  PREDICTED: tubulin beta-8 chain-like               258   8e-81   
ref|XP_008648960.1|  PREDICTED: tubulin beta-7 chain-like               257   8e-81   
gb|AAY43798.1|  tubulin                                                 257   8e-81   
ref|XP_007205196.1|  hypothetical protein PRUPE_ppa005693mg             257   8e-81   
ref|XP_008778745.1|  PREDICTED: tubulin beta-2 chain-like               257   9e-81   
ref|XP_008370041.1|  PREDICTED: tubulin beta chain                      257   9e-81   
ref|XP_006390273.1|  hypothetical protein EUTSA_v10018544mg             257   9e-81   
emb|CDY70326.1|  BnaCnng67810D                                          248   9e-81   
ref|NP_001105688.1|  tubulin beta-7 chain                               257   9e-81   
gb|ABY86663.1|  beta-tubulin 17                                         257   9e-81   
gb|KDO84876.1|  hypothetical protein CISIN_1g036688mg                   250   1e-80   
ref|NP_180515.1|  tubulin beta-7 chain                                  257   1e-80   
ref|XP_001779193.1|  predicted protein                                  257   1e-80   
ref|XP_008360926.1|  PREDICTED: tubulin beta chain-like                 257   1e-80   
ref|XP_006302256.1|  hypothetical protein CARUB_v10020293mg             257   1e-80   
gb|AEN19688.1|  beta-tubulin                                            254   1e-80   
gb|EAZ28789.1|  hypothetical protein OsJ_12810                          257   1e-80   
gb|AEN19686.1|  beta-tubulin                                            254   1e-80   
ref|NP_001058334.1|  Os06g0671900                                       256   1e-80   
gb|AAQ57206.1|  beta tubulin                                            246   1e-80   
ref|XP_010087906.1|  Tubulin beta-1 chain                               257   1e-80   
ref|NP_001051451.1|  Os03g0780600                                       257   1e-80   
ref|NP_001169695.1|  uncharacterized protein LOC100383576               257   1e-80   
sp|Q40665.2|TBB3_ORYSJ  RecName: Full=Tubulin beta-3 chain; AltNa...    257   1e-80   
gb|KDP25455.1|  hypothetical protein JCGZ_20611                         257   1e-80   
ref|NP_001046006.1|  Os02g0167300                                       257   1e-80   
gb|KJB36869.1|  hypothetical protein B456_006G179900                    258   1e-80   
emb|CAA55912.1|  beta tubulin                                           257   2e-80   
emb|CAM58981.1|  beta tubulin 3                                         257   2e-80   
pir||JC2511  beta-tubulin R2242 - rice                                  256   2e-80
gb|KDP36918.1|  hypothetical protein JCGZ_08209                         257   2e-80   
gb|ABY86662.1|  beta-tubulin 16                                         256   2e-80   
ref|NP_001168917.1|  uncharacterized protein LOC100382727               259   2e-80   
ref|XP_004299532.1|  PREDICTED: tubulin beta chain-like                 256   2e-80   
ref|XP_004966294.1|  PREDICTED: tubulin beta-1 chain-like               256   2e-80   
ref|XP_010662749.1|  PREDICTED: tubulin beta-1 chain-like               248   2e-80   
ref|XP_010926884.1|  PREDICTED: tubulin beta chain-like                 256   2e-80   
gb|ABP65322.1|  beta tubulin                                            256   2e-80   
sp|P12460.1|TBB2_SOYBN  RecName: Full=Tubulin beta-2 chain; AltNa...    256   2e-80   
ref|NP_001275378.1|  beta-tubulin-like protein                          256   2e-80   
ref|XP_007211629.1|  hypothetical protein PRUPE_ppa005785mg             256   2e-80   
ref|NP_001234807.1|  beta-tubulin                                       256   2e-80   
ref|XP_008388103.1|  PREDICTED: tubulin beta chain-like                 256   2e-80   
ref|XP_010536397.1|  PREDICTED: tubulin beta-1 chain-like               256   2e-80   
gb|AAC84132.1|  beta-tubulin                                            247   2e-80   
ref|NP_177706.1|  tubulin beta-1 chain                                  256   2e-80   
gb|KHN12641.1|  Tubulin beta-1 chain                                    256   3e-80   
ref|XP_004293671.1|  PREDICTED: tubulin beta chain                      256   3e-80   
gb|KJB37164.1|  hypothetical protein B456_006G191900                    256   3e-80   
ref|XP_009608201.1|  PREDICTED: tubulin beta-1 chain                    256   3e-80   
ref|XP_002510540.1|  tubulin beta chain, putative                       256   3e-80   
ref|XP_009106234.1|  PREDICTED: tubulin beta-1 chain                    256   3e-80   
ref|XP_002889044.1|  tubulin beta-1 chain                               256   3e-80   
ref|XP_008392575.1|  PREDICTED: tubulin beta-6 chain-like               249   3e-80   
ref|XP_010434258.1|  PREDICTED: tubulin beta-9 chain-like               245   3e-80   
gb|KHN39426.1|  Tubulin beta-1 chain                                    256   3e-80   
gb|AIS84167.1|  beta-tubulin 3a                                         256   3e-80   
dbj|BAC41937.1|  putative tubulin beta-1 chain                          256   3e-80   
ref|XP_010516638.1|  PREDICTED: tubulin beta chain                      256   3e-80   
ref|XP_006848044.1|  hypothetical protein AMTR_s00029p00190040          256   3e-80   
gb|KFK42010.1|  hypothetical protein AALP_AA2G200900                    256   3e-80   
ref|NP_001242850.1|  uncharacterized protein LOC100781043               256   3e-80   
gb|ABY86654.1|  beta-tubulin 2                                          256   3e-80   
ref|XP_002881057.1|  tubulin beta-7 chain                               256   3e-80   
gb|AFR42243.1|  beta-tubulin                                            245   3e-80   
ref|XP_011096695.1|  PREDICTED: tubulin beta chain                      256   3e-80   
ref|XP_004291357.1|  PREDICTED: tubulin beta chain-like                 256   3e-80   
ref|XP_010906251.1|  PREDICTED: tubulin beta chain-like                 256   3e-80   
ref|XP_010104458.1|  Tubulin beta-1 chain                               256   3e-80   
ref|XP_002438838.1|  hypothetical protein SORBIDRAFT_10g027010          256   3e-80   
gb|ACN39870.1|  unknown                                                 256   3e-80   
sp|P29501.1|TBB2_PEA  RecName: Full=Tubulin beta-2 chain; AltName...    256   4e-80   
ref|XP_002299042.1|  hypothetical protein POPTR_0001s46870g             256   4e-80   
gb|AAD02498.1|  beta tubulin 1                                          256   4e-80   
ref|XP_011039269.1|  PREDICTED: tubulin beta chain-like                 256   4e-80   
gb|KCW77253.1|  hypothetical protein EUGRSUZ_D01612                     256   4e-80   
gb|KJB63515.1|  hypothetical protein B456_010G003800                    256   4e-80   
emb|CDP12577.1|  unnamed protein product                                256   4e-80   
gb|AGH08233.1|  beta-tubulin 1                                          256   4e-80   
sp|Q9ZPN8.1|TBB3_ELEIN  RecName: Full=Tubulin beta-3 chain; AltNa...    256   4e-80   
gb|KHG02799.1|  Tubulin beta-5 chain                                    248   4e-80   
gb|AET80382.1|  beta-tubulin 1                                          253   4e-80   
ref|XP_007017809.1|  Tubulin beta-1 chain                               256   4e-80   
gb|AFN53689.1|  putative tubulin beta-1 chain protein                   256   5e-80   
ref|XP_008448943.1|  PREDICTED: tubulin beta chain-like                 255   5e-80   
ref|XP_004172348.1|  PREDICTED: tubulin beta-1 chain-like               255   5e-80   
ref|XP_007136094.1|  hypothetical protein PHAVU_009G017300g             256   5e-80   
ref|XP_010941598.1|  PREDICTED: tubulin beta chain                      255   5e-80   
ref|XP_008807190.1|  PREDICTED: tubulin beta chain-like                 255   5e-80   
ref|XP_004147894.1|  PREDICTED: tubulin beta-1 chain-like               255   5e-80   
ref|XP_009792728.1|  PREDICTED: tubulin beta chain                      255   5e-80   
dbj|BAA02505.1|  beta-tubulin                                           255   5e-80   
gb|AGH08235.1|  beta-tubulin 11                                         255   5e-80   
ref|XP_002275306.1|  PREDICTED: tubulin beta-1 chain                    255   5e-80   
sp|P28551.2|TBB3_SOYBN  RecName: Full=Tubulin beta chain; AltName...    254   5e-80   
ref|XP_009622091.1|  PREDICTED: tubulin beta chain                      255   5e-80   
ref|XP_006448872.1|  hypothetical protein CICLE_v10015255mg             255   6e-80   
ref|XP_004240391.1|  PREDICTED: tubulin beta-8 chain-like               255   6e-80   
ref|XP_003559023.1|  PREDICTED: tubulin beta-2 chain                    255   6e-80   
ref|XP_010533801.1|  PREDICTED: tubulin beta-5 chain                    255   6e-80   
ref|XP_007036799.1|  Beta-6 tubulin                                     255   6e-80   
gb|KHG28642.1|  Tubulin beta-7 chain                                    248   6e-80   
gb|KFK36378.1|  hypothetical protein AALP_AA4G115600                    255   6e-80   
ref|XP_006377941.1|  tubulin beta chain family protein                  255   6e-80   
ref|XP_011037726.1|  PREDICTED: tubulin beta chain                      255   6e-80   
ref|XP_011035226.1|  PREDICTED: tubulin beta-2 chain                    255   6e-80   
ref|XP_002298330.1|  Tubulin beta-2/beta-3 chain family protein         255   6e-80   
ref|XP_001777263.1|  predicted protein                                  255   6e-80   
ref|XP_001767462.1|  predicted protein                                  255   6e-80   
emb|CDO98351.1|  unnamed protein product                                255   6e-80   
gb|AHA84224.1|  tubulin beta-1 chain-like protein                       255   6e-80   
ref|XP_002523174.1|  tubulin beta chain, putative                       255   7e-80   
ref|XP_002963869.1|  hypothetical protein SELMODRAFT_266715             255   7e-80   
ref|XP_009144143.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    255   7e-80   
gb|AGT02044.1|  beta-tubulin                                            255   7e-80   
ref|XP_003535107.1|  PREDICTED: tubulin beta-3 chain-like               255   7e-80   
ref|XP_002962357.1|  hypothetical protein SELMODRAFT_78418              255   7e-80   
ref|XP_004135544.1|  PREDICTED: tubulin beta-1 chain-like               255   8e-80   
ref|XP_002881356.1|  beta-tubulin R2242-rice                            255   8e-80   
ref|XP_008793578.1|  PREDICTED: tubulin beta chain                      255   8e-80   
ref|XP_003546276.1|  PREDICTED: tubulin beta-3 chain                    255   8e-80   
ref|XP_010685649.1|  PREDICTED: tubulin beta-1 chain                    255   8e-80   
ref|XP_008445559.1|  PREDICTED: tubulin beta chain                      255   8e-80   
emb|CDY31638.1|  BnaA05g09090D                                          255   8e-80   
ref|XP_002961071.1|  hypothetical protein SELMODRAFT_402668             255   8e-80   
ref|XP_007147456.1|  hypothetical protein PHAVU_006G126100g             255   8e-80   
ref|XP_007222097.1|  hypothetical protein PRUPE_ppa005644mg             255   8e-80   
gb|AIC33036.1|  beta-tubulin                                            250   9e-80   
sp|P18025.1|TBB1_MAIZE  RecName: Full=Tubulin beta-1 chain; AltNa...    254   9e-80   
gb|EPS63676.1|  beta-tubulin                                            254   9e-80   
ref|XP_008221256.1|  PREDICTED: tubulin beta chain-like                 255   9e-80   
ref|XP_010509706.1|  PREDICTED: tubulin beta chain-like                 254   1e-79   
emb|CDX84283.1|  BnaC04g10450D                                          254   1e-79   
gb|AEG89522.1|  tubulin beta-6                                          254   1e-79   
gb|AGH08230.1|  beta-tubulin 7                                          254   1e-79   
ref|XP_004294235.1|  PREDICTED: tubulin beta chain                      254   1e-79   
gb|KDP23866.1|  hypothetical protein JCGZ_27135                         254   1e-79   
ref|XP_010101838.1|  Tubulin beta-1 chain                               254   1e-79   
ref|XP_010459680.1|  PREDICTED: tubulin beta-5 chain                    254   1e-79   
ref|XP_008377144.1|  PREDICTED: tubulin beta chain                      254   1e-79   



>emb|CBI32808.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  88   GIMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGR  267
            G MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGR
Sbjct  20   GKMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGR  79

Query  268  FVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLD  447
            FVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLD
Sbjct  80   FVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLD  139

Query  448  VVRKEAENSDCL  483
            VVRKEAEN DCL
Sbjct  140  VVRKEAENCDCL  151



>emb|CAL46265.1| beta-tubulin 6 [Oryza sativa Indica Group]
Length=138

 Score =   268 bits (686),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010673063.1| PREDICTED: tubulin beta-6 chain isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=464

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 137/149 (92%), Gaps = 3/149 (2%)
 Frame = +1

Query  37   SLSNPRLIVRLLPIF*RGIMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSD  216
            SL+NP       P F  G MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSD
Sbjct  4    SLTNPSFND---PSFHLGKMREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSD  60

Query  217  LQLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNW  396
            LQLERVNVYYNEASCGRFVPRAVLMDLEPGTMD+VRTGPYGQIFRPDNFVFGQSGAGNNW
Sbjct  61   LQLERVNVYYNEASCGRFVPRAVLMDLEPGTMDAVRTGPYGQIFRPDNFVFGQSGAGNNW  120

Query  397  AKGHYTEGAELIDSVLDVVRKEAENSDCL  483
            AKGHYTEGAELIDSVLDVVRKEAEN DCL
Sbjct  121  AKGHYTEGAELIDSVLDVVRKEAENCDCL  149



>gb|EYU18601.1| hypothetical protein MIMGU_mgv1a005215mg [Erythranthe guttata]
Length=493

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  22   STSHFSLSNPRLIVRLLPIF*RGIMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY  201
            S   FSL +  L   +     RG MREILH+QGGQCGNQIGSKFWEVVCDEHGID TGRY
Sbjct  23   SCRQFSLYHSSLRFSVFESRFRGKMREILHIQGGQCGNQIGSKFWEVVCDEHGIDQTGRY  82

Query  202  VGTSDLQLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSG  381
            VGTSDLQLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSG
Sbjct  83   VGTSDLQLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSG  142

Query  382  AGNNWAKGHYTEGAELIDSVLDVVRKEAENSDCL  483
            AGNNWAKGHYTEGAELIDSVLDVVRKEAEN DCL
Sbjct  143  AGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCL  176



>gb|KHG13886.1| Tubulin beta-3 chain [Gossypium arboreum]
Length=221

 Score =   269 bits (688),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CDP06213.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   278 bits (712),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +1

Query  85   RGIMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCG  264
            +G MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCG
Sbjct  95   KGKMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCG  154

Query  265  RFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL  444
            RFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL
Sbjct  155  RFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL  214

Query  445  DVVRKEAENSDCL  483
            DVVRKEAEN DCL
Sbjct  215  DVVRKEAENCDCL  227



>ref|XP_002283056.1| PREDICTED: tubulin beta-5 chain [Vitis vinifera]
 emb|CAN64894.1| hypothetical protein VITISV_029111 [Vitis vinifera]
Length=447

 Score =   275 bits (704),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/130 (99%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011079080.1| PREDICTED: tubulin beta-5 chain-like [Sesamum indicum]
 ref|XP_011079081.1| PREDICTED: tubulin beta-5 chain-like [Sesamum indicum]
Length=446

 Score =   275 bits (704),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/130 (99%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003568202.1| PREDICTED: tubulin beta-5 chain-like [Brachypodium distachyon]
Length=447

 Score =   275 bits (704),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>tpg|DAA54230.1| TPA: hypothetical protein ZEAMMB73_283964, partial [Zea mays]
Length=427

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011075465.1| PREDICTED: tubulin beta-5 chain isoform X2 [Sesamum indicum]
Length=447

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/130 (99%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>sp|Q9ZRA8.1|TBB5_WHEAT RecName: Full=Tubulin beta-5 chain; AltName: Full=Beta-5-tubulin 
[Triticum aestivum]
 gb|AAD10492.1| beta-tubulin 5 [Triticum aestivum]
 emb|CAM58982.1| beta tubulin 4 [Hordeum vulgare subsp. vulgare]
 gb|EMT33709.1| Tubulin beta-5 chain [Aegilops tauschii]
Length=447

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003567397.1| PREDICTED: tubulin beta-4 chain [Brachypodium distachyon]
Length=446

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001105458.1| tubulin beta-5 chain [Zea mays]
 ref|XP_008673433.1| PREDICTED: tubulin beta-5 chain isoform X1 [Zea mays]
 sp|Q43697.1|TBB5_MAIZE RecName: Full=Tubulin beta-5 chain; AltName: Full=Beta-5-tubulin 
[Zea mays]
 emb|CAA52720.1| beta-5 tubulin [Zea mays]
 tpg|DAA54227.1| TPA: tubulin beta-8 chain isoform 1 [Zea mays]
 tpg|DAA54228.1| TPA: tubulin beta-8 chain isoform 2 [Zea mays]
 tpg|DAA54229.1| TPA: tubulin beta-8 chain isoform 3 [Zea mays]
Length=445

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004967662.1| PREDICTED: tubulin beta-5 chain-like [Setaria italica]
Length=445

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003568451.1| PREDICTED: tubulin beta-2 chain [Brachypodium distachyon]
Length=444

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CAM58984.1| beta tubulin 6 [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>sp|Q9ZPN7.1|TBB4_ELEIN RecName: Full=Tubulin beta-4 chain; AltName: Full=Beta-4-tubulin 
[Eleusine indica]
 gb|AAD20181.1| beta-tubulin 4 [Eleusine indica]
Length=446

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AFW79504.1| hypothetical protein ZEAMMB73_908177, partial [Zea mays]
Length=447

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011075464.1| PREDICTED: tubulin beta-5 chain isoform X1 [Sesamum indicum]
Length=456

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/130 (99%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  10   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  69

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  70   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  129

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  130  RKEAENCDCL  139



>sp|Q9ZRB2.1|TBB1_WHEAT RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin 
[Triticum aestivum]
 gb|AAD10487.1| beta-tubulin 1 [Triticum aestivum]
Length=445

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006644071.1| PREDICTED: tubulin beta-1 chain-like [Oryza brachyantha]
Length=447

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_008654521.1| PREDICTED: uncharacterized protein LOC100272336 isoform X1 [Zea 
mays]
 ref|XP_008654522.1| PREDICTED: uncharacterized protein LOC100272336 isoform X1 [Zea 
mays]
 gb|AFW79501.1| hypothetical protein ZEAMMB73_908177 [Zea mays]
 gb|AFW79502.1| hypothetical protein ZEAMMB73_908177 [Zea mays]
 gb|AFW79503.1| hypothetical protein ZEAMMB73_908177 [Zea mays]
Length=444

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004249322.1| PREDICTED: tubulin beta-5 chain [Solanum lycopersicum]
Length=447

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001042761.1| Os01g0282800 [Oryza sativa Japonica Group]
 sp|Q43594.2|TBB1_ORYSJ RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAB39951.1| putative tubulin beta-4 chain [Oryza sativa Japonica Group]
 dbj|BAB64211.1| putative beta-tubulin 4 [Oryza sativa Japonica Group]
 dbj|BAF04675.1| Os01g0282800 [Oryza sativa Japonica Group]
 gb|EAY73543.1| hypothetical protein OsI_01426 [Oryza sativa Indica Group]
 dbj|BAH00806.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AFR42145.1| beta-tubulin, partial [Populus alba]
 gb|AFR42157.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42160.1| beta-tubulin, partial [Populus fremontii]
Length=131

 Score =   264 bits (674),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009588441.1| PREDICTED: tubulin beta-1 chain [Nicotiana tomentosiformis]
 ref|XP_009769578.1| PREDICTED: tubulin beta-1 chain [Nicotiana sylvestris]
Length=447

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|ABK95893.1| unknown [Populus trichocarpa]
Length=446

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTG+YVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AFR42136.1| beta-tubulin, partial [Populus trichocarpa]
 gb|AFR42138.1| beta-tubulin, partial [Populus trichocarpa]
 gb|AFR42139.1| beta-tubulin, partial [Populus trichocarpa]
 gb|AFR42140.1| beta-tubulin, partial [Populus alba]
 gb|AFR42141.1| beta-tubulin, partial [Populus alba]
 gb|AFR42142.1| beta-tubulin, partial [Populus alba]
 gb|AFR42143.1| beta-tubulin, partial [Populus alba]
 gb|AFR42144.1| beta-tubulin, partial [Populus alba]
 gb|AFR42146.1| beta-tubulin, partial [Populus alba]
 gb|AFR42147.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42148.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42149.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42150.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42151.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42152.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42153.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42154.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42155.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42158.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42159.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42161.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42162.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42163.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42165.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42166.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42168.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42169.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42170.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42171.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42172.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42173.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42174.1| beta-tubulin, partial [Populus nigra]
Length=138

 Score =   264 bits (674),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010922039.1| PREDICTED: tubulin beta-5 chain [Elaeis guineensis]
 ref|XP_010922040.1| PREDICTED: tubulin beta-5 chain [Elaeis guineensis]
Length=446

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006387232.1| hypothetical protein POPTR_1455s00200g [Populus trichocarpa]
 gb|ERP46146.1| hypothetical protein POPTR_1455s00200g [Populus trichocarpa]
Length=447

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTG+YVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AFR42164.1| beta-tubulin, partial [Populus nigra]
Length=136

 Score =   263 bits (673),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AFR42167.1| beta-tubulin, partial [Populus nigra]
Length=137

 Score =   263 bits (673),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AGH08225.1| beta-tubulin 18 [Salix arbutifolia]
Length=450

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002322609.1| hypothetical protein POPTR_0016s03300g [Populus trichocarpa]
 gb|ABK94896.1| unknown [Populus trichocarpa]
 gb|EEF04370.1| hypothetical protein POPTR_0016s03300g [Populus trichocarpa]
Length=450

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010673064.1| PREDICTED: tubulin beta-6 chain isoform X2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010673065.1| PREDICTED: tubulin beta-6 chain isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=445

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMD+VRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDAVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011036386.1| PREDICTED: tubulin beta-5 chain [Populus euphratica]
Length=447

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTG+YVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001055546.1| Os05g0413200 [Oryza sativa Japonica Group]
 sp|Q76FS3.1|TBB6_ORYSJ RecName: Full=Tubulin beta-6 chain; AltName: Full=Beta-6-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAC82429.1| beta-tubulin [Oryza sativa Japonica Group]
 gb|AAT94032.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAF17460.1| Os05g0413200 [Oryza sativa Japonica Group]
Length=444

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010271905.1| PREDICTED: tubulin beta-1 chain [Nelumbo nucifera]
 ref|XP_010271906.1| PREDICTED: tubulin beta-1 chain [Nelumbo nucifera]
Length=446

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010243823.1| PREDICTED: tubulin beta-4 chain-like [Nelumbo nucifera]
Length=447

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011040743.1| PREDICTED: tubulin beta-5 chain-like [Populus euphratica]
 ref|XP_011040744.1| PREDICTED: tubulin beta-5 chain-like [Populus euphratica]
Length=448

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011041397.1| PREDICTED: tubulin beta-5 chain-like [Populus euphratica]
Length=448

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006836258.1| hypothetical protein AMTR_s00101p00135960 [Amborella trichopoda]
 gb|ERM99111.1| hypothetical protein AMTR_s00101p00135960 [Amborella trichopoda]
Length=398

 Score =   272 bits (696),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+GT DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGTLDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006339255.1| PREDICTED: tubulin beta-1 chain-like [Solanum tuberosum]
Length=447

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDP+GRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPSGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004962088.1| PREDICTED: tubulin beta-2 chain-like [Setaria italica]
Length=446

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMD++RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDAIRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AGH08229.1| beta-tubulin 17 [Salix arbutifolia]
Length=448

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AGZ90159.1| tubulin beta, partial [Litsea cubeba]
Length=446

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006430521.1| hypothetical protein CICLE_v10011719mg [Citrus clementina]
 ref|XP_006430522.1| hypothetical protein CICLE_v10011719mg [Citrus clementina]
 gb|ESR43761.1| hypothetical protein CICLE_v10011719mg [Citrus clementina]
 gb|ESR43762.1| hypothetical protein CICLE_v10011719mg [Citrus clementina]
Length=447

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006482055.1| PREDICTED: tubulin beta-1 chain-like [Citrus sinensis]
 gb|KDO53645.1| hypothetical protein CISIN_1g013154mg [Citrus sinensis]
 gb|KDO53646.1| hypothetical protein CISIN_1g013154mg [Citrus sinensis]
Length=448

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003624926.1| Tubulin beta chain [Medicago truncatula]
 gb|AES81144.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002307960.1| hypothetical protein POPTR_0006s03390g [Populus trichocarpa]
 ref|XP_006380970.1| Tubulin beta-6 chain family protein [Populus trichocarpa]
 gb|EEE91483.1| hypothetical protein POPTR_0006s03390g [Populus trichocarpa]
 gb|ERP58767.1| Tubulin beta-6 chain family protein [Populus trichocarpa]
Length=448

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY+G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001289666.1| tubulin beta-5 chain [Eucalyptus grandis]
 gb|ABS50669.1| beta-tubulin [Eucalyptus grandis]
Length=446

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002523246.1| tubulin beta chain, putative [Ricinus communis]
 gb|EEF39167.1| tubulin beta chain, putative [Ricinus communis]
Length=414

 Score =   272 bits (695),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_008788536.1| PREDICTED: tubulin beta-5 chain-like [Phoenix dactylifera]
Length=446

 Score =   273 bits (698),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDTVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011036385.1| PREDICTED: tubulin beta-1 chain-like [Populus euphratica]
 gb|ABK95958.1| unknown [Populus trichocarpa]
 gb|AGH08236.1| beta-tubulin 14 [Salix arbutifolia]
Length=446

 Score =   273 bits (698),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTG+YVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002314014.2| hypothetical protein POPTR_0009s07150g [Populus trichocarpa]
 gb|EEE87969.2| hypothetical protein POPTR_0009s07150g [Populus trichocarpa]
Length=446

 Score =   273 bits (698),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTG+YVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_007028241.1| Beta-6 tubulin [Theobroma cacao]
 gb|EOY08743.1| Beta-6 tubulin [Theobroma cacao]
Length=445

 Score =   273 bits (697),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|ACM89775.1| beta-tubulin 3 [Gossypium hirsutum]
 gb|KJB46191.1| hypothetical protein B456_007G351900 [Gossypium raimondii]
 gb|KJB46192.1| hypothetical protein B456_007G351900 [Gossypium raimondii]
Length=447

 Score =   273 bits (697),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003624927.1| Tubulin beta chain [Medicago truncatula]
Length=527

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG SDLQLERVNVYYNEASCGRFV
Sbjct  79   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQLERVNVYYNEASCGRFV  138

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  139  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  198

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  199  RKEAENCDCL  208



>emb|CDM85842.1| unnamed protein product [Triticum aestivum]
Length=447

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>sp|Q6VAF8.1|TBB3_GOSHI RecName: Full=Tubulin beta-3 chain; AltName: Full=Beta-3-tubulin 
[Gossypium hirsutum]
 gb|AAQ92664.1| beta-tubulin 3 [Gossypium hirsutum]
Length=430

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004493370.1| PREDICTED: tubulin beta-6 chain-like [Cicer arietinum]
Length=448

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIG+KFWEVVCDEHGIDPTGRYVG SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGTKFWEVVCDEHGIDPTGRYVGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>sp|Q9ZRB1.1|TBB2_WHEAT RecName: Full=Tubulin beta-2 chain; AltName: Full=Beta-2-tubulin 
[Triticum aestivum]
 gb|AAD10488.1| beta-tubulin 2 [Triticum aestivum]
Length=447

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AGH08237.1| beta-tubulin 16 [Salix arbutifolia]
Length=445

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTG+YVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRT PYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTSPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010232467.1| PREDICTED: tubulin beta chain [Brachypodium distachyon]
Length=447

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>sp|P93176.1|TBB_HORVU RecName: Full=Tubulin beta chain; AltName: Full=Beta-tubulin 
[Hordeum vulgare]
 emb|CAA70891.1| beta-tubulin 1 [Hordeum vulgare subsp. vulgare]
 emb|CAM58979.1| beta tubulin 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87463.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92333.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93445.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002456503.1| hypothetical protein SORBIDRAFT_03g037490 [Sorghum bicolor]
 gb|EES01623.1| hypothetical protein SORBIDRAFT_03g037490 [Sorghum bicolor]
Length=447

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010088982.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXB37197.1| Tubulin beta-1 chain [Morus notabilis]
Length=446

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001239638.1| beta-tubulin [Glycine max]
 gb|AAX86048.1| tubulin B4 [Glycine max]
 gb|KHN12167.1| Tubulin beta-5 chain [Glycine soja]
Length=449

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTG+YVG SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>sp|Q9ZPN9.1|TBB2_ELEIN RecName: Full=Tubulin beta-2 chain; AltName: Full=Beta-2-tubulin 
[Eleusine indica]
 gb|AAD20179.1| beta-tubulin 2 [Eleusine indica]
Length=448

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009420971.1| PREDICTED: tubulin beta-4 chain [Musa acuminata subsp. malaccensis]
Length=448

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G+SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGSSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003554108.1| PREDICTED: tubulin beta-4 chain-like [Glycine max]
Length=450

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTG+YVG SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KHN08902.1| Tubulin beta-1 chain [Glycine soja]
Length=449

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTG+YVG SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_007015369.1| Beta-6 tubulin isoform 1 [Theobroma cacao]
 gb|EOY32988.1| Beta-6 tubulin isoform 1 [Theobroma cacao]
Length=450

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY+G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010909062.1| PREDICTED: tubulin beta-1 chain [Elaeis guineensis]
 ref|XP_010909063.1| PREDICTED: tubulin beta-1 chain [Elaeis guineensis]
 ref|XP_010909064.1| PREDICTED: tubulin beta-1 chain [Elaeis guineensis]
Length=447

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001105426.1| tubulin beta-2 chain [Zea mays]
 sp|P18026.1|TBB2_MAIZE RecName: Full=Tubulin beta-2 chain; AltName: Full=Beta-2-tubulin 
[Zea mays]
 emb|CAA37061.1| unnamed protein product [Zea mays]
 gb|AFW81928.1| beta tubulin2 [Zea mays]
Length=444

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY+GTSD+QLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYMGTSDVQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMD+VRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDAVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_008798348.1| PREDICTED: tubulin beta-1 chain [Phoenix dactylifera]
Length=448

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010536143.1| PREDICTED: tubulin beta-4 chain [Tarenaya hassleriana]
 ref|XP_010536144.1| PREDICTED: tubulin beta-4 chain [Tarenaya hassleriana]
Length=449

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002270069.1| PREDICTED: tubulin beta-4 chain [Vitis vinifera]
Length=446

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|EMT00232.1| Tubulin beta-2 chain [Aegilops tauschii]
Length=466

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  20   MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  79

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  80   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  139

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  140  RKEAENCDCL  149



>sp|Q41785.1|TBB8_MAIZE RecName: Full=Tubulin beta-8 chain; AltName: Full=Beta-8-tubulin 
[Zea mays]
 gb|AAA19709.1| beta-8 tubulin [Zea mays]
Length=445

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            P AVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PGAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010909929.1| PREDICTED: tubulin beta-1 chain-like [Elaeis guineensis]
 ref|XP_010909930.1| PREDICTED: tubulin beta-1 chain-like [Elaeis guineensis]
 ref|XP_010909931.1| PREDICTED: tubulin beta-1 chain-like [Elaeis guineensis]
Length=446

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006387289.1| hypothetical protein POPTR_1327s00200g [Populus trichocarpa]
 gb|ERP46203.1| hypothetical protein POPTR_1327s00200g [Populus trichocarpa]
Length=273

 Score =   266 bits (679),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006649228.1| PREDICTED: tubulin beta-2 chain-like [Oryza brachyantha]
Length=447

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006644872.1| PREDICTED: tubulin beta-4 chain-like [Oryza brachyantha]
Length=448

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KDP36971.1| hypothetical protein JCGZ_08563 [Jatropha curcas]
Length=447

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002523247.1| tubulin beta chain, putative [Ricinus communis]
 gb|EEF39168.1| tubulin beta chain, putative [Ricinus communis]
Length=446

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|EYU20815.1| hypothetical protein MIMGU_mgv1a006356mg [Erythranthe guttata]
Length=447

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC+EHGIDPTGRYVGTSD+Q+ERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCEEHGIDPTGRYVGTSDVQIERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_008227321.1| PREDICTED: tubulin beta-4 chain [Prunus mume]
Length=448

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGT D+QLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTKDVQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|ADE76978.1| unknown [Picea sitchensis]
Length=445

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYQGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|ABK92780.1| unknown [Populus trichocarpa]
Length=448

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY+G+SDLQLERVN YYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGSSDLQLERVNEYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CAA55022.1| beta tubulin [Oryza sativa Japonica Group]
Length=447

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AAA66495.1| beta-tubulin [Oryza sativa]
Length=447

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006826860.1| hypothetical protein AMTR_s00010p00119100 [Amborella trichopoda]
 gb|ERM94097.1| hypothetical protein AMTR_s00010p00119100 [Amborella trichopoda]
Length=447

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SD+QLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDIQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001105317.1| tubulin beta-6 chain [Zea mays]
 ref|XP_008673429.1| PREDICTED: tubulin beta-6 chain isoform X1 [Zea mays]
 sp|Q41783.1|TBB6_MAIZE RecName: Full=Tubulin beta-6 chain; AltName: Full=Beta-6-tubulin 
[Zea mays]
 gb|AAA20186.1| beta-6 tubulin [Zea mays]
 gb|ACL53189.1| unknown [Zea mays]
 tpg|DAA57200.1| TPA: beta tubulin6 isoform 1 [Zea mays]
 tpg|DAA57201.1| TPA: beta tubulin6 isoform 2 [Zea mays]
Length=446

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>tpg|DAA57202.1| TPA: beta tubulin6 [Zea mays]
Length=488

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +1

Query  85   RGIMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCG  264
            R  MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCG
Sbjct  40   RAKMREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCG  99

Query  265  RFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL  444
            RFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL
Sbjct  100  RFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL  159

Query  445  DVVRKEAENSDCL  483
            DVVRKEAEN DCL
Sbjct  160  DVVRKEAENCDCL  172



>ref|NP_001044565.1| Os01g0805900 [Oryza sativa Japonica Group]
 sp|P45960.1|TBB4_ORYSJ RecName: Full=Tubulin beta-4 chain; AltName: Full=Beta-4-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAA06381.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAB92274.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAF06479.1| Os01g0805900 [Oryza sativa Japonica Group]
 dbj|BAG93002.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009403832.1| PREDICTED: tubulin beta-1 chain-like [Musa acuminata subsp. malaccensis]
Length=447

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTG+Y GTSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGQYTGTSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>pir||JC2510 beta-tubulin R1623 - rice
Length=446

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001167651.1| uncharacterized protein LOC100381281 [Zea mays]
 ref|XP_008673428.1| PREDICTED: tubulin beta-6 chain isoform X2 [Zea mays]
 gb|ACF85464.1| unknown [Zea mays]
 tpg|DAA57203.1| TPA: beta tubulin6 isoform 1 [Zea mays]
 tpg|DAA57204.1| TPA: beta tubulin6 isoform 2 [Zea mays]
Length=496

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  51   MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  110

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  111  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  170

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  171  RKEAENCDCL  180



>ref|XP_007201980.1| hypothetical protein PRUPE_ppa004851mg [Prunus persica]
 gb|EMJ03179.1| hypothetical protein PRUPE_ppa004851mg [Prunus persica]
Length=488

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGT D+QLERVNVYYNEASCGRFV
Sbjct  43   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTKDVQLERVNVYYNEASCGRFV  102

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  103  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  162

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  163  RKEAENCDCL  172



>ref|XP_007015368.1| Beta-6 tubulin isoform 2 [Theobroma cacao]
 gb|EOY32987.1| Beta-6 tubulin isoform 2 [Theobroma cacao]
Length=460

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_007015367.1| Beta-6 tubulin isoform 1 [Theobroma cacao]
 gb|EOY32986.1| Beta-6 tubulin isoform 1 [Theobroma cacao]
Length=447

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_008450322.1| PREDICTED: tubulin beta-6 chain [Cucumis melo]
 ref|XP_008450323.1| PREDICTED: tubulin beta-6 chain [Cucumis melo]
Length=447

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEV+CDEHGIDPTGRY GTSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVLCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010419814.1| PREDICTED: tubulin beta-6 chain-like [Camelina sativa]
Length=449

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_196786.1| beta-6 tubulin [Arabidopsis thaliana]
 ref|XP_002873559.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 sp|P29514.1|TBB6_ARATH RecName: Full=Tubulin beta-6 chain; AltName: Full=Beta-6-tubulin 
[Arabidopsis thaliana]
 gb|AAK25970.1|AF360260_1 putative tubulin beta-6 chain [Arabidopsis thaliana]
 gb|AAA32884.1| beta-6 tubulin [Arabidopsis thaliana]
 dbj|BAB10043.1| tubulin beta-6 chain [Arabidopsis thaliana]
 gb|AAK64132.1| putative tubulin beta-6 chain [Arabidopsis thaliana]
 gb|EFH49818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|AED91783.1| beta-6 tubulin [Arabidopsis thaliana]
Length=449

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006289933.1| hypothetical protein CARUB_v10003555mg [Capsella rubella]
 ref|XP_010453291.1| PREDICTED: tubulin beta-6 chain [Camelina sativa]
 gb|EOA22831.1| hypothetical protein CARUB_v10003555mg [Capsella rubella]
Length=449

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CAE52516.1| beta tubulin [Setaria viridis]
Length=448

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009393896.1| PREDICTED: tubulin beta chain [Musa acuminata subsp. malaccensis]
Length=446

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYG+IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGRIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004139067.1| PREDICTED: tubulin beta-2 chain-like [Cucumis sativus]
 ref|XP_004154657.1| PREDICTED: tubulin beta-2 chain-like [Cucumis sativus]
 gb|KGN66563.1| hypothetical protein Csa_1G629200 [Cucumis sativus]
Length=447

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEV+CDEHGIDPTGRY GTSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVLCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004970293.1| PREDICTED: LOW QUALITY PROTEIN: tubulin beta-4 chain-like [Setaria 
italica]
Length=498

 Score =   272 bits (695),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  51   MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  110

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  111  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  170

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  171  RKEAENCDCL  180



>ref|XP_010491982.1| PREDICTED: tubulin beta-6 chain-like [Camelina sativa]
Length=449

 Score =   270 bits (691),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AGH08240.1| beta-tubulin 15 [Salix arbutifolia]
Length=445

 Score =   270 bits (691),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KDP21557.1| hypothetical protein JCGZ_03665 [Jatropha curcas]
Length=447

 Score =   270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTG+YVG+SDLQLERVNVY+NEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGSSDLQLERVNVYFNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KJB09278.1| hypothetical protein B456_001G132500 [Gossypium raimondii]
 gb|KJB09279.1| hypothetical protein B456_001G132500 [Gossypium raimondii]
Length=447

 Score =   270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G S LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSSLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AGH08239.1| beta-tubulin 13 [Salix arbutifolia]
Length=447

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|ABY86657.1| beta-tubulin 10 [Gossypium hirsutum]
Length=447

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY G S LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSSLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|EEC79224.1| hypothetical protein OsI_19960 [Oryza sativa Indica Group]
Length=624

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  181  MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQLERVNVYYNEASCGRFV  240

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  241  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  300

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  301  RKEAENCDCL  310



>gb|EEE63725.1| hypothetical protein OsJ_18543 [Oryza sativa Japonica Group]
Length=624

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  181  MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQLERVNVYYNEASCGRFV  240

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  241  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  300

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  301  RKEAENCDCL  310



>gb|EEC71666.1| hypothetical protein OsI_04129 [Oryza sativa Indica Group]
Length=496

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  50   MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  109

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  110  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  169

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  170  RKEAENCDCL  179



>ref|XP_009404699.1| PREDICTED: tubulin beta-1 chain [Musa acuminata subsp. malaccensis]
Length=447

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGTYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AIS84173.1| beta-tubulin 6b [Linum usitatissimum]
Length=448

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GT+D+QLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTTDVQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AIS84172.1| beta-tubulin 6a [Linum usitatissimum]
Length=446

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GT+D+QLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTTDVQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001168511.1| hypothetical protein [Zea mays]
 gb|ACN28480.1| unknown [Zea mays]
 gb|AFW84813.1| hypothetical protein ZEAMMB73_647337 [Zea mays]
 gb|AFW84814.1| hypothetical protein ZEAMMB73_647337 [Zea mays]
Length=448

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGID TGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDTTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006399740.1| hypothetical protein EUTSA_v10013524mg [Eutrema salsugineum]
 dbj|BAJ34332.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41193.1| hypothetical protein EUTSA_v10013524mg [Eutrema salsugineum]
Length=450

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010274718.1| PREDICTED: tubulin beta-6 chain-like [Nelumbo nucifera]
Length=449

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYNGTSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYG+IFRPDNF+FGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGKIFRPDNFIFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CDX69693.1| BnaA10g20420D [Brassica napus]
Length=461

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGR+V
Sbjct  14   MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRYV  73

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  74   PRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  133

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  134  RKEAENCDCL  143



>ref|XP_009121863.1| PREDICTED: tubulin beta-6 chain [Brassica rapa]
Length=448

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002298455.1| hypothetical protein POPTR_0001s27960g [Populus trichocarpa]
 ref|XP_011025005.1| PREDICTED: tubulin beta-4 chain-like [Populus euphratica]
 gb|EEE83260.1| hypothetical protein POPTR_0001s27960g [Populus trichocarpa]
Length=445

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009401585.1| PREDICTED: tubulin beta-1 chain-like [Musa acuminata subsp. malaccensis]
Length=447

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIG+KFWEVVCDEHGID TGRY+G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCDEHGIDATGRYIGKSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006654403.1| PREDICTED: tubulin beta-1 chain-like [Oryza brachyantha]
Length=445

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGID TGRYVGTS+LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDTTGRYVGTSELQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFG+SGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGRSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|ACG32188.1| tubulin beta-4 chain [Zea mays]
Length=446

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
             KEAEN DCL
Sbjct  121  MKEAENCDCL  130



>ref|XP_010673793.1| PREDICTED: tubulin beta-4 chain [Beta vulgaris subsp. vulgaris]
Length=446

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYSGSSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CDX97180.1| BnaC09g44450D [Brassica napus]
Length=481

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEASCGR+V
Sbjct  34   MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRYV  93

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  94   PRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  153

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  154  RKEAENCDCL  163



>gb|AFW84815.1| hypothetical protein ZEAMMB73_647337, partial [Zea mays]
Length=476

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGID TGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDTTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|EMS63710.1| Tubulin beta-2 chain [Triticum urartu]
Length=626

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVCDEHGIDPTGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  220  MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  279

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  280  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  339

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  340  RKEAENCDCL  349



>ref|XP_010521570.1| PREDICTED: tubulin beta-5 chain-like [Tarenaya hassleriana]
 ref|XP_010521572.1| PREDICTED: tubulin beta-5 chain-like [Tarenaya hassleriana]
Length=448

 Score =   268 bits (684),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRY GTSDLQLERVNVY+NEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQLERVNVYFNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN D L
Sbjct  121  RKEAENCDSL  130



>ref|XP_010036380.1| PREDICTED: tubulin beta-1 chain-like [Eucalyptus grandis]
 gb|KCW47927.1| hypothetical protein EUGRSUZ_K01666 [Eucalyptus grandis]
Length=449

 Score =   268 bits (684),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTG Y+GTS+LQLERVNVY+NEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGHYIGTSELQLERVNVYFNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRTGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_008790003.1| PREDICTED: tubulin beta-1 chain-like [Phoenix dactylifera]
Length=446

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVCDEHGI+PTG Y G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGINPTGSYTGNSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>dbj|BAC42563.1| putative tubulin beta-6 chain [Arabidopsis thaliana]
Length=449

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMD+VRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAILMDLEPGTMDNVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAE+ DCL
Sbjct  121  RKEAEDCDCL  130



>gb|KDP23921.1| hypothetical protein JCGZ_27081 [Jatropha curcas]
Length=354

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQ+ERVNVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQIERVNVYYNEASNGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011025004.1| PREDICTED: tubulin beta-4 chain-like [Populus euphratica]
Length=447

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G+S+LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSELQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>dbj|BAP59013.1| beta tubulin [Taxus cuspidata]
Length=449

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIGSKFWEVVC+EHGID TGRY GTSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCEEHGIDHTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003604816.1| Tubulin beta chain [Medicago truncatula]
 gb|AES87013.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   266 bits (679),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY GTS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYSGTSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAILMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AAK32919.1|AF367332_1 AT5g62700/MRG21_12 [Arabidopsis thaliana]
 gb|AAM16247.1| AT5g62700/MRG21_12 [Arabidopsis thaliana]
Length=353

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001048679.2| Os03g0105600 [Oryza sativa Japonica Group]
 dbj|BAF10593.2| Os03g0105600 [Oryza sativa Japonica Group]
Length=133

 Score =   254 bits (649),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYDGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|ACJ84610.1| unknown [Medicago truncatula]
Length=449

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRYVG SDLQLER+NVYYNEAS GRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYVGDSDLQLERINVYYNEASGGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAENSDCL
Sbjct  121  RKEAENSDCL  130



>ref|XP_003604818.1| Tubulin beta chain [Medicago truncatula]
 gb|AES87015.1| tubulin beta-1 chain [Medicago truncatula]
 gb|AFK47888.1| unknown [Medicago truncatula]
Length=449

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRYVG SDLQLER+NVYYNEAS GRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYVGDSDLQLERINVYYNEASGGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAENSDCL
Sbjct  121  RKEAENSDCL  130



>gb|KFK34015.1| hypothetical protein AALP_AA5G090900 [Arabis alpina]
Length=450

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRYVG SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYVGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KFK28005.1| hypothetical protein AALP_AA8G459200 [Arabis alpina]
Length=450

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRYVG SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYVGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002321512.2| hypothetical protein POPTR_0015s04560g [Populus trichocarpa]
 gb|EEF05639.2| hypothetical protein POPTR_0015s04560g [Populus trichocarpa]
Length=444

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTG+Y+G +DLQLERVNVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGQYIGKTDLQLERVNVYYNEASNGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KHG21955.1| Tubulin beta-8 chain -like protein [Gossypium arboreum]
Length=241

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010926477.1| PREDICTED: tubulin beta-5 chain-like [Elaeis guineensis]
Length=446

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDP+GRY G S LQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPSGRYTGNSPLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYG+IFRPDNFVFGQSGAGNNWAKGHYTEGAEL+DSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGKIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004234396.1| PREDICTED: tubulin beta-1 chain [Solanum lycopersicum]
Length=445

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYKGESDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSV+DVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVMDVV  120

Query  454  RKEAENSDCL  483
            RKEAENSDCL
Sbjct  121  RKEAENSDCL  130



>gb|KHG16112.1| Tubulin beta-1 chain [Gossypium arboreum]
Length=227

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011009715.1| PREDICTED: tubulin beta chain-like [Populus euphratica]
Length=444

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTG+Y+G +DLQLERVNVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGQYIGKTDLQLERVNVYYNEASNGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006353299.1| PREDICTED: tubulin beta-1 chain-like isoform X1 [Solanum tuberosum]
 ref|XP_006353300.1| PREDICTED: tubulin beta-1 chain-like isoform X2 [Solanum tuberosum]
Length=447

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYKGESDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSV+DVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVMDVV  120

Query  454  RKEAENSDCL  483
            RKEAENSDCL
Sbjct  121  RKEAENSDCL  130



>ref|XP_006404432.1| hypothetical protein EUTSA_v10010368mg [Eutrema salsugineum]
 ref|XP_006404433.1| hypothetical protein EUTSA_v10010369mg [Eutrema salsugineum]
 dbj|BAJ33671.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45885.1| hypothetical protein EUTSA_v10010368mg [Eutrema salsugineum]
 gb|ESQ45886.1| hypothetical protein EUTSA_v10010369mg [Eutrema salsugineum]
Length=449

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY+G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYIGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AGN95064.1| putative tubulin beta-2-like protein [Physaria fendleri]
Length=450

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY+G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYIGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010908105.1| PREDICTED: tubulin beta-2 chain-like [Elaeis guineensis]
Length=447

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY+G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDATGRYLGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KHG02753.1| Tubulin beta-2/beta-3 chain -like protein [Gossypium arboreum]
Length=237

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G  DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCSEHGIDPTGRYQGDLDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_008804937.1| PREDICTED: tubulin beta-2 chain [Phoenix dactylifera]
Length=446

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY+G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYLGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010521908.1| PREDICTED: tubulin beta-2 chain-like [Tarenaya hassleriana]
 gb|ABW81102.1| BTub-1 [Cleome spinosa]
Length=448

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTGRY G SDLQLERVNVYYNEASCGR V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGRYHGDSDLQLERVNVYYNEASCGRLV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAILMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AIZ74332.1| beta-tubulin [Pinus massoniana]
Length=446

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTG Y GT+D+QLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGSYQGTTDIQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>tpg|DAA51373.1| TPA: hypothetical protein ZEAMMB73_041268 [Zea mays]
Length=176

 Score =   254 bits (649),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEV+CDEHGID TGRY G SDLQLERVNVYYNEAS GRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDATGRYAGDSDLQLERVNVYYNEASGGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CDY21784.1| BnaA06g20530D [Brassica napus]
 emb|CDX99087.1| BnaA06g17780D [Brassica napus]
Length=427

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006657241.1| PREDICTED: tubulin beta-3 chain-like, partial [Oryza brachyantha]
Length=132

 Score =   253 bits (645),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEV+CDEHGID TG+Y G SDLQLER+NVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQLERINVYYNEASGGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|EYU38358.1| hypothetical protein MIMGU_mgv1a007077mg [Erythranthe guttata]
Length=420

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDSTGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KHG25436.1| Tubulin beta-8 chain -like protein [Gossypium arboreum]
Length=280

 Score =   258 bits (658),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TG+Y G SDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGKYHGDSDLQLERINVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KHG21113.1| Tubulin beta-9 chain [Gossypium arboreum]
Length=221

 Score =   256 bits (653),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREI+HVQGGQCGNQIG+KFWEVVC EHGID TGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREIVHVQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKE+EN DCL
Sbjct  121  RKESENCDCL  130



>ref|NP_568959.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 ref|NP_568960.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 sp|Q56YW9.2|TBB2_ARATH RecName: Full=Tubulin beta-2 chain [Arabidopsis thaliana]
 sp|Q9ASR0.2|TBB3_ARATH RecName: Full=Tubulin beta-3 chain [Arabidopsis thaliana]
 gb|AAA32881.1| beta-2 tubulin [Arabidopsis thaliana]
 gb|AAA32882.1| beta-3 tubulin [Arabidopsis thaliana]
 dbj|BAA97216.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 dbj|BAB10838.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAL08267.1| AT5g62690/MRG21_11 [Arabidopsis thaliana]
 gb|AAL31181.1| AT5g62700/MRG21_12 [Arabidopsis thaliana]
 gb|AAL32692.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAL32820.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAM65411.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAM91185.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 dbj|BAC42096.1| putative tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAO00947.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AED97643.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AED97644.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
Length=450

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002877519.1| tubulin beta-2 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010503303.1| PREDICTED: tubulin beta-2 chain-like [Camelina sativa]
 gb|EFH53778.1| tubulin beta-2 [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009149954.1| PREDICTED: tubulin beta-2 chain-like [Brassica rapa]
Length=449

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001289924.1| tubulin beta-2 chain [Camelina sativa]
 ref|XP_009150241.1| PREDICTED: tubulin beta-2 chain [Brassica rapa]
 ref|XP_009151388.1| PREDICTED: tubulin beta-2 chain [Brassica rapa]
 ref|XP_010515012.1| PREDICTED: tubulin beta-2 chain [Camelina sativa]
 ref|XP_010444122.1| PREDICTED: tubulin beta-2 chain [Camelina sativa]
 gb|AID81896.1| tubulin [Camelina sativa]
 emb|CDY38073.1| BnaC03g75120D [Brassica napus]
 emb|CDY00319.1| BnaA06g22200D [Brassica napus]
 emb|CDX86102.1| BnaC03g56170D [Brassica napus]
 emb|CDX84345.1| BnaC03g51550D [Brassica napus]
Length=450

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010459234.1| PREDICTED: tubulin beta-2 chain-like [Camelina sativa]
Length=451

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KFK44234.1| hypothetical protein AALP_AA1G232100 [Arabis alpina]
Length=449

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEV+CDE GID TGRYVG SDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVICDEQGIDQTGRYVGDSDLQLERINVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006291122.1| hypothetical protein CARUB_v10017235mg [Capsella rubella]
 ref|XP_006292748.1| hypothetical protein CARUB_v10018995mg [Capsella rubella]
 gb|EOA24020.1| hypothetical protein CARUB_v10017235mg [Capsella rubella]
 gb|EOA25646.1| hypothetical protein CARUB_v10018995mg [Capsella rubella]
Length=451

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002864813.1| tubulin beta-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41072.1| tubulin beta-2 [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AGQ43300.1| TUBB3, partial [Oryza nivara]
 gb|AGQ43301.1| TUBB3, partial [Oryza rufipogon]
 gb|AGQ43302.1| TUBB3, partial [Oryza glumipatula]
 gb|AGQ43303.1| TUBB3, partial [Oryza longistaminata]
 gb|AGQ43304.1| TUBB3, partial [Oryza barthii]
 gb|AGQ43305.1| TUBB3, partial [Oryza meridionalis]
 gb|AGQ43306.1| TUBB3, partial [Oryza glaberrima]
 gb|AGQ43307.1| TUBB3, partial [Oryza sativa Indica Group]
 gb|AGQ43308.1| TUBB3, partial [Oryza sativa Japonica Group]
 gb|AGQ43309.1| TUBB3, partial [Oryza punctata]
 gb|AGQ43310.1| TUBB3, partial [Oryza officinalis]
 gb|AGQ43311.1| TUBB3, partial [Oryza australiensis]
Length=145

 Score =   253 bits (645),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEV+CDEHGID TG+Y G SDLQLER+NVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQLERINVYYNEASGGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010542657.1| PREDICTED: tubulin beta-2 chain-like [Tarenaya hassleriana]
Length=448

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLERVNVYYNEASCGR V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYQGDSDLQLERVNVYYNEASCGRLV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004506645.1| PREDICTED: tubulin beta-2 chain-like [Cicer arietinum]
Length=448

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRYVG S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYVGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CDX88051.1| BnaA06g26420D [Brassica napus]
Length=426

 Score =   262 bits (670),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGESDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CDY67078.1| BnaAnng23580D, partial [Brassica napus]
Length=394

 Score =   261 bits (667),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GP+GQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPFGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010483981.1| PREDICTED: tubulin beta-2 chain-like [Camelina sativa]
Length=451

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_007133955.1| hypothetical protein PHAVU_010G006400g [Phaseolus vulgaris]
 gb|ESW05949.1| hypothetical protein PHAVU_010G006400g [Phaseolus vulgaris]
Length=449

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|ACU22866.1| unknown [Glycine max]
Length=381

 Score =   261 bits (666),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009150568.1| PREDICTED: tubulin beta-2 chain-like [Brassica rapa]
Length=449

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010255421.1| PREDICTED: tubulin beta-2 chain [Nelumbo nucifera]
 ref|XP_010255422.1| PREDICTED: tubulin beta-2 chain [Nelumbo nucifera]
Length=446

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CDX80390.1| BnaC07g30540D [Brassica napus]
Length=449

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGESDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009150907.1| PREDICTED: tubulin beta-8 chain [Brassica rapa]
Length=449

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGESDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010557230.1| PREDICTED: tubulin beta-2 chain-like [Tarenaya hassleriana]
Length=448

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G SDLQLER+NVYYNEASCGR V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYHGDSDLQLERINVYYNEASCGRIV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003516925.1| PREDICTED: tubulin beta-2 chain-like [Glycine max]
Length=449

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003520939.1| PREDICTED: tubulin beta-2 chain-like [Glycine max]
Length=449

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CAM58986.1| beta tubulin 8 [Hordeum vulgare subsp. vulgare]
 dbj|BAK00571.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50212.1| Tubulin beta-2 chain [Triticum urartu]
Length=447

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYAGDTDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGGIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006827680.1| hypothetical protein AMTR_s00009p00255970 [Amborella trichopoda]
 gb|ERM95096.1| hypothetical protein AMTR_s00009p00255970 [Amborella trichopoda]
Length=446

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDSTGRYHGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002271992.1| PREDICTED: tubulin beta-2 chain [Vitis vinifera]
Length=447

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004158094.1| PREDICTED: tubulin beta chain-like [Cucumis sativus]
Length=178

 Score =   253 bits (646),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEV+CDEHGID TG+Y G S+LQLER+NVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSELQLERINVYYNEASGGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006429261.1| hypothetical protein CICLE_v10011723mg [Citrus clementina]
 gb|ESR42501.1| hypothetical protein CICLE_v10011723mg [Citrus clementina]
 gb|KDO58028.1| hypothetical protein CISIN_1g013335mg [Citrus sinensis]
Length=445

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G +DLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYQGDTDLQLERINVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|EMT08428.1| Tubulin beta-1 chain [Aegilops tauschii]
Length=448

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYAGDTDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGGIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_008782284.1| PREDICTED: tubulin beta-6 chain-like [Phoenix dactylifera]
Length=446

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDP+GRY G S LQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPSGRYTGNSLLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVRTGPYG+IFRPDNFVFGQSGAGNNWAKGHYTEGAEL+D+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGKIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDTVLDVV  120

Query  454  RKEAENSDCL  483
            R+EAEN DCL
Sbjct  121  RREAENCDCL  130



>gb|AGE44289.1| beta-tubulin [Dimocarpus longan]
Length=446

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY GT++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGTNELQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006404194.1| hypothetical protein EUTSA_v10010366mg [Eutrema salsugineum]
 gb|ESQ45647.1| hypothetical protein EUTSA_v10010366mg [Eutrema salsugineum]
Length=451

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAILMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002282157.1| PREDICTED: tubulin beta chain [Vitis vinifera]
Length=445

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY G SDLQLERVNVYYNEA  GRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEAGGGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRTGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKE EN DCL
Sbjct  121  RKEVENCDCL  130



>ref|XP_006481398.1| PREDICTED: tubulin beta-2 chain [Citrus sinensis]
Length=432

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGIDPTG+Y G +DLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYQGDTDLQLERINVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_008806874.1| PREDICTED: tubulin beta-2 chain [Phoenix dactylifera]
Length=447

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011039129.1| PREDICTED: tubulin beta-5 chain-like [Populus euphratica]
Length=444

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC+EHGIDPTGRYVG S+LQLERVNVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCEEHGIDPTGRYVGNSELQLERVNVYYNEASNGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PR VLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRGVLMDLEPGTMDSIRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010035138.1| PREDICTED: tubulin beta-1 chain [Eucalyptus grandis]
 gb|KCW46432.1| hypothetical protein EUGRSUZ_K00264 [Eucalyptus grandis]
Length=447

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGNNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004496560.1| PREDICTED: tubulin beta-1 chain-like [Cicer arietinum]
Length=448

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGNNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_003592284.1| Tubulin beta chain [Medicago truncatula]
 gb|AES62535.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGNNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002509780.1| tubulin beta chain, putative [Ricinus communis]
 gb|EEF51167.1| tubulin beta chain, putative [Ricinus communis]
Length=446

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDTDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AFC88825.1| putative tubulin beta-7 chain [Miscanthus sinensis]
Length=298

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEV+CDEHGID TGRY G SDLQLER+NVYYNEAS GRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDATGRYAGDSDLQLERINVYYNEASGGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011072483.1| PREDICTED: tubulin beta-8 chain-like [Sesamum indicum]
Length=445

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDSTGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002532094.1| tubulin beta chain, putative [Ricinus communis]
 gb|EEF30284.1| tubulin beta chain, putative [Ricinus communis]
Length=445

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRY G S+LQ+ERVNVYYNEA+ GR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSELQVERVNVYYNEANNGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009144365.1| PREDICTED: tubulin beta-7 chain [Brassica rapa]
Length=449

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CDY45452.1| BnaA05g12490D [Brassica napus]
Length=449

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KJB21246.1| hypothetical protein B456_003G126300 [Gossypium raimondii]
Length=388

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G  DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCSEHGIDPTGRYQGDLDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010469941.1| PREDICTED: tubulin beta-7 chain-like [Camelina sativa]
Length=448

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AGV54374.1| tubulin beta-2 chain-like protein [Phaseolus vulgaris]
Length=422

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGIDPTGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010510475.1| PREDICTED: tubulin beta-7 chain isoform X1 [Camelina sativa]
 ref|XP_010510476.1| PREDICTED: tubulin beta-7 chain isoform X2 [Camelina sativa]
 ref|XP_010414372.1| PREDICTED: tubulin beta-7 chain [Camelina sativa]
Length=449

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLERVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011072460.1| PREDICTED: tubulin beta-8 chain-like [Sesamum indicum]
Length=445

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDSTGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002318519.1| hypothetical protein POPTR_0012s04500g [Populus trichocarpa]
 gb|EEE96739.1| hypothetical protein POPTR_0012s04500g [Populus trichocarpa]
Length=444

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG S+LQLERVNVYYNE S GR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSELQLERVNVYYNEVSNGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PR VLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRGVLMDLEPGTMDSIRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>emb|CDP05193.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYKGDNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006421924.1| hypothetical protein CICLE_v10004755mg [Citrus clementina]
 gb|ESR35164.1| hypothetical protein CICLE_v10004755mg [Citrus clementina]
Length=514

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  69   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDNDLQLERVNVYYNEASCGRFV  128

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  129  PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  188

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  189  RKEAENCDCL  198



>emb|CDP09135.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPHGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AFR42222.1| beta-tubulin, partial [Populus trichocarpa]
 gb|AFR42226.1| beta-tubulin, partial [Populus alba]
 gb|AFR42227.1| beta-tubulin, partial [Populus alba]
 gb|AFR42228.1| beta-tubulin, partial [Populus alba]
 gb|AFR42230.1| beta-tubulin, partial [Populus alba]
 gb|AFR42232.1| beta-tubulin, partial [Populus alba]
 gb|AFR42245.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42246.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42247.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42248.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42249.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42250.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42251.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42252.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42254.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42255.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42256.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42257.1| beta-tubulin, partial [Populus nigra]
Length=131

 Score =   250 bits (639),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQ GQCGNQIG KFWEVVCDEHGIDPTG Y G S++QLERVNVYYNEAS GR+V
Sbjct  1    MREILHVQAGQCGNQIGGKFWEVVCDEHGIDPTGNYAGNSNVQLERVNVYYNEASGGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+RTGPYGQIFRPDNFVFGQ+GAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRTGPYGQIFRPDNFVFGQNGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010940464.1| PREDICTED: tubulin beta-2 chain [Elaeis guineensis]
Length=447

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYHGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AAK96884.1| beta tubulin [Arabidopsis thaliana]
 gb|AAM10035.1| beta tubulin [Arabidopsis thaliana]
Length=449

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G  DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGEKDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010535429.1| PREDICTED: tubulin beta-2 chain [Tarenaya hassleriana]
Length=449

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEV+C EHGIDPTGRY G SDLQ ER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDPTGRYQGDSDLQRERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_568437.1| tubulin beta-8 chain [Arabidopsis thaliana]
 ref|NP_001190373.1| tubulin beta-8 chain [Arabidopsis thaliana]
 sp|P29516.2|TBB8_ARATH RecName: Full=Tubulin beta-8 chain; AltName: Full=Beta-8-tubulin 
[Arabidopsis thaliana]
 dbj|BAB10059.1| beta tubulin [Arabidopsis thaliana]
 gb|AED93223.1| tubulin beta-8 chain [Arabidopsis thaliana]
 gb|AED93224.1| tubulin beta-8 chain [Arabidopsis thaliana]
Length=449

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006287738.1| hypothetical protein CARUB_v10000948mg [Capsella rubella]
 ref|XP_010421190.1| PREDICTED: tubulin beta-8 chain [Camelina sativa]
 ref|XP_010454670.1| PREDICTED: tubulin beta-8 chain [Camelina sativa]
 gb|EOA20636.1| hypothetical protein CARUB_v10000948mg [Capsella rubella]
Length=449

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010676480.1| PREDICTED: tubulin beta-1 chain [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+Q GQCGNQIG+KFWEVVC EHGIDPTG+Y G SDLQ ERVNVYYNEASCGRFV
Sbjct  1    MREILHIQAGQCGNQIGAKFWEVVCAEHGIDPTGQYKGESDLQFERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002510784.1| tubulin beta chain, putative [Ricinus communis]
 gb|EEF51386.1| tubulin beta chain, putative [Ricinus communis]
Length=448

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KJB34131.1| hypothetical protein B456_006G049000 [Gossypium raimondii]
Length=448

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_011076163.1| PREDICTED: tubulin beta-1 chain [Sesamum indicum]
Length=446

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_006490393.1| PREDICTED: tubulin beta-1 chain-like [Citrus sinensis]
 gb|KDO59996.1| hypothetical protein CISIN_1g013291mg [Citrus sinensis]
Length=446

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AIS84176.1| beta-tubulin 7c [Linum usitatissimum]
Length=450

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIG+KFWEV+C+EHGID TGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVICNEHGIDSTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AIS84175.1| beta-tubulin 7b [Linum usitatissimum]
Length=450

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIG+KFWEV+C+EHGID TGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVICNEHGIDSTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_002872076.1| tubulin beta-8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48335.1| tubulin beta-8 [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNF+FGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFIFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|EYU38453.1| hypothetical protein MIMGU_mgv1a006387mg [Erythranthe guttata]
Length=445

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDQTGRYDGDSDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009767718.1| PREDICTED: tubulin beta-1 chain [Nicotiana sylvestris]
Length=447

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEV+C EHGID TGRY G +DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDSTGRYAGDNDLQLERLNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KHG11026.1| Tubulin beta-8 chain -like protein [Gossypium arboreum]
Length=246

 Score =   254 bits (648),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G  DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGNLDLQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|NP_001289638.1| tubulin beta-9 chain [Eucalyptus grandis]
 gb|ABS50666.1| beta-tubulin [Eucalyptus grandis]
 gb|KCW85484.1| hypothetical protein EUGRSUZ_B02285 [Eucalyptus grandis]
Length=447

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G S+LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYHGDSELQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_004172853.1| PREDICTED: tubulin beta-1 chain-like, partial [Cucumis sativus]
Length=133

 Score =   249 bits (637),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 2/132 (2%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVG--TSDLQLERVNVYYNEASCGR  267
            MREILHVQGGQCGNQIGSKFWEV+CDEHGID TG+Y G  +SDLQLER+NVYYNEAS GR
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVICDEHGIDATGKYNGDPSSDLQLERINVYYNEASGGR  60

Query  268  FVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLD  447
            +VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLD
Sbjct  61   YVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLD  120

Query  448  VVRKEAENSDCL  483
            VVRKEAEN DCL
Sbjct  121  VVRKEAENCDCL  132



>ref|XP_009596463.1| PREDICTED: tubulin beta-1 chain [Nicotiana tomentosiformis]
Length=447

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEV+C EHGID TGRY G +DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDSTGRYAGDNDLQLERLNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|KJB25808.1| hypothetical protein B456_004G210600 [Gossypium raimondii]
Length=419

 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>gb|AIS84174.1| beta-tubulin 7a [Linum usitatissimum]
Length=450

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEV+C+EHGID TGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICNEHGIDSTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009141007.1| PREDICTED: tubulin beta-7 chain-like [Brassica rapa]
Length=449

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIGSKFWEVVC EHGID TGRY G SDLQL+RVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLDRVNVYYNEASCGRYV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_009626214.1| PREDICTED: tubulin beta-2 chain-like [Nicotiana tomentosiformis]
Length=447

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLER+NVYYNEA+CGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDSDLQLERINVYYNEATCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_007040195.1| Tubulin beta 8 [Theobroma cacao]
 gb|EOY24696.1| Tubulin beta 8 [Theobroma cacao]
Length=445

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILHVQGGQCGNQIG+KFWEVVC EHGID TGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCTEHGIDSTGRYHGDSELQLERINVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRA+LMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAILMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



>ref|XP_010530505.1| PREDICTED: tubulin beta-8 chain, partial [Tarenaya hassleriana]
Length=442

 Score =   260 bits (664),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  273
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TG+Y G +DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGKYKGDNDLQLERVNVYYNEASCGRFV  60

Query  274  PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  453
            PRAVLMDLEPGTMDSVR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  454  RKEAENSDCL  483
            RKEAEN DCL
Sbjct  121  RKEAENCDCL  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550