BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I07

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624573.1|  PREDICTED: uncharacterized protein LOC104115...    134   3e-33   Nicotiana tomentosiformis
ref|XP_009624574.1|  PREDICTED: uncharacterized protein LOC104115...    133   5e-33   
ref|XP_009624575.1|  PREDICTED: uncharacterized protein LOC104115...    132   8e-33   
ref|XP_006350465.1|  PREDICTED: ATPase family AAA domain-containi...    132   1e-32   Solanum tuberosum [potatoes]
gb|EYU27731.1|  hypothetical protein MIMGU_mgv1a003429mg                132   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_009768630.1|  PREDICTED: uncharacterized protein LOC104219631    132   2e-32   Nicotiana sylvestris
ref|XP_011096007.1|  PREDICTED: spermatogenesis-associated protein 5    132   3e-32   
emb|CDP04451.1|  unnamed protein product                                130   5e-32   Coffea canephora [robusta coffee]
ref|XP_007026194.1|  P-loop containing nucleoside triphosphate hy...    127   6e-31   
ref|XP_004231621.1|  PREDICTED: ATPase family AAA domain-containi...    127   7e-31   Solanum lycopersicum
ref|XP_007026193.1|  P-loop containing nucleoside triphosphate hy...    127   8e-31   
ref|XP_007026192.1|  P-loop containing nucleoside triphosphate hy...    127   9e-31   
ref|XP_007026191.1|  P-loop containing nucleoside triphosphate hy...    127   1e-30   
ref|XP_010315707.1|  PREDICTED: cell division control protein 48 ...    123   1e-29   Solanum lycopersicum
ref|XP_011046997.1|  PREDICTED: 26S protease regulatory subunit 7...    124   2e-29   Populus euphratica
gb|KJB67294.1|  hypothetical protein B456_010G184000                    120   3e-28   Gossypium raimondii
ref|XP_010099152.1|  Cell division cycle protein 48-like protein        120   5e-28   Morus notabilis
gb|KJB67295.1|  hypothetical protein B456_010G184000                    119   7e-28   Gossypium raimondii
ref|XP_006383852.1|  hypothetical protein POPTR_0004s00570g             119   7e-28   
gb|KJB67293.1|  hypothetical protein B456_010G184000                    118   8e-28   Gossypium raimondii
ref|XP_011046998.1|  PREDICTED: 26S protease regulatory subunit 7...    118   2e-27   Populus euphratica
gb|KDP20696.1|  hypothetical protein JCGZ_21167                         118   2e-27   Jatropha curcas
gb|KJB67292.1|  hypothetical protein B456_010G184000                    117   3e-27   Gossypium raimondii
ref|XP_002267342.2|  PREDICTED: katanin p60 ATPase-containing sub...    117   7e-27   Vitis vinifera
gb|KHG02373.1|  hypothetical protein F383_23861                         117   9e-27   Gossypium arboreum [tree cotton]
gb|KHG02372.1|  Cell division cycle protein 48                          117   9e-27   Gossypium arboreum [tree cotton]
ref|XP_008224718.1|  PREDICTED: 26S protease regulatory subunit 1...    116   1e-26   Prunus mume [ume]
ref|XP_007211382.1|  hypothetical protein PRUPE_ppa003074mg             116   1e-26   Prunus persica
ref|XP_010252532.1|  PREDICTED: katanin p60 ATPase-containing sub...    115   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_007214513.1|  hypothetical protein PRUPE_ppa015790mg             112   4e-25   
gb|KHN06980.1|  hypothetical protein glysoja_048511                     103   1e-24   Glycine soja [wild soybean]
ref|XP_006578510.1|  PREDICTED: uncharacterized protein LOC100806...    103   2e-24   
ref|XP_006449811.1|  hypothetical protein CICLE_v10014675mg             109   4e-24   Citrus clementina [clementine]
ref|XP_006449813.1|  hypothetical protein CICLE_v10014675mg             108   4e-24   
ref|XP_006578507.1|  PREDICTED: uncharacterized protein LOC100806...    102   5e-24   
gb|EPS69768.1|  hypothetical protein M569_04996                         108   6e-24   Genlisea aurea
ref|XP_004486193.1|  PREDICTED: katanin p60 ATPase-containing sub...    107   1e-23   Cicer arietinum [garbanzo]
gb|KDO78373.1|  hypothetical protein CISIN_1g047219mg                   106   3e-23   Citrus sinensis [apfelsine]
ref|XP_010057885.1|  PREDICTED: 26S protease regulatory subunit 6...    106   4e-23   
ref|XP_006467371.1|  PREDICTED: peroxisomal ATPase pex1-like            106   4e-23   Citrus sinensis [apfelsine]
ref|XP_004134780.1|  PREDICTED: ATPase family AAA domain-containi...    105   7e-23   Cucumis sativus [cucumbers]
gb|KFK30962.1|  hypothetical protein AALP_AA6G050000                    103   2e-22   Arabis alpina [alpine rockcress]
ref|XP_011460019.1|  PREDICTED: uncharacterized protein LOC101304...    103   3e-22   Fragaria vesca subsp. vesca
ref|XP_002518418.1|  26S protease regulatory subunit, putative          103   3e-22   Ricinus communis
ref|XP_004166040.1|  PREDICTED: ATPase family AAA domain-containi...    103   3e-22   
ref|XP_008384107.1|  PREDICTED: ATPase family AAA domain-containi...    103   5e-22   Malus domestica [apple tree]
ref|XP_004293327.2|  PREDICTED: probable 26S protease regulatory ...    103   6e-22   Fragaria vesca subsp. vesca
ref|XP_008440046.1|  PREDICTED: probable 26S protease regulatory ...    102   6e-22   Cucumis melo [Oriental melon]
ref|XP_009357497.1|  PREDICTED: cell division control protein 48 ...    102   6e-22   Pyrus x bretschneideri [bai li]
ref|XP_003547270.1|  PREDICTED: cell division cycle protein 48 ho...    102   7e-22   Glycine max [soybeans]
ref|XP_009114584.1|  PREDICTED: ATPase family gene 2 protein            102   7e-22   Brassica rapa
ref|XP_010236144.1|  PREDICTED: katanin p60 ATPase-containing sub...    102   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_002872681.1|  AAA-type ATPase family protein                     102   1e-21   
ref|XP_008440045.1|  PREDICTED: spastin isoform X4                      101   1e-21   Cucumis melo [Oriental melon]
emb|CDY16679.1|  BnaA09g20570D                                        97.8    1e-21   Brassica napus [oilseed rape]
ref|XP_008440044.1|  PREDICTED: spastin isoform X3                      102   1e-21   Cucumis melo [Oriental melon]
ref|XP_008440042.1|  PREDICTED: spastin isoform X1                      101   2e-21   Cucumis melo [Oriental melon]
ref|XP_008440043.1|  PREDICTED: probable 26S protease regulatory ...    101   2e-21   Cucumis melo [Oriental melon]
emb|CDY71527.1|  BnaAnng37770D                                        98.6    2e-21   Brassica napus [oilseed rape]
gb|KEH36940.1|  P-loop nucleoside triphosphate hydrolase superfam...    100   5e-21   Medicago truncatula
gb|KEH36938.1|  P-loop nucleoside triphosphate hydrolase superfam...    100   5e-21   Medicago truncatula
ref|XP_004304993.1|  PREDICTED: vacuolar protein sorting-associat...    100   7e-21   Fragaria vesca subsp. vesca
ref|XP_010433019.1|  PREDICTED: probable 26S protease regulatory ...  99.4    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008793792.1|  PREDICTED: uncharacterized protein LOC103710...  98.6    2e-20   
ref|XP_008793793.1|  PREDICTED: uncharacterized protein LOC103710...  98.6    2e-20   
ref|XP_008793790.1|  PREDICTED: meiotic spindle formation protein...  98.6    2e-20   Phoenix dactylifera
ref|XP_008793791.1|  PREDICTED: uncharacterized protein LOC103710...  98.2    3e-20   
ref|XP_010539308.1|  PREDICTED: uncharacterized protein LOC104813427  98.2    3e-20   Tarenaya hassleriana [spider flower]
gb|EEC73974.1|  hypothetical protein OsI_08877                        98.2    3e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_010496163.1|  PREDICTED: 26S protease regulatory subunit 7...  97.8    4e-20   Camelina sativa [gold-of-pleasure]
ref|NP_001048071.1|  Os02g0740300                                     97.8    4e-20   
gb|EEE57779.1|  hypothetical protein OsJ_08323                        97.8    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_192327.3|  P-loop containing nucleoside triphosphate hydro...  97.8    4e-20   
ref|XP_006290067.1|  hypothetical protein CARUB_v10003705mg           97.4    5e-20   
ref|XP_007147681.1|  hypothetical protein PHAVU_006G145500g           97.1    7e-20   Phaseolus vulgaris [French bean]
ref|XP_010686771.1|  PREDICTED: 26S protease regulatory subunit 6...  95.9    2e-19   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX94544.1|  BnaC09g22920D                                        95.1    4e-19   
dbj|BAK06484.1|  predicted protein                                    94.4    7e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004953904.1|  PREDICTED: protein MSP1-like isoform X2          94.0    7e-19   
gb|EMT08829.1|  Protein cdcH                                          94.0    8e-19   
ref|XP_004953903.1|  PREDICTED: protein MSP1-like isoform X1          94.0    8e-19   Setaria italica
ref|XP_006649032.1|  PREDICTED: protein MSP1-like                     93.2    1e-18   
ref|XP_006396713.1|  hypothetical protein EUTSA_v10028536mg           93.6    1e-18   Eutrema salsugineum [saltwater cress]
ref|XP_008646232.1|  PREDICTED: uncharacterized protein LOC100216...  92.8    2e-18   
ref|XP_008646231.1|  PREDICTED: uncharacterized protein LOC100216...  92.8    2e-18   
ref|XP_008646230.1|  PREDICTED: katanin p60 ATPase-containing sub...  92.8    2e-18   
ref|XP_010928222.1|  PREDICTED: ATPase family AAA domain-containi...  91.3    4e-18   
ref|XP_006449812.1|  hypothetical protein CICLE_v10014675mg           90.9    7e-18   
ref|XP_010928220.1|  PREDICTED: ATPase family AAA domain-containi...  90.5    1e-17   Elaeis guineensis
ref|XP_010928219.1|  PREDICTED: uncharacterized protein LOC105050...  90.9    1e-17   
ref|XP_010928218.1|  PREDICTED: uncharacterized protein LOC105050...  90.9    1e-17   Elaeis guineensis
ref|XP_010433030.1|  PREDICTED: uncharacterized protein LOC104717...  86.7    2e-17   
gb|AAC28233.1|  contains similarity to ATPases associated with va...  87.8    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410259.1|  PREDICTED: katanin p60 ATPase-containing sub...  86.3    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410260.1|  PREDICTED: katanin p60 ATPase-containing sub...  85.9    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006836682.1|  hypothetical protein AMTR_s00088p00084700        82.0    1e-14   
ref|XP_002452576.1|  hypothetical protein SORBIDRAFT_04g028420        80.1    4e-14   
ref|XP_008793794.1|  PREDICTED: ATPase family AAA domain-containi...  79.3    5e-14   
gb|KEH36939.1|  P-loop nucleoside triphosphate hydrolase superfam...  62.0    3e-08   Medicago truncatula
emb|CDX83073.1|  BnaA01g20730D                                        60.8    7e-08   
ref|XP_009381623.1|  PREDICTED: cell division control protein 48-...  60.1    1e-07   
ref|XP_010057886.1|  PREDICTED: probable 26S protease regulatory ...  59.7    2e-07   Eucalyptus grandis [rose gum]



>ref|XP_009624573.1| PREDICTED: uncharacterized protein LOC104115608 isoform X1 [Nicotiana 
tomentosiformis]
Length=586

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 125/183 (68%), Gaps = 12/183 (7%)
 Frame = +1

Query  40   LARMLRCSRAIAS-LKTLASSS--THLPPTLPNRPLVHQLHISAHQGPH-----SRSIPG  195
            +A + R +RA+ S  + LAS S    LPP   +   + +L  +   G H     SRS+P 
Sbjct  1    MASIRRLARALHSHYRALASPSPILQLPP---HNDFILELVFTGTFGCHRHTFYSRSLPS  57

Query  196  FMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELI  375
              +PA+LAGLLGVG LDVA AD++E S      S S PTP+H+ LEE A KE+ RL  L+
Sbjct  58   TAIPAILAGLLGVGGLDVAYADSNEVSPKVP-ASDSLPTPSHNPLEETAKKERRRLENLL  116

Query  376  KTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMIL  555
            K+KG+  GSYPR+TVAVKGQKV IKFQVPPTCEIP+LI  LVSRLG+KLED  + S+M+L
Sbjct  117  KSKGVQYGSYPRFTVAVKGQKVTIKFQVPPTCEIPLLIANLVSRLGVKLEDPSAASNMML  176

Query  556  RAW  564
            RAW
Sbjct  177  RAW  179



>ref|XP_009624574.1| PREDICTED: uncharacterized protein LOC104115608 isoform X2 [Nicotiana 
tomentosiformis]
Length=582

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 8/179 (4%)
 Frame = +1

Query  40   LARMLRCSRAIAS-LKTLASSS--THLPPTLPNRPLVHQLHISAHQGP-HSRSIPGFMVP  207
            +A + R +RA+ S  + LAS S    LPP   +  LV       H+   +SRS+P   +P
Sbjct  1    MASIRRLARALHSHYRALASPSPILQLPP---HNELVFTGTFGCHRHTFYSRSLPSTAIP  57

Query  208  avlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKG  387
            A+LAGLLGVG LDVA AD++E S      S S PTP+H+ LEE A KE+ RL  L+K+KG
Sbjct  58   AILAGLLGVGGLDVAYADSNEVSPKVP-ASDSLPTPSHNPLEETAKKERRRLENLLKSKG  116

Query  388  MLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +  GSYPR+TVAVKGQKV IKFQVPPTCEIP+LI  LVSRLG+KLED  + S+M+LRAW
Sbjct  117  VQYGSYPRFTVAVKGQKVTIKFQVPPTCEIPLLIANLVSRLGVKLEDPSAASNMMLRAW  175



>ref|XP_009624575.1| PREDICTED: uncharacterized protein LOC104115608 isoform X3 [Nicotiana 
tomentosiformis]
Length=577

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 122/179 (68%), Gaps = 13/179 (7%)
 Frame = +1

Query  40   LARMLRCSRAIAS-LKTLASSS--THLPPTLPNRPLVHQLHISAHQGP-HSRSIPGFMVP  207
            +A + R +RA+ S  + LAS S    LPP        H      H+   +SRS+P   +P
Sbjct  1    MASIRRLARALHSHYRALASPSPILQLPP--------HNGTFGCHRHTFYSRSLPSTAIP  52

Query  208  avlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKG  387
            A+LAGLLGVG LDVA AD++E S      S S PTP+H+ LEE A KE+ RL  L+K+KG
Sbjct  53   AILAGLLGVGGLDVAYADSNEVSPKVP-ASDSLPTPSHNPLEETAKKERRRLENLLKSKG  111

Query  388  MLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +  GSYPR+TVAVKGQKV IKFQVPPTCEIP+LI  LVSRLG+KLED  + S+M+LRAW
Sbjct  112  VQYGSYPRFTVAVKGQKVTIKFQVPPTCEIPLLIANLVSRLGVKLEDPSAASNMMLRAW  170



>ref|XP_006350465.1| PREDICTED: ATPase family AAA domain-containing protein 1-A-like 
[Solanum tuberosum]
Length=574

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 122/177 (69%), Gaps = 8/177 (5%)
 Frame = +1

Query  40   LARMLRCSRAIAS-LKTLASSSTHLPPTLPNRPLVHQLHISAHQGPH-SRSIPGFMVPav  213
            +A + R +RA+ S  +TLAS S +  P LP     H      H+    SRS+P   +PA+
Sbjct  1    MASIRRLARALHSHYRTLASPSLYQSPNLP-----HNGIFGCHRRTFFSRSVPSTTIPAI  55

Query  214  lagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGML  393
            LAGLLGVG+L+VA AD+DE  +    P  S P P+H+ LEE A +E+ RL  L+K+KG+ 
Sbjct  56   LAGLLGVGVLNVAYADSDEVGAKVP-PYDSLPIPSHNPLEETAKRERLRLENLLKSKGVK  114

Query  394  IGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
             GSYPR+TVAVKGQKV IKFQVPPTCEIP+LI  LVSRLG+KLED  + S+M+L AW
Sbjct  115  YGSYPRFTVAVKGQKVTIKFQVPPTCEIPLLIASLVSRLGVKLEDSSAASNMMLHAW  171



>gb|EYU27731.1| hypothetical protein MIMGU_mgv1a003429mg [Erythranthe guttata]
Length=586

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 109/188 (58%), Gaps = 12/188 (6%)
 Frame = +1

Query  22   VASMASLARMLRCSRAIASLKTLA-----SSSTHLPPTLP--NRPLVHQLHISAHQGPHS  180
            +A++  LAR +R  R IAS KTL      S S  LP +LP  NR    Q      +GP  
Sbjct  1    MAAIWRLARTIRSYRTIASAKTLNPRPFFSPSPRLPLSLPICNRTF-EQHEACGSRGPRP  59

Query  181  RSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNR  360
            + +P   V      L G+    +      +     ALP+ SP   NH  LEE+A KEK R
Sbjct  60   KGVPELSV---HTLLGGLLGFGLLDVAFADEPVKAALPAESP-VLNHHNLEEIARKEKTR  115

Query  361  LGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSG  540
            L EL++  G   GSYPR+TV++KGQKV IKFQVP +CEIP+LI  LVSRLG+K ++ G G
Sbjct  116  LEELLRQYGGRYGSYPRFTVSIKGQKVTIKFQVPQSCEIPLLIANLVSRLGVKPDNNGVG  175

Query  541  SDMILRAW  564
            SDM LRAW
Sbjct  176  SDMTLRAW  183



>ref|XP_009768630.1| PREDICTED: uncharacterized protein LOC104219631, partial [Nicotiana 
sylvestris]
Length=585

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  175  HSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEK  354
            +SRS+P   +PA+LAGLLGVG LDVA AD++E S      S S PTP+H+ LEE A KE+
Sbjct  50   YSRSLPSTAIPAILAGLLGVGGLDVAYADSNEVSPKVP-ASDSLPTPSHNPLEETAKKER  108

Query  355  NRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXG  534
             RL  L+K+KG+  GSYPR+TVAVKGQKV IKFQVPPTCEIP+LI  LVSRLG+KLED  
Sbjct  109  RRLENLLKSKGVQFGSYPRFTVAVKGQKVTIKFQVPPTCEIPLLIANLVSRLGVKLEDPS  168

Query  535  SGSDMILRAW  564
            + S+M+LRAW
Sbjct  169  AASNMMLRAW  178



>ref|XP_011096007.1| PREDICTED: spermatogenesis-associated protein 5 [Sesamum indicum]
Length=640

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 119/210 (57%), Gaps = 23/210 (11%)
 Frame = +1

Query  4    TTPHSTVASMAS---LARMLRCSRAIASLKTLASSSTHLP-PTLP--NR--PLVHQLHIS  159
            ++P  T A+M S   LAR LR  R IAS +TL    +  P P LP  NR      Q + S
Sbjct  28   SSPVRTAAAMPSIWRLARALRSCRTIASAQTLNPRPSLSPSPRLPLYNRRCEWDKQTYGS  87

Query  160  A-------HQGPHSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTP-  315
                    H+ P   ++ G +   ++           A   +   S+ T LP  S  TP 
Sbjct  88   ECPRPKGLHELPFHIALAGLLGFGLVDVAFADSNEAAAKTPSPPESAKTPLPPESAKTPP  147

Query  316  -------NHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
                   +H  LEE+A +EK+RL EL+K+KG   GSYPR+TV++KGQKV IKFQVPP+CE
Sbjct  148  QESPAASSHHNLEEIARREKSRLEELLKSKGGRSGSYPRFTVSIKGQKVTIKFQVPPSCE  207

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            IP+LIT LVSRLG+K ED G GSDM LRAW
Sbjct  208  IPLLITNLVSRLGVKAEDNGIGSDMTLRAW  237



>emb|CDP04451.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 124/184 (67%), Gaps = 9/184 (5%)
 Frame = +1

Query  40   LARMLRCSRAIA-SLKTLAS----SSTHLP----PTLPNRPLVHQLHISAHQGPHSRSIP  192
            +A M R +RA+A S KTLAS    SS   P    P L NR   H+ + +A +G  SR   
Sbjct  1    MASMRRLARALAASSKTLASFPPLSSRSSPRLQLPQLYNRVFEHRGYSNASEGLPSRLKI  60

Query  193  GFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGEL  372
                PA+LA L G GL++VA ADADE ++   +P     T ++S LEE A KE+ RL EL
Sbjct  61   ETYFPAMLAALFGGGLINVAYADADEDAAKNPMPPQPSQTSSYSDLEETAKKERLRLEEL  120

Query  373  IKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMI  552
            +K+KG+  GSYPR+TVAVKGQKV I+FQ+PP CEIP+LI  LVSRLG+K++D  SG+DM+
Sbjct  121  LKSKGVGYGSYPRFTVAVKGQKVTIRFQIPPACEIPLLIANLVSRLGVKVDDSASGADML  180

Query  553  LRAW  564
            LRAW
Sbjct  181  LRAW  184



>ref|XP_007026194.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 4 [Theobroma cacao]
 gb|EOY28816.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 4 [Theobroma cacao]
Length=495

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 121/190 (64%), Gaps = 20/190 (11%)
 Frame = +1

Query  31   MASLARMLRCSRAIASLKTLA---SSSTHLPPTLPNRP--------LVHQLHISA-HQGP  174
            +  LAR  R  R IAS K L    +SS  LP  L +R            QL ++A   G 
Sbjct  4    LERLARTARSWRKIASPKILTPSRASSRDLPSALYHRSSGCLKCILDTQQLRLAAASSGS  63

Query  175  HSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEK  354
            +S      M+PAVLAGLLG G+L+ A A+ADE ++   LPS +P +  H  LEE A KE+
Sbjct  64   YS------MLPAVLAGLLGAGVLETAYAEADEVAAKPPLPSETPAS--HVNLEETAKKER  115

Query  355  NRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXG  534
             R+ +L+K KGM  GSYPR+TVA+KGQKV IKFQ+PP+CE+  LI  LVS LGLK+E+ G
Sbjct  116  QRIEQLLKDKGMKSGSYPRFTVAIKGQKVTIKFQIPPSCEVAQLIANLVSNLGLKVEERG  175

Query  535  SGSDMILRAW  564
             GSDM+LRAW
Sbjct  176  GGSDMLLRAW  185



>ref|XP_004231621.1| PREDICTED: ATPase family AAA domain-containing protein 1-A isoform 
X1 [Solanum lycopersicum]
 ref|XP_004231622.1| PREDICTED: ATPase family AAA domain-containing protein 1-A isoform 
X1 [Solanum lycopersicum]
 ref|XP_010315706.1| PREDICTED: ATPase family AAA domain-containing protein 1-A isoform 
X1 [Solanum lycopersicum]
Length=574

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 118/172 (69%), Gaps = 8/172 (5%)
 Frame = +1

Query  55   RCSRAIAS-LKTLASSSTHLPPTLPNRPLVHQLHISAHQGPH-SRSIPGFMVPavlagll  228
            R +RA+ S  +TLAS S H    LP     H       Q  + SRS+P    PA+LAGLL
Sbjct  6    RLARALHSHYRTLASPSLHQSTNLP-----HNGIFGCKQRTYFSRSVPSTTFPAILAGLL  60

Query  229  gvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYP  408
            GVG+L+VA AD+DE  +    P  S P P+++ LEE A +E+ RL  L+K+KG+  GSYP
Sbjct  61   GVGVLNVAYADSDEAGAEVP-PFDSLPIPSYNPLEETAKRERLRLENLLKSKGVKYGSYP  119

Query  409  RYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            R+TVAVKGQKV IKFQ+PPTCEIP+LI  LVSRLG+KLED  + S+M+LRAW
Sbjct  120  RFTVAVKGQKVTIKFQIPPTCEIPLLIATLVSRLGVKLEDPNAASNMLLRAW  171



>ref|XP_007026193.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY28815.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=529

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 121/190 (64%), Gaps = 20/190 (11%)
 Frame = +1

Query  31   MASLARMLRCSRAIASLKTLA---SSSTHLPPTLPNRP--------LVHQLHISA-HQGP  174
            +  LAR  R  R IAS K L    +SS  LP  L +R            QL ++A   G 
Sbjct  4    LERLARTARSWRKIASPKILTPSRASSRDLPSALYHRSSGCLKCILDTQQLRLAAASSGS  63

Query  175  HSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEK  354
            +S      M+PAVLAGLLG G+L+ A A+ADE ++   LPS +P +  H  LEE A KE+
Sbjct  64   YS------MLPAVLAGLLGAGVLETAYAEADEVAAKPPLPSETPAS--HVNLEETAKKER  115

Query  355  NRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXG  534
             R+ +L+K KGM  GSYPR+TVA+KGQKV IKFQ+PP+CE+  LI  LVS LGLK+E+ G
Sbjct  116  QRIEQLLKDKGMKSGSYPRFTVAIKGQKVTIKFQIPPSCEVAQLIANLVSNLGLKVEERG  175

Query  535  SGSDMILRAW  564
             GSDM+LRAW
Sbjct  176  GGSDMLLRAW  185



>ref|XP_007026192.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2, partial [Theobroma cacao]
 gb|EOY28814.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2, partial [Theobroma cacao]
Length=546

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 121/190 (64%), Gaps = 20/190 (11%)
 Frame = +1

Query  31   MASLARMLRCSRAIASLKTLA---SSSTHLPPTLPNRP--------LVHQLHISA-HQGP  174
            +  LAR  R  R IAS K L    +SS  LP  L +R            QL ++A   G 
Sbjct  4    LERLARTARSWRKIASPKILTPSRASSRDLPSALYHRSSGCLKCILDTQQLRLAAASSGS  63

Query  175  HSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEK  354
            +S      M+PAVLAGLLG G+L+ A A+ADE ++   LPS +P +  H  LEE A KE+
Sbjct  64   YS------MLPAVLAGLLGAGVLETAYAEADEVAAKPPLPSETPAS--HVNLEETAKKER  115

Query  355  NRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXG  534
             R+ +L+K KGM  GSYPR+TVA+KGQKV IKFQ+PP+CE+  LI  LVS LGLK+E+ G
Sbjct  116  QRIEQLLKDKGMKSGSYPRFTVAIKGQKVTIKFQIPPSCEVAQLIANLVSNLGLKVEERG  175

Query  535  SGSDMILRAW  564
             GSDM+LRAW
Sbjct  176  GGSDMLLRAW  185



>ref|XP_007026191.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY28813.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=600

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 121/190 (64%), Gaps = 20/190 (11%)
 Frame = +1

Query  31   MASLARMLRCSRAIASLKTLA---SSSTHLPPTLPNRP--------LVHQLHISA-HQGP  174
            +  LAR  R  R IAS K L    +SS  LP  L +R            QL ++A   G 
Sbjct  4    LERLARTARSWRKIASPKILTPSRASSRDLPSALYHRSSGCLKCILDTQQLRLAAASSGS  63

Query  175  HSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEK  354
            +S      M+PAVLAGLLG G+L+ A A+ADE ++   LPS +P +  H  LEE A KE+
Sbjct  64   YS------MLPAVLAGLLGAGVLETAYAEADEVAAKPPLPSETPAS--HVNLEETAKKER  115

Query  355  NRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXG  534
             R+ +L+K KGM  GSYPR+TVA+KGQKV IKFQ+PP+CE+  LI  LVS LGLK+E+ G
Sbjct  116  QRIEQLLKDKGMKSGSYPRFTVAIKGQKVTIKFQIPPSCEVAQLIANLVSNLGLKVEERG  175

Query  535  SGSDMILRAW  564
             GSDM+LRAW
Sbjct  176  GGSDMLLRAW  185



>ref|XP_010315707.1| PREDICTED: cell division control protein 48 isoform X2 [Solanum 
lycopersicum]
Length=501

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +1

Query  292  PSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTC  471
            P  S P P+++ LEE A +E+ RL  L+K+KG+  GSYPR+TVAVKGQKV IKFQ+PPTC
Sbjct  8    PFDSLPIPSYNPLEETAKRERLRLENLLKSKGVKYGSYPRFTVAVKGQKVTIKFQIPPTC  67

Query  472  EIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            EIP+LI  LVSRLG+KLED  + S+M+LRAW
Sbjct  68   EIPLLIATLVSRLGVKLEDPNAASNMLLRAW  98



>ref|XP_011046997.1| PREDICTED: 26S protease regulatory subunit 7 homolog isoform 
X1 [Populus euphratica]
Length=601

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 124/194 (64%), Gaps = 14/194 (7%)
 Frame = +1

Query  22   VASMASLARMLRCSRAI--ASLKTLA---SSSTHLPP--TLPNRPLVHQLHISAHQ----  168
            +A ++  AR  R  RAI  +SL+TL     +S  LPP   L  R   HQ+H S+ +    
Sbjct  1    MAVLSRFARATRSWRAIPSSSLRTLNPSRDTSCDLPPPTLLFLRSFNHQIHSSSSKILRP  60

Query  169  --GPHSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELA  342
                ++  +P  + PA+LA  + VG+L VA AD+DE +S    PS      ++  LEE+A
Sbjct  61   RWASNANELPNSLFPALLASFIAVGMLQVAHADSDENASKPPSPS-ESSPSSYGDLEEIA  119

Query  343  MKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKL  522
             KE+ R+ EL+K+KG+  GSYPR+T+AVKGQKV IKFQ+PP C+ P LI  LVS LG+K+
Sbjct  120  KKERQRIEELLKSKGIKYGSYPRFTIAVKGQKVTIKFQIPPACDTPQLIANLVSNLGVKV  179

Query  523  EDXGSGSDMILRAW  564
            ++ G+GSDM+LRAW
Sbjct  180  DERGAGSDMLLRAW  193



>gb|KJB67294.1| hypothetical protein B456_010G184000 [Gossypium raimondii]
Length=528

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 125/201 (62%), Gaps = 31/201 (15%)
 Frame = +1

Query  31   MASLARMLRCS----RAIASLKTLASSSTHLPP---TLPNRPL---------------VH  144
            MA   R++R +    R I S KTLA + T LP     LP  PL               V 
Sbjct  1    MAVFDRLVRTTARSWRRIVSPKTLALALTPLPSPSRQLPPPPLYLRFPGSSNFTIGSDVQ  60

Query  145  QLH-ISAHQGPHSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNH  321
            QL  ++A  G +S      ++PAVLAGLLG G+++   ADADE SS   LPS  PPT +H
Sbjct  61   QLRLVAAASGSYS------ILPAVLAGLLGAGMIETTYADADEVSSKPPLPS-EPPT-SH  112

Query  322  SFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLV  501
              LEE A KE+ R+ +++K KG+  GSYPR+TVAVKGQKV IKFQ+PP+CE+  L+  LV
Sbjct  113  VNLEETAKKERQRIEQMLKDKGIRHGSYPRFTVAVKGQKVTIKFQIPPSCEVAQLVANLV  172

Query  502  SRLGLKLEDXGSGSDMILRAW  564
            S LGLK+++ G GSD++LRAW
Sbjct  173  SHLGLKVDERGGGSDVLLRAW  193



>ref|XP_010099152.1| Cell division cycle protein 48-like protein [Morus notabilis]
 gb|EXB77024.1| Cell division cycle protein 48-like protein [Morus notabilis]
Length=585

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 121/197 (61%), Gaps = 27/197 (14%)
 Frame = +1

Query  31   MASLARMLRCSRAIASLKTLASSSTHLPP------TLPN------RPLVHQLHISAH--Q  168
            M  L R+++ SR   +LKT+ SS T  PP        PN      R +  Q H +A   Q
Sbjct  1    MGVLGRLVKASR---TLKTITSSKTLNPPPVLLSRNTPNPRLLDLRSVRQQNHYNASEIQ  57

Query  169  GPHS-RSIPG--FMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSF--LE  333
             P S R+  G  F++PA+LA L GV  L  A ADA E  +G   PS SP     SF  LE
Sbjct  58   WPTSVRNSRGLYFILPALLASLSGVEGLQTAYADA-EEPTGRPSPSESPA----SFVDLE  112

Query  334  ELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLG  513
            E+A KE+ R+ EL+K KG+  GSYPR+T+A+KGQKV++KFQ+P  CE+  LI  LVS+LG
Sbjct  113  EVAKKERKRIEELLKAKGIRHGSYPRFTIAIKGQKVSVKFQIPSACEVSQLIANLVSQLG  172

Query  514  LKLEDXGSGSDMILRAW  564
            LK+E  G GSDM++RAW
Sbjct  173  LKVEQRGGGSDMLVRAW  189



>gb|KJB67295.1| hypothetical protein B456_010G184000 [Gossypium raimondii]
Length=610

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 125/201 (62%), Gaps = 31/201 (15%)
 Frame = +1

Query  31   MASLARMLRCS----RAIASLKTLASSSTHLPP---TLPNRPL---------------VH  144
            MA   R++R +    R I S KTLA + T LP     LP  PL               V 
Sbjct  1    MAVFDRLVRTTARSWRRIVSPKTLALALTPLPSPSRQLPPPPLYLRFPGSSNFTIGSDVQ  60

Query  145  QLH-ISAHQGPHSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNH  321
            QL  ++A  G +S      ++PAVLAGLLG G+++   ADADE SS   LPS  PPT +H
Sbjct  61   QLRLVAAASGSYS------ILPAVLAGLLGAGMIETTYADADEVSSKPPLPS-EPPT-SH  112

Query  322  SFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLV  501
              LEE A KE+ R+ +++K KG+  GSYPR+TVAVKGQKV IKFQ+PP+CE+  L+  LV
Sbjct  113  VNLEETAKKERQRIEQMLKDKGIRHGSYPRFTVAVKGQKVTIKFQIPPSCEVAQLVANLV  172

Query  502  SRLGLKLEDXGSGSDMILRAW  564
            S LGLK+++ G GSD++LRAW
Sbjct  173  SHLGLKVDERGGGSDVLLRAW  193



>ref|XP_006383852.1| hypothetical protein POPTR_0004s00570g [Populus trichocarpa]
 gb|ERP61649.1| hypothetical protein POPTR_0004s00570g [Populus trichocarpa]
Length=601

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 124/194 (64%), Gaps = 14/194 (7%)
 Frame = +1

Query  22   VASMASLARMLRCSRAI--ASLKTLA---SSSTHLPPTLPN--RPLVHQLHISAHQ----  168
            +A  +  AR  R  R I  +SL+TL    ++S  LPP  P   R   HQ+H S+ +    
Sbjct  1    MAVFSRFARATRSWRTIPSSSLRTLNPSRATSCDLPPPTPLFLRSFNHQIHSSSSEILRP  60

Query  169  --GPHSRSIPGFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELA  342
                ++  +P  + PA+LA  +GVG+L VA AD+DE +S   LPS      ++  LEE+A
Sbjct  61   RWASNANELPNSLFPALLASFIGVGMLQVAHADSDENASKPPLPS-ESSPSSYGDLEEIA  119

Query  343  MKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKL  522
             KE+ R+ EL+K+KG+  GS+PR+T+AVKGQKV IKFQ+PP C+ P LI  LVS LG+K+
Sbjct  120  KKERQRIEELLKSKGIKYGSFPRFTIAVKGQKVTIKFQIPPACDTPQLIANLVSNLGVKV  179

Query  523  EDXGSGSDMILRAW  564
            ++ G+GSDM LRAW
Sbjct  180  DERGAGSDMSLRAW  193



>gb|KJB67293.1| hypothetical protein B456_010G184000 [Gossypium raimondii]
Length=524

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            E SS   LPS  PPT +H  LEE A KE+ R+ +++K KG+  GSYPR+TVAVKGQKV I
Sbjct  11   EVSSKPPLPS-EPPT-SHVNLEETAKKERQRIEQMLKDKGIRHGSYPRFTVAVKGQKVTI  68

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQ+PP+CE+  L+  LVS LGLK+++ G GSD++LRAW
Sbjct  69   KFQIPPSCEVAQLVANLVSHLGLKVDERGGGSDVLLRAW  107



>ref|XP_011046998.1| PREDICTED: 26S protease regulatory subunit 7 homolog isoform 
X2 [Populus euphratica]
Length=590

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            LEE+A KE+ R+ EL+K+KG+  GSYPR+T+AVKGQKV IKFQ+PP C+ P LI  LVS 
Sbjct  104  LEEIAKKERQRIEELLKSKGIKYGSYPRFTIAVKGQKVTIKFQIPPACDTPQLIANLVSN  163

Query  508  LGLKLEDXGSGSDMILRAW  564
            LG+K+++ G+GSDM+LRAW
Sbjct  164  LGVKVDERGAGSDMLLRAW  182



>gb|KDP20696.1| hypothetical protein JCGZ_21167 [Jatropha curcas]
Length=592

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPN-HSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVA  444
            ++    + P+ SP +P+ +  LEE+A KE+ R+ EL+++KGM  GSYPR+TVA+KGQKV 
Sbjct  88   DSDQAASKPTLSPDSPSSYQDLEEIAKKERQRIEELLRSKGMKYGSYPRFTVALKGQKVT  147

Query  445  IKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            IKFQ+PP C++P LI  L   LGLK+++ G GSDM LRAW
Sbjct  148  IKFQIPPACDVPQLIANLAMNLGLKVDERGGGSDMRLRAW  187



>gb|KJB67292.1| hypothetical protein B456_010G184000 [Gossypium raimondii]
Length=520

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            + SS   LPS  PPT +H  LEE A KE+ R+ +++K KG+  GSYPR+TVAVKGQKV I
Sbjct  7    QVSSKPPLPS-EPPT-SHVNLEETAKKERQRIEQMLKDKGIRHGSYPRFTVAVKGQKVTI  64

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQ+PP+CE+  L+  LVS LGLK+++ G GSD++LRAW
Sbjct  65   KFQIPPSCEVAQLVANLVSHLGLKVDERGGGSDVLLRAW  103



>ref|XP_002267342.2| PREDICTED: katanin p60 ATPase-containing subunit A1 [Vitis vinifera]
 emb|CBI33002.3| unnamed protein product [Vitis vinifera]
Length=596

 Score =   117 bits (292),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  319  HSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKL  498
            ++ LEE A K ++RL ELI+TKGM  GSYPR+TVA+KGQKV IKFQ+PPTCE+P LI KL
Sbjct  104  YTNLEENARKLRDRLEELIRTKGMKYGSYPRFTVALKGQKVTIKFQIPPTCEVPCLIAKL  163

Query  499  VSRLGLKLEDXGSGSDMILRAW  564
            V++LG+K+E+   GSDMI+RAW
Sbjct  164  VAQLGMKVEERSGGSDMIMRAW  185



>gb|KHG02373.1| hypothetical protein F383_23861 [Gossypium arboreum]
Length=672

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 72/103 (70%), Gaps = 5/103 (5%)
 Frame = +1

Query  271  TSSGTALPSGSPPTPN-----HSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQ  435
               G  + S  PP P+     H  LEE A KE+ R+ +++K KG+  GSYPR+TVAVKGQ
Sbjct  211  VDEGINIVSSKPPLPSEPPTSHFNLEETAKKERQRIEQMLKDKGIRYGSYPRFTVAVKGQ  270

Query  436  KVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KV IKFQ+PP+CE+  L+  LVS LGLK+++ G GSD++LRAW
Sbjct  271  KVTIKFQIPPSCEVAQLVANLVSHLGLKVDERGGGSDVLLRAW  313



>gb|KHG02372.1| Cell division cycle protein 48 [Gossypium arboreum]
Length=730

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 72/103 (70%), Gaps = 5/103 (5%)
 Frame = +1

Query  271  TSSGTALPSGSPPTPN-----HSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQ  435
               G  + S  PP P+     H  LEE A KE+ R+ +++K KG+  GSYPR+TVAVKGQ
Sbjct  211  VDEGINIVSSKPPLPSEPPTSHFNLEETAKKERQRIEQMLKDKGIRYGSYPRFTVAVKGQ  270

Query  436  KVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KV IKFQ+PP+CE+  L+  LVS LGLK+++ G GSD++LRAW
Sbjct  271  KVTIKFQIPPSCEVAQLVANLVSHLGLKVDERGGGSDVLLRAW  313



>ref|XP_008224718.1| PREDICTED: 26S protease regulatory subunit 10B homolog A [Prunus 
mume]
Length=600

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +1

Query  292  PSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTC  471
            P+ SP T +H  LEE+A K++ ++ +L+K+KG+  GSYP++TVAVKGQKV+IKFQ+PP C
Sbjct  95   PAESPTTESHVDLEEIAKKQRQKIEDLLKSKGIRRGSYPQFTVAVKGQKVSIKFQIPPAC  154

Query  472  EIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            E   LI  + S LGLK+E+ G GSDM LRAW
Sbjct  155  EASQLIANIASHLGLKVEEHGGGSDMSLRAW  185



>ref|XP_007211382.1| hypothetical protein PRUPE_ppa003074mg [Prunus persica]
 gb|EMJ12581.1| hypothetical protein PRUPE_ppa003074mg [Prunus persica]
Length=606

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +1

Query  292  PSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTC  471
            P+ SP T +H  LEE+A K++ ++ +L+K+KG+  GSYP++TVAVKGQKV+IKFQ+PP C
Sbjct  100  PAESPATESHVDLEEIAKKQRQKIEDLLKSKGIRRGSYPQFTVAVKGQKVSIKFQIPPAC  159

Query  472  EIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            E   LI  + S LGLK+E+ G GSDM LRAW
Sbjct  160  EASQLIANIASHLGLKVEEHGGGSDMSLRAW  190



>ref|XP_010252532.1| PREDICTED: katanin p60 ATPase-containing subunit A1 [Nelumbo 
nucifera]
 ref|XP_010252533.1| PREDICTED: katanin p60 ATPase-containing subunit A1 [Nelumbo 
nucifera]
Length=604

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 112/186 (60%), Gaps = 8/186 (4%)
 Frame = +1

Query  31   MASLARMLRCSRA---IASLKTLASSSTHLPPTLPNR---PLVHQLHISAHQGPHSRSIP  192
            MASL R+++  +A   I SLK+L SSS     +L  +   P  + +H    +GP  +S  
Sbjct  1    MASLRRLMKPGQAWWTINSLKSLTSSSPATRNSLHRQYRWPFEYFIHPKTSEGPRFKSTC  60

Query  193  GF--MVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNRLG  366
             F   +  + A L+G+  + +    AD     +  PS S     ++  E+   +E++RL 
Sbjct  61   EFHGFLSILPAVLVGILGVGLQETHADANQVDSKAPSSSQAPSTYADSEKFIKQERSRLE  120

Query  367  ELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSD  546
            EL+++KGM  GSYP +TVAVKG+KV +KFQ+PPTCE+  LI  LVS LGLK ++ GSGSD
Sbjct  121  ELLRSKGMHYGSYPPFTVAVKGEKVTVKFQIPPTCEVSHLIVDLVSHLGLKADEHGSGSD  180

Query  547  MILRAW  564
            MILRAW
Sbjct  181  MILRAW  186



>ref|XP_007214513.1| hypothetical protein PRUPE_ppa015790mg [Prunus persica]
 gb|EMJ15712.1| hypothetical protein PRUPE_ppa015790mg [Prunus persica]
Length=565

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  292  PSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTC  471
            P+ SP T +H  L+E++ K++ ++ +L+++KG+  GSYP++TVAVKGQKV+IKFQ+PP C
Sbjct  89   PAESPATESHVDLDEISKKQRQKIEDLLRSKGIRRGSYPQFTVAVKGQKVSIKFQIPPAC  148

Query  472  EIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            E   LI  + S LGLK+E+ G GSD++LRAW
Sbjct  149  EASKLIANMASHLGLKVEEHGGGSDILLRAW  179



>gb|KHN06980.1| hypothetical protein glysoja_048511 [Glycine soja]
Length=110

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            ++E A KE+ R+ EL++++G+  GSYPR+TV VKGQKV+IKFQ+PP CE+  LI  L + 
Sbjct  16   VQESAKKERERIEELLRSRGIRYGSYPRFTVYVKGQKVSIKFQIPPNCEVSQLIANLTAH  75

Query  508  LGLKLEDXGSGSDMILRAW  564
            LG K E  G GSDM+LRAW
Sbjct  76   LGTKAEGHGGGSDMLLRAW  94



>ref|XP_006578510.1| PREDICTED: uncharacterized protein LOC100806110 isoform X5 [Glycine 
max]
Length=113

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            ++E A KE+ R+ EL++++G+  GSYPR+TV VKGQKV+IKFQ+PP CE+  LI  L + 
Sbjct  16   VQESAKKERERIEELLRSRGIRYGSYPRFTVYVKGQKVSIKFQIPPNCEVSQLIANLTAH  75

Query  508  LGLKLEDXGSGSDMILRAW  564
            LG K E  G GSDM+LRAW
Sbjct  76   LGTKAEGHGGGSDMLLRAW  94



>ref|XP_006449811.1| hypothetical protein CICLE_v10014675mg [Citrus clementina]
 gb|ESR63051.1| hypothetical protein CICLE_v10014675mg [Citrus clementina]
Length=592

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  337  LAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGL  516
            +A KE++R+ EL+K KGM  GS P +TVAVKGQKV IKFQVPP CEIP LI  LVS LGL
Sbjct  105  IAKKERHRIEELLKRKGMHYGSCPTFTVAVKGQKVTIKFQVPPACEIPQLIANLVSHLGL  164

Query  517  KLEDXGSGSDMILRAW  564
            K+E+ G GSDM LRAW
Sbjct  165  KVEEHGGGSDMGLRAW  180



>ref|XP_006449813.1| hypothetical protein CICLE_v10014675mg [Citrus clementina]
 gb|ESR63053.1| hypothetical protein CICLE_v10014675mg [Citrus clementina]
Length=597

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  337  LAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGL  516
            +A KE++R+ EL+K KGM  GS P +TVAVKGQKV IKFQVPP CEIP LI  LVS LGL
Sbjct  110  IAKKERHRIEELLKRKGMHYGSCPTFTVAVKGQKVTIKFQVPPACEIPQLIANLVSHLGL  169

Query  517  KLEDXGSGSDMILRAW  564
            K+E+ G GSDM LRAW
Sbjct  170  KVEEHGGGSDMGLRAW  185



>ref|XP_006578507.1| PREDICTED: uncharacterized protein LOC100806110 isoform X2 [Glycine 
max]
 ref|XP_006578508.1| PREDICTED: uncharacterized protein LOC100806110 isoform X3 [Glycine 
max]
Length=138

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            ++E A KE+ R+ EL++++G+  GSYPR+TV VKGQKV+IKFQ+PP CE+  LI  L + 
Sbjct  16   VQESAKKERERIEELLRSRGIRYGSYPRFTVYVKGQKVSIKFQIPPNCEVSQLIANLTAH  75

Query  508  LGLKLEDXGSGSDMILRAW  564
            LG K E  G GSDM+LRAW
Sbjct  76   LGTKAEGHGGGSDMLLRAW  94



>gb|EPS69768.1| hypothetical protein M569_04996 [Genlisea aurea]
Length=591

 Score =   108 bits (270),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +1

Query  295  SGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
            S   P+PN   L+++A  EK RL EL++  G   G YPR++VAVKGQKV+  FQVPP+CE
Sbjct  96   SAQAPSPNK--LQDIARVEKARLEELLRKNGARYGFYPRFSVAVKGQKVSFSFQVPPSCE  153

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            IP+LI+KLVSRLG+   D G+GSDM+LR W
Sbjct  154  IPLLISKLVSRLGVNTSDNGAGSDMMLRVW  183



>ref|XP_004486193.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Cicer 
arietinum]
Length=575

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            ++E+A KE+ R+ EL+ T+G+  GSYPR+ VAVKGQKV+IKFQ+PP CE+  LI  L + 
Sbjct  90   VQEIAKKERQRIQELLTTRGIRQGSYPRFNVAVKGQKVSIKFQIPPGCEVSQLIANLTAH  149

Query  508  LGLKLEDXGSGSDMILRAW  564
            LGLK E  G GSDMILR+W
Sbjct  150  LGLKSEGNGGGSDMILRSW  168



>gb|KDO78373.1| hypothetical protein CISIN_1g047219mg [Citrus sinensis]
Length=567

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 111/183 (61%), Gaps = 5/183 (3%)
 Frame = +1

Query  31   MASLARMLRCSRAIASLKTLASSSTHLPPTLPNRPLVHQLHISAHQGPHSRSI-----PG  195
            MASL R+ + +     L    +S    P  LP+R L  Q+  SA +    + +     P 
Sbjct  1    MASLRRLAKTASVWRVLTASRASPRGQPRRLPHRSLEQQIRFSASEIQRPKLLDDTPGPS  60

Query  196  FMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELI  375
             + PA+LAGL GVG L++A AD D+ +        S  + ++  LEE+A KE+ R+ EL+
Sbjct  61   SIHPAILAGLFGVGALNIAYADGDQGAGTAKPSLPSESSSSYENLEEIAKKERQRIEELL  120

Query  376  KTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMIL  555
            K KGM  GS P +TVAVKGQKV IKFQVPP CEIP LI  LVS LGLK+E+ G GSDM L
Sbjct  121  KRKGMHYGSCPTFTVAVKGQKVTIKFQVPPACEIPQLIANLVSHLGLKVEEHGGGSDMGL  180

Query  556  RAW  564
            RAW
Sbjct  181  RAW  183



>ref|XP_010057885.1| PREDICTED: 26S protease regulatory subunit 6B homolog isoform 
X1 [Eucalyptus grandis]
 gb|KCW75231.1| hypothetical protein EUGRSUZ_E03984 [Eucalyptus grandis]
Length=603

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 65/96 (68%), Gaps = 5/96 (5%)
 Frame = +1

Query  292  PSGSPPTPNHS-----FLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQ  456
            P  SPP  + S      LEE+A  E+ R+ E +KTKGM  GSYPR++V VKGQKV +KFQ
Sbjct  99   PVESPPLQSESPSVGEKLEEIARTERQRVEESLKTKGMHYGSYPRFSVGVKGQKVTLKFQ  158

Query  457  VPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            VPP CEI  LI  LVS LG+K E+   GSD++LR W
Sbjct  159  VPPACEISQLIANLVSNLGVKAEEHSGGSDVLLRGW  194



>ref|XP_006467371.1| PREDICTED: peroxisomal ATPase pex1-like [Citrus sinensis]
Length=595

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 111/183 (61%), Gaps = 5/183 (3%)
 Frame = +1

Query  31   MASLARMLRCSRAIASLKTLASSSTHLPPTLPNRPLVHQLHISAHQGPHSRSI-----PG  195
            MASL R+ + +     L    +S    P  LP+R L  Q+  SA +    + +     P 
Sbjct  1    MASLRRLAKTASVWRVLTASRASPRGQPRRLPHRSLEQQIRFSASEIQRPKLLDDTPGPS  60

Query  196  FMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELI  375
             + PA+LAGL GVG L++A AD D+ +        S  + ++  LEE+A KE+ R+ EL+
Sbjct  61   SIHPAILAGLFGVGALNIAYADGDQGAGTAKPSLPSESSSSYENLEEIAKKERQRIEELL  120

Query  376  KTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMIL  555
            K KGM  GS P +TVAVKGQKV IKFQVPP CEIP LI  LVS LGLK+E+ G GSDM L
Sbjct  121  KRKGMHYGSCPTFTVAVKGQKVTIKFQVPPACEIPQLIANLVSHLGLKVEEHGGGSDMGL  180

Query  556  RAW  564
            RAW
Sbjct  181  RAW  183



>ref|XP_004134780.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
[Cucumis sativus]
 gb|KGN49077.1| hypothetical protein Csa_6G512920 [Cucumis sativus]
Length=585

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 117/189 (62%), Gaps = 23/189 (12%)
 Frame = +1

Query  31   MASLARMLRCSRA---IASLKTLASSSTHLPPTLPNRPLVHQLHISAHQGPHSRSI---P  192
            M+ L R+ R +RA   +AS K   SSS        +  L H  H   H  P S S    P
Sbjct  1    MSVLNRISRTARAWRILASFKLKESSSAS-----QSFYLRHFGHQPEHFKPGSLSNGREP  55

Query  193  GFMVPavlagllgvglldvaaadadETSSGTALPSGSPPTPN----HSFLEELAMKEKNR  360
             F+ PA++AG++GVG +++A A+A+E++S       +PP P     H+ +E++A KE+ R
Sbjct  56   CFLYPAIVAGMVGVGAMEIAYAEAEESTS-------TPPPPRDLSTHADMEDIAKKERLR  108

Query  361  LGELIK-TKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGS  537
            + E +K  KG   G+ PR+TV VKGQKV+IKFQVPP+CE+  LI  LVS LGLK+E+   
Sbjct  109  ITEQLKRNKGTKYGACPRFTVGVKGQKVSIKFQVPPSCEVSHLIANLVSNLGLKVEETAG  168

Query  538  GSDMILRAW  564
            GSDM+LRAW
Sbjct  169  GSDMLLRAW  177



>gb|KFK30962.1| hypothetical protein AALP_AA6G050000 [Arabis alpina]
Length=564

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +1

Query  301  SPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIP  480
            SP  P  S+++ +A KE+ R+ ELIK+KG   GSYPR+ VA++GQK+ +KFQVP TCE+ 
Sbjct  75   SPIDPPQSYVD-IAKKERARIEELIKSKGTRTGSYPRFDVALRGQKITLKFQVPSTCEVT  133

Query  481  VLITKLVSRLGLKLEDXGSGSDMILRAW  564
             LI  + S+LG+K+ D   GSDM+LRAW
Sbjct  134  QLIANIGSQLGVKVSDQTGGSDMLLRAW  161



>ref|XP_011460019.1| PREDICTED: uncharacterized protein LOC101304945 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            E +S    P+ +P + N   +E++A K++  + + +K+KGM  G+YP +TV+VKGQKV +
Sbjct  93   EAASKQGFPADAPVSNN---VEDIAKKQRQDIEDRLKSKGMRRGTYPNFTVSVKGQKVTV  149

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQ+PP+CE   +I  + S LGLK+E+ G GSD+ LRAW
Sbjct  150  KFQIPPSCEASQVIANIASNLGLKVEENGGGSDISLRAW  188



>ref|XP_002518418.1| 26S protease regulatory subunit, putative [Ricinus communis]
 gb|EEF43805.1| 26S protease regulatory subunit, putative [Ricinus communis]
Length=587

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            LEE+A KE+ R+  L+K +G+  GSYPR+ VAVKGQKV IKFQ+PP C+   LI  LVS 
Sbjct  99   LEEIATKERQRIEGLLKLRGIKNGSYPRFMVAVKGQKVTIKFQIPPACDALHLIANLVSN  158

Query  508  LGLKLEDXGSGSDMILRAW  564
            LGLK+++   GSDM+LRAW
Sbjct  159  LGLKVDERAGGSDMLLRAW  177



>ref|XP_004166040.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
[Cucumis sativus]
Length=521

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = +1

Query  301  SPPTPN----HSFLEELAMKEKNRLGELIK-TKGMLIGSYPRYTVAVKGQKVAIKFQVPP  465
            +PP P     H+ +E++A KE+ R+ E +K  KG   G+ PR+TV VKGQKV+IKFQVPP
Sbjct  20   TPPPPRDLSTHADMEDIAKKERLRITEQLKRNKGTKYGACPRFTVGVKGQKVSIKFQVPP  79

Query  466  TCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +CE+  LI  LVS LGLK+E+   GSDM+LRAW
Sbjct  80   SCEVSHLIANLVSNLGLKVEETAGGSDMLLRAW  112



>ref|XP_008384107.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Malus domestica]
Length=586

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            E  S  ALP+  P + +H  L+E+  K++ ++ +L+++KG+  G YP +TVAVKGQKV+I
Sbjct  75   EDISKPALPADPPASESHVDLDEITKKQRQQILDLLRSKGIGRGFYPPFTVAVKGQKVSI  134

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQ+PP CE   LI  L S LG+K+E+ G G DM LRAW
Sbjct  135  KFQIPPACEASQLIANLASHLGVKVEERGGGLDMSLRAW  173



>ref|XP_004293327.2| PREDICTED: probable 26S protease regulatory subunit 10B isoform 
X1 [Fragaria vesca subsp. vesca]
Length=606

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            E +S    P+ +P + N   +E++A K++  + + +K+KGM  G+YP +TV+VKGQKV +
Sbjct  93   EAASKQGFPADAPVSNN---VEDIAKKQRQDIEDRLKSKGMRRGTYPNFTVSVKGQKVTV  149

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQ+PP+CE   +I  + S LGLK+E+ G GSD+ LRAW
Sbjct  150  KFQIPPSCEASQVIANIASNLGLKVEENGGGSDISLRAW  188



>ref|XP_008440046.1| PREDICTED: probable 26S protease regulatory subunit 10B isoform 
X5 [Cucumis melo]
Length=520

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 68/95 (72%), Gaps = 5/95 (5%)
 Frame = +1

Query  295  SGSPPTPN----HSFLEELAMKEKNRLGE-LIKTKGMLIGSYPRYTVAVKGQKVAIKFQV  459
            + +PP P     H+ +E++A KE+ R+ E L + KG   G+ PR+TV VKGQKV+IKFQV
Sbjct  11   AATPPPPKDLSTHADMEDVAKKERLRIIEQLNRNKGTKYGACPRFTVGVKGQKVSIKFQV  70

Query  460  PPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            PP+CE+  LI  LVS LGLK+E+   GSDM+LRAW
Sbjct  71   PPSCEVSHLIANLVSNLGLKVEESAGGSDMLLRAW  105



>ref|XP_009357497.1| PREDICTED: cell division control protein 48 homolog C-like [Pyrus 
x bretschneideri]
Length=586

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            E  S  ALP+  P + +H  LEE+  K++ ++ +L+++KG+  G YP +TVAVKGQKV+I
Sbjct  75   EDISKPALPADPPASGSHVDLEEITKKQRQQILDLLRSKGIGRGFYPPFTVAVKGQKVSI  134

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQ+PP CE   LI  + S LG+K+E+ G G DM LRAW
Sbjct  135  KFQIPPACEASQLIANIASHLGVKVEERGGGLDMSLRAW  173



>ref|XP_003547270.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
 gb|KHN32990.1| Cell division cycle protein 48 like [Glycine soja]
Length=573

 Score =   102 bits (255),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            ++E A KE+ R+ EL++++G+  GSYPR+TV+VKGQKV+IKFQ+PP CE+  LI  L + 
Sbjct  85   VQESAKKERERIEELLRSRGIRYGSYPRFTVSVKGQKVSIKFQIPPNCEVSQLIANLTAH  144

Query  508  LGLKLEDXGSGSDMILRAW  564
            LG K E  G GSDM+LRAW
Sbjct  145  LGTKAEGHGGGSDMLLRAW  163



>ref|XP_009114584.1| PREDICTED: ATPase family gene 2 protein [Brassica rapa]
Length=609

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 72/99 (73%), Gaps = 5/99 (5%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            E S+ +++P+   P PN++   ++A KE+ R+ ELI++KG   GS+PR+ V+V+GQK+ +
Sbjct  111  EVSNKSSVPA--DPPPNYA---DIAKKERARIQELIQSKGTQYGSFPRFNVSVRGQKITL  165

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQVP TCE+  LI  + S+LG+K+ D   GSDMILR+W
Sbjct  166  KFQVPSTCEVAQLIANIGSQLGVKVSDRTGGSDMILRSW  204



>ref|XP_010236144.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 1 [Brachypodium 
distachyon]
Length=588

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +1

Query  304  PPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPV  483
            P + + +  E+LA KEK R+ ELI+++GM +GSYP++ VA+KGQKV +KF VP TC I  
Sbjct  104  PVSADAAVGEDLARKEKKRIMELIESRGMPLGSYPQFDVAMKGQKVVVKFNVPSTCNISC  163

Query  484  LITKLVSRLGLKLEDXGSGSDMILRAW  564
            LI  LV  LGL+ E  G GS+M+LRAW
Sbjct  164  LIVDLVKHLGLEAEQFGGGSEMLLRAW  190



>ref|XP_002872681.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48940.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
Length=602

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +1

Query  307  PTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVL  486
            P PN+    ++A KE+ R+ ELI +KG   GSYPR+ VAV+GQK+ +KFQVP TCE+  L
Sbjct  117  PPPNYV---DIAKKERARIEELISSKGTQYGSYPRFNVAVRGQKITLKFQVPSTCEVAQL  173

Query  487  ITKLVSRLGLKLEDXGSGSDMILRAW  564
            I+ + S+LG+K+ D   GSDM+LRAW
Sbjct  174  ISNIGSQLGVKVSDRTGGSDMLLRAW  199



>ref|XP_008440045.1| PREDICTED: spastin isoform X4 [Cucumis melo]
Length=533

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = +1

Query  301  SPPTPN----HSFLEELAMKEKNRLGE-LIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPP  465
            +PP P     H+ +E++A KE+ R+ E L + KG   G+ PR+TV VKGQKV+IKFQVPP
Sbjct  85   TPPPPKDLSTHADMEDVAKKERLRIIEQLNRNKGTKYGACPRFTVGVKGQKVSIKFQVPP  144

Query  466  TCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +CE+  LI  LVS LGLK+E+   GSDM+LRAW
Sbjct  145  SCEVSHLIANLVSNLGLKVEESAGGSDMLLRAW  177



>emb|CDY16679.1| BnaA09g20570D [Brassica napus]
Length=195

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 8/94 (9%)
 Frame = +1

Query  307  PTPNHSFL--------EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVP  462
            P PNHS L         ++A KE+ R+ ELI++KG   GS PR+ V+V+GQK+ +KFQVP
Sbjct  100  PPPNHSSLPADPPPNYADIAKKERARIQELIQSKGSQYGSLPRFNVSVRGQKITLKFQVP  159

Query  463  PTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
             TCE+  LI  + S+LG K+ D   GSDM+LR+W
Sbjct  160  STCEVAQLIANIGSQLGAKVSDRTGGSDMMLRSW  193



>ref|XP_008440044.1| PREDICTED: spastin isoform X3 [Cucumis melo]
Length=586

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = +1

Query  301  SPPTPN----HSFLEELAMKEKNRLGE-LIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPP  465
            +PP P     H+ +E++A KE+ R+ E L + KG   G+ PR+TV VKGQKV+IKFQVPP
Sbjct  85   TPPPPKDLSTHADMEDVAKKERLRIIEQLNRNKGTKYGACPRFTVGVKGQKVSIKFQVPP  144

Query  466  TCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +CE+  LI  LVS LGLK+E+   GSDM+LRAW
Sbjct  145  SCEVSHLIANLVSNLGLKVEESAGGSDMLLRAW  177



>ref|XP_008440042.1| PREDICTED: spastin isoform X1 [Cucumis melo]
Length=592

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = +1

Query  301  SPPTPN----HSFLEELAMKEKNRLGE-LIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPP  465
            +PP P     H+ +E++A KE+ R+ E L + KG   G+ PR+TV VKGQKV+IKFQVPP
Sbjct  85   TPPPPKDLSTHADMEDVAKKERLRIIEQLNRNKGTKYGACPRFTVGVKGQKVSIKFQVPP  144

Query  466  TCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +CE+  LI  LVS LGLK+E+   GSDM+LRAW
Sbjct  145  SCEVSHLIANLVSNLGLKVEESAGGSDMLLRAW  177



>ref|XP_008440043.1| PREDICTED: probable 26S protease regulatory subunit 10B isoform 
X2 [Cucumis melo]
Length=590

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = +1

Query  301  SPPTPN----HSFLEELAMKEKNRLGE-LIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPP  465
            +PP P     H+ +E++A KE+ R+ E L + KG   G+ PR+TV VKGQKV+IKFQVPP
Sbjct  85   TPPPPKDLSTHADMEDVAKKERLRIIEQLNRNKGTKYGACPRFTVGVKGQKVSIKFQVPP  144

Query  466  TCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +CE+  LI  LVS LGLK+E+   GSDM+LRAW
Sbjct  145  SCEVSHLIANLVSNLGLKVEESAGGSDMLLRAW  177



>emb|CDY71527.1| BnaAnng37770D, partial [Brassica napus]
Length=263

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            E S+ ++LP+   P PN++   ++A KE+ R+ ELI++KG   GS PR+ V+V+GQK+ +
Sbjct  82   EVSNKSSLPA--DPPPNYA---DIAKKERARIQELIQSKGSQYGSLPRFNVSVRGQKITL  136

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQVP TCE+  LI  + S+LG K+ D   GSDM+LR+W
Sbjct  137  KFQVPSTCEVAQLIANIGSQLGAKVSDRTGGSDMMLRSW  175



>gb|KEH36940.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=576

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            ++E+A+KE+ R+ +L+ TKG+   S PR+ VAVKGQKV+IKFQ+PP CE+  +I  L + 
Sbjct  92   VQEIAIKERQRIQDLLTTKGIRPSSVPRFNVAVKGQKVSIKFQIPPGCEVSQVIANLTAH  151

Query  508  LGLKLEDXGSGSDMILRAW  564
            LGLK E  G GSDMILRAW
Sbjct  152  LGLKSEGHGGGSDMILRAW  170



>gb|KEH36938.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=577

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            ++E+A+KE+ R+ +L+ TKG+   S PR+ VAVKGQKV+IKFQ+PP CE+  +I  L + 
Sbjct  92   VQEIAIKERQRIQDLLTTKGIRPSSVPRFNVAVKGQKVSIKFQIPPGCEVSQVIANLTAH  151

Query  508  LGLKLEDXGSGSDMILRAW  564
            LGLK E  G GSDMILRAW
Sbjct  152  LGLKSEGHGGGSDMILRAW  170



>ref|XP_004304993.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Fragaria vesca subsp. vesca]
Length=592

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = +1

Query  286  ALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPP  465
            A   G P   N+  +EE A K++  + +L+K KG+  GS P +TV+VKGQKV IKFQ+PP
Sbjct  98   ASKQGLPADANN--MEEAAKKQRQEIEDLLKRKGIRGGSIPNFTVSVKGQKVTIKFQIPP  155

Query  466  TCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            TCE   LI  +VS LGLK+E+ G GSD+ LRAW
Sbjct  156  TCEASQLIANIVSNLGLKVEEHGGGSDVSLRAW  188



>ref|XP_010433019.1| PREDICTED: probable 26S protease regulatory subunit 10B [Camelina 
sativa]
Length=589

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +1

Query  307  PTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVL  486
            P PN+    ++A KE+ R+ ELI++KG   GSYPR+ VAV+GQKV +KFQVP TCE+  L
Sbjct  104  PPPNYV---DIAKKERTRIEELIQSKGTQYGSYPRFNVAVRGQKVTLKFQVPSTCEVAQL  160

Query  487  ITKLVSRLGLKLEDXGSGSDMILRAW  564
            I+ + S+LG+K+ D   GSDM+LRAW
Sbjct  161  ISNIGSQLGVKVSDRTGGSDMLLRAW  186



>ref|XP_008793792.1| PREDICTED: uncharacterized protein LOC103710008 isoform X3 [Phoenix 
dactylifera]
Length=553

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  SGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
            + S   P+    E L  +EK R+ EL++++GM  GSYP ++VA KGQKV +KF++P TCE
Sbjct  101  AASDSVPSFGGTESLVSQEKQRIEELLRSRGMPRGSYPPFSVAAKGQKVIVKFKIPSTCE  160

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +  LI  LV+ LGLK E  GSGS+M+LRAW
Sbjct  161  VSHLIVDLVTHLGLKAEQHGSGSEMLLRAW  190



>ref|XP_008793793.1| PREDICTED: uncharacterized protein LOC103710008 isoform X4 [Phoenix 
dactylifera]
Length=527

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  SGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
            + S   P+    E L  +EK R+ EL++++GM  GSYP ++VA KGQKV +KF++P TCE
Sbjct  101  AASDSVPSFGGTESLVSQEKQRIEELLRSRGMPRGSYPPFSVAAKGQKVIVKFKIPSTCE  160

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +  LI  LV+ LGLK E  GSGS+M+LRAW
Sbjct  161  VSHLIVDLVTHLGLKAEQHGSGSEMLLRAW  190



>ref|XP_008793790.1| PREDICTED: meiotic spindle formation protein mei-1 isoform X1 
[Phoenix dactylifera]
Length=597

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  SGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
            + S   P+    E L  +EK R+ EL++++GM  GSYP ++VA KGQKV +KF++P TCE
Sbjct  101  AASDSVPSFGGTESLVSQEKQRIEELLRSRGMPRGSYPPFSVAAKGQKVIVKFKIPSTCE  160

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +  LI  LV+ LGLK E  GSGS+M+LRAW
Sbjct  161  VSHLIVDLVTHLGLKAEQHGSGSEMLLRAW  190



>ref|XP_008793791.1| PREDICTED: uncharacterized protein LOC103710008 isoform X2 [Phoenix 
dactylifera]
Length=571

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  SGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
            + S   P+    E L  +EK R+ EL++++GM  GSYP ++VA KGQKV +KF++P TCE
Sbjct  101  AASDSVPSFGGTESLVSQEKQRIEELLRSRGMPRGSYPPFSVAAKGQKVIVKFKIPSTCE  160

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            +  LI  LV+ LGLK E  GSGS+M+LRAW
Sbjct  161  VSHLIVDLVTHLGLKAEQHGSGSEMLLRAW  190



>ref|XP_010539308.1| PREDICTED: uncharacterized protein LOC104813427 [Tarenaya hassleriana]
 ref|XP_010539316.1| PREDICTED: uncharacterized protein LOC104813427 [Tarenaya hassleriana]
Length=591

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +1

Query  295  SGSPPTPNHSFLE--ELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPT  468
             G P +P  S     ++A KE+ R+ EL+++K M  GS PR+ VA+KGQK  IKFQ+PPT
Sbjct  94   DGKPSSPKDSTANYVDMAKKERARIEELLRSKEMHHGSIPRFNVAIKGQKTTIKFQIPPT  153

Query  469  CEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            CE+  LI  + S+LG+K+ +  SGSDMILRAW
Sbjct  154  CEVAQLIANVGSQLGVKVAERPSGSDMILRAW  185



>gb|EEC73974.1| hypothetical protein OsI_08877 [Oryza sativa Indica Group]
Length=612

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA KE+ R+ ELI+++GM  GSYP++ VAVKGQKV +KF VP TC +  LI  LV+ +
Sbjct  125  EDLAHKERKRIMELIQSRGMPHGSYPQFDVAVKGQKVVVKFNVPSTCSLSDLIVDLVTHI  184

Query  511  GLKLEDXGSGSDMILRAW  564
            GL+ E  G GS+M+LRAW
Sbjct  185  GLEAEQGGGGSEMLLRAW  202



>ref|XP_010496163.1| PREDICTED: 26S protease regulatory subunit 7-like [Camelina sativa]
Length=587

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 65/92 (71%), Gaps = 5/92 (5%)
 Frame = +1

Query  289  LPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPT  468
            +P  SPP        ++A KE+ R+ ELI++KG   GSYPR+ VAV+GQKV +KFQVP T
Sbjct  100  VPIDSPPN-----YVDIAKKERARIEELIQSKGTQYGSYPRFNVAVRGQKVTLKFQVPST  154

Query  469  CEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            CE+  LI+ + S+LG+K+ D   GSDM+LRAW
Sbjct  155  CEVAQLISNIGSQLGVKVSDRTGGSDMLLRAW  186



>ref|NP_001048071.1| Os02g0740300 [Oryza sativa Japonica Group]
 dbj|BAD15754.1| putative AAA family ATPase [Oryza sativa Japonica Group]
 dbj|BAF09985.1| Os02g0740300 [Oryza sativa Japonica Group]
 dbj|BAG90630.1| unnamed protein product [Oryza sativa Japonica Group]
Length=611

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA KE+ R+ ELI+++GM  GSYP++ VAVKGQKV +KF VP TC +  LI  LV+ +
Sbjct  124  EDLAHKERKRIIELIQSRGMPHGSYPQFDVAVKGQKVVVKFNVPSTCSLSDLIVDLVTHI  183

Query  511  GLKLEDXGSGSDMILRAW  564
            GL+ E  G GS+M+LRAW
Sbjct  184  GLEAEQGGGGSEMLLRAW  201



>gb|EEE57779.1| hypothetical protein OsJ_08323 [Oryza sativa Japonica Group]
Length=612

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA KE+ R+ ELI+++GM  GSYP++ VAVKGQKV +KF VP TC +  LI  LV+ +
Sbjct  125  EDLAHKERKRIIELIQSRGMPHGSYPQFDVAVKGQKVVVKFNVPSTCSLSDLIVDLVTHI  184

Query  511  GLKLEDXGSGSDMILRAW  564
            GL+ E  G GS+M+LRAW
Sbjct  185  GLEAEQGGGGSEMLLRAW  202



>ref|NP_192327.3| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AEE82370.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=609

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +1

Query  307  PTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVL  486
            P PN+    ++A KE+ R+ ELI++KG   GSYPR+ VAV+GQK+ +KFQVP TCE+  L
Sbjct  115  PPPNYV---DIAKKERARVEELIQSKGTQYGSYPRFNVAVRGQKITLKFQVPSTCEVAQL  171

Query  487  ITKLVSRLGLKLEDXGSGSDMILRAW  564
            I+ + S+LG+K+ D   GSDM+LRAW
Sbjct  172  ISNIGSQLGVKVSDRTGGSDMLLRAW  197



>ref|XP_006290067.1| hypothetical protein CARUB_v10003705mg [Capsella rubella]
 gb|EOA22965.1| hypothetical protein CARUB_v10003705mg [Capsella rubella]
Length=595

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +1

Query  307  PTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVL  486
            P PN+    ++A KE+ R+ ELI++KG   GSYPR+ VAV+GQK+ +KFQVP TCE+  L
Sbjct  102  PPPNYV---DIAKKERARVEELIQSKGTQYGSYPRFNVAVRGQKITLKFQVPSTCEVGQL  158

Query  487  ITKLVSRLGLKLEDXGSGSDMILRAW  564
            I+ + S+LG+K+ D   GSDM+LRAW
Sbjct  159  ISNIGSQLGVKVSDRTGGSDMLLRAW  184



>ref|XP_007147681.1| hypothetical protein PHAVU_006G145500g [Phaseolus vulgaris]
 gb|ESW19675.1| hypothetical protein PHAVU_006G145500g [Phaseolus vulgaris]
Length=573

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            ++E A  E+ R+ EL++++G+  GSYP ++VAVKGQKV+IKFQ+P  CEI  LI  L + 
Sbjct  85   VQERAKNERQRIEELMRSRGIRYGSYPSFSVAVKGQKVSIKFQIPHGCEISQLIANLTAN  144

Query  508  LGLKLEDXGSGSDMILRAW  564
            LG K E  G GSDM+LRAW
Sbjct  145  LGTKAEGHGGGSDMLLRAW  163



>ref|XP_010686771.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Beta vulgaris 
subsp. vulgaris]
Length=592

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 9/99 (9%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            E S+ ++ PS  P T  +  LEE A KE+ +L +LI+TKGM  GSYPR+ VAVKGQK+AI
Sbjct  93   EVSTKSSSPSEIPST--YDDLEETAKKERRKLEDLIRTKGMKYGSYPRFAVAVKGQKIAI  150

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQVP  CEIP LI  L S L         GS M +++W
Sbjct  151  KFQVPSNCEIPRLIANLASNL-------NGGSPMDIQSW  182



>emb|CDX94544.1| BnaC09g22920D [Brassica napus]
Length=609

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 5/99 (5%)
 Frame = +1

Query  268  ETSSGTALPSGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAI  447
            E S+ +++P+   P PN++   ++A KE+ R+ ELI++KG    S PR+ V V+GQK+ +
Sbjct  113  EISNKSSVPA--DPPPNYA---DIAKKERARIQELIQSKGSQYSSCPRFNVFVRGQKITL  167

Query  448  KFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KFQVP TCE+  LI  + S+LG+K+ D   GSDM+LR+W
Sbjct  168  KFQVPSTCEVAQLIANIGSQLGVKVSDRTGGSDMMLRSW  206



>dbj|BAK06484.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            +E+LA KE+ R+ ELI+++GM  GSYP++ VA+KGQKV +KF VP TC I  LI  LV+ 
Sbjct  131  VEDLAGKERKRIMELIESRGMQPGSYPKFEVAIKGQKVVVKFNVPSTCNISRLIVDLVTH  190

Query  508  LGLKLEDXGSGSDMILRAW  564
            +GL+ E    GS+M+ RAW
Sbjct  191  IGLEAEQCVGGSEMLFRAW  209



>ref|XP_004953904.1| PREDICTED: protein MSP1-like isoform X2 [Setaria italica]
Length=565

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA KEK R+ EL++++GM  GSYP++ VA+KGQKV +KF +P TC I  LI  LV+ +
Sbjct  114  EDLARKEKRRIMELVQSRGMQRGSYPQFDVAMKGQKVVVKFNMPSTCNISHLIVDLVTHI  173

Query  511  GLKLEDXGSGSDMILRAW  564
            GL+ E  G GS++++RAW
Sbjct  174  GLEAEQHGGGSEVLVRAW  191



>gb|EMT08829.1| Protein cdcH [Aegilops tauschii]
Length=610

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  LEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSR  507
            +E+LA KE+ R+ ELI+++GM  GSYP++ VA+KGQKV +KF VP TC I  LI  LV+ 
Sbjct  110  VEDLARKERKRIMELIESRGMQPGSYPKFEVAIKGQKVVVKFNVPSTCNISRLIVDLVTH  169

Query  508  LGLKLEDXGSGSDMILRAW  564
            +GL+ E    GS+++LRAW
Sbjct  170  IGLEAEQCVGGSEILLRAW  188



>ref|XP_004953903.1| PREDICTED: protein MSP1-like isoform X1 [Setaria italica]
Length=593

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA KEK R+ EL++++GM  GSYP++ VA+KGQKV +KF +P TC I  LI  LV+ +
Sbjct  114  EDLARKEKRRIMELVQSRGMQRGSYPQFDVAMKGQKVVVKFNMPSTCNISHLIVDLVTHI  173

Query  511  GLKLEDXGSGSDMILRAW  564
            GL+ E  G GS++++RAW
Sbjct  174  GLEAEQHGGGSEVLVRAW  191



>ref|XP_006649032.1| PREDICTED: protein MSP1-like [Oryza brachyantha]
Length=521

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA +E+ R+ ELI++ GM  GSYP+Y VAVKGQKV +KF +P TC +  LI  LV+ +
Sbjct  38   EDLAHRERKRIMELIQSLGMPRGSYPQYDVAVKGQKVVVKFNLPSTCNLSHLIVDLVTHI  97

Query  511  GLKLEDXGSGSDMILRAW  564
            GL+ E  G GS+M+LRAW
Sbjct  98   GLEAELSGGGSEMLLRAW  115



>ref|XP_006396713.1| hypothetical protein EUTSA_v10028536mg [Eutrema salsugineum]
 gb|ESQ38166.1| hypothetical protein EUTSA_v10028536mg [Eutrema salsugineum]
Length=583

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +1

Query  307  PTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVL  486
            P PN+    ++A KE+ R+ ELI++KG   GSYPR+ VAV+ QK+ +KFQVP +CE+  L
Sbjct  102  PPPNYV---DVAKKERARVEELIQSKGTQYGSYPRFNVAVRSQKITLKFQVPSSCEVAQL  158

Query  487  ITKLVSRLGLKLEDXGSGSDMILRAW  564
            I  + ++LG+K+ D   GSDM+LRAW
Sbjct  159  IANIGTKLGVKVSDRTGGSDMLLRAW  184



>ref|XP_008646232.1| PREDICTED: uncharacterized protein LOC100216753 isoform X3 [Zea 
mays]
 ref|XP_008646233.1| PREDICTED: uncharacterized protein LOC100216753 isoform X3 [Zea 
mays]
Length=494

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA KE+ R+ EL++++GM  GSYP++ VAVKGQKV +KF +P  C +  LI  LV+ +
Sbjct  115  EDLARKERKRILELVQSRGMQRGSYPKFDVAVKGQKVVVKFNMPSNCNVSHLIVDLVTHI  174

Query  511  GLKLEDXGSGSDMILRAW  564
            GL+ E  G GS++++RAW
Sbjct  175  GLEAEQHGGGSEVLVRAW  192



>ref|XP_008646231.1| PREDICTED: uncharacterized protein LOC100216753 isoform X2 [Zea 
mays]
Length=535

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA KE+ R+ EL++++GM  GSYP++ VAVKGQKV +KF +P  C +  LI  LV+ +
Sbjct  115  EDLARKERKRILELVQSRGMQRGSYPKFDVAVKGQKVVVKFNMPSNCNVSHLIVDLVTHI  174

Query  511  GLKLEDXGSGSDMILRAW  564
            GL+ E  G GS++++RAW
Sbjct  175  GLEAEQHGGGSEVLVRAW  192



>ref|XP_008646230.1| PREDICTED: katanin p60 ATPase-containing subunit A1 isoform X1 
[Zea mays]
Length=588

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA KE+ R+ EL++++GM  GSYP++ VAVKGQKV +KF +P  C +  LI  LV+ +
Sbjct  115  EDLARKERKRILELVQSRGMQRGSYPKFDVAVKGQKVVVKFNMPSNCNVSHLIVDLVTHI  174

Query  511  GLKLEDXGSGSDMILRAW  564
            GL+ E  G GS++++RAW
Sbjct  175  GLEAEQHGGGSEVLVRAW  192



>ref|XP_010928222.1| PREDICTED: ATPase family AAA domain-containing protein 1-A isoform 
X4 [Elaeis guineensis]
Length=462

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  SGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
            + S   P+    E L  +E+ R+ E++++ GM  GSYP ++VA KGQKV +KF++PPTC 
Sbjct  105  AASDSLPSFGGTESLVDQERQRIEEMLRSMGMPRGSYPPFSVAAKGQKVIVKFKIPPTCV  164

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            I  LI  LV+ LG K E  G+GS+M+LRAW
Sbjct  165  ISHLIVDLVTHLGHKAEQNGNGSEMLLRAW  194



>ref|XP_006449812.1| hypothetical protein CICLE_v10014675mg [Citrus clementina]
 gb|ESR63052.1| hypothetical protein CICLE_v10014675mg [Citrus clementina]
Length=471

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  388  MLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            M  GS P +TVAVKGQKV IKFQVPP CEIP LI  LVS LGLK+E+ G GSDM LRAW
Sbjct  1    MHYGSCPTFTVAVKGQKVTIKFQVPPACEIPQLIANLVSHLGLKVEEHGGGSDMGLRAW  59



>ref|XP_010928220.1| PREDICTED: ATPase family AAA domain-containing protein 1-B isoform 
X3 [Elaeis guineensis]
Length=511

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  SGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
            + S   P+    E L  +E+ R+ E++++ GM  GSYP ++VA KGQKV +KF++PPTC 
Sbjct  15   AASDSLPSFGGTESLVDQERQRIEEMLRSMGMPRGSYPPFSVAAKGQKVIVKFKIPPTCV  74

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            I  LI  LV+ LG K E  G+GS+M+LRAW
Sbjct  75   ISHLIVDLVTHLGHKAEQNGNGSEMLLRAW  104



>ref|XP_010928219.1| PREDICTED: uncharacterized protein LOC105050063 isoform X2 [Elaeis 
guineensis]
Length=568

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  SGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
            + S   P+    E L  +E+ R+ E++++ GM  GSYP ++VA KGQKV +KF++PPTC 
Sbjct  105  AASDSLPSFGGTESLVDQERQRIEEMLRSMGMPRGSYPPFSVAAKGQKVIVKFKIPPTCV  164

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            I  LI  LV+ LG K E  G+GS+M+LRAW
Sbjct  165  ISHLIVDLVTHLGHKAEQNGNGSEMLLRAW  194



>ref|XP_010928218.1| PREDICTED: uncharacterized protein LOC105050063 isoform X1 [Elaeis 
guineensis]
Length=601

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  SGSPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCE  474
            + S   P+    E L  +E+ R+ E++++ GM  GSYP ++VA KGQKV +KF++PPTC 
Sbjct  105  AASDSLPSFGGTESLVDQERQRIEEMLRSMGMPRGSYPPFSVAAKGQKVIVKFKIPPTCV  164

Query  475  IPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            I  LI  LV+ LG K E  G+GS+M+LRAW
Sbjct  165  ISHLIVDLVTHLGHKAEQNGNGSEMLLRAW  194



>ref|XP_010433030.1| PREDICTED: uncharacterized protein LOC104717188 isoform X1 [Camelina 
sativa]
Length=195

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = +1

Query  301  SPPTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIP  480
            S   PN+    ++A KE+ R+ ELI++KG   GSYPR+ VAV+GQK+ +KFQVP TCE+ 
Sbjct  90   SDEIPNYV---DIAKKERARIEELIQSKGNQYGSYPRFNVAVRGQKITLKFQVPSTCEVA  146

Query  481  VLITKLVSRLGLKLEDXGSGSDM  549
             LI+ + S+LG+K+ D   GS +
Sbjct  147  QLISNIGSQLGVKVSDRTGGSRL  169



>gb|AAC28233.1| contains similarity to ATPases associated with various cellular 
activities (Pfam: AAA.hmm, score: 155.05) [Arabidopsis thaliana]
 emb|CAB77886.1| putative vesicle transfer ATPase [Arabidopsis thaliana]
Length=536

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 8/86 (9%)
 Frame = +1

Query  307  PTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVL  486
            P PN+    ++A KE+ R+ ELI++KG   GSYPR+ VA+      +KFQVP TCE+  L
Sbjct  47   PPPNYV---DIAKKERARVEELIQSKGTQYGSYPRFNVAI-----TLKFQVPSTCEVAQL  98

Query  487  ITKLVSRLGLKLEDXGSGSDMILRAW  564
            I+ + S+LG+K+ D   GSDM+LRAW
Sbjct  99   ISNIGSQLGVKVSDRTGGSDMLLRAW  124



>ref|XP_009410259.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=595

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            +++  + K RL EL++TKGM  GSYP +TV+ KG KV IKF VPP CEI  LI  +V  L
Sbjct  116  DKIVRQVKQRLEELLRTKGMQRGSYPAFTVSAKGNKVTIKFIVPPACEISHLIVNIVKHL  175

Query  511  GLKLEDXGSGSDMILRAW  564
            G   E  G GS+M+LRAW
Sbjct  176  GEMAEHYGGGSEMLLRAW  193



>ref|XP_009410260.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=574

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            +++  + K RL EL++TKGM  GSYP +TV+ KG KV IKF VPP CEI  LI  +V  L
Sbjct  116  DKIVRQVKQRLEELLRTKGMQRGSYPAFTVSAKGNKVTIKFIVPPACEISHLIVNIVKHL  175

Query  511  GLKLEDXGSGSDMILRAW  564
            G   E  G GS+M+LRAW
Sbjct  176  GEMAEHYGGGSEMLLRAW  193



>ref|XP_006836682.1| hypothetical protein AMTR_s00088p00084700 [Amborella trichopoda]
 gb|ERM99535.1| hypothetical protein AMTR_s00088p00084700 [Amborella trichopoda]
Length=623

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  349  EKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLED  528
            E+ R+ EL++ KG+  GSYP + VAVKGQ+V ++FQVP  CE+  LI  LVSRLGLK + 
Sbjct  125  ERERVEELLRKKGLQRGSYPPFIVAVKGQQVTLRFQVPSHCEVHRLIVDLVSRLGLKTDL  184

Query  529  XGSGSDMILRAW  564
               GS+M L AW
Sbjct  185  HVGGSEMKLHAW  196



>ref|XP_002452576.1| hypothetical protein SORBIDRAFT_04g028420 [Sorghum bicolor]
 gb|EES05552.1| hypothetical protein SORBIDRAFT_04g028420 [Sorghum bicolor]
Length=543

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  331  EELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRL  510
            E+LA KE+ R+ EL++++GM  GSYP++ VAVKGQK+ +KF +P TC +  LI  LV+ +
Sbjct  111  EDLARKERKRILELVQSRGMQRGSYPQFDVAVKGQKLVVKFNMPSTCNVSHLIVDLVTHI  170

Query  511  GLKLEDXGSGSDMI  552
            G + E  G GS+++
Sbjct  171  GHEAEQLGGGSEVL  184



>ref|XP_008793794.1| PREDICTED: ATPase family AAA domain-containing protein 1-A isoform 
X5 [Phoenix dactylifera]
Length=466

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  397  GSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            GSYP ++VA KGQKV +KF++P TCE+  LI  LV+ LGLK E  GSGS+M+LRAW
Sbjct  4    GSYPPFSVAAKGQKVIVKFKIPSTCEVSHLIVDLVTHLGLKAEQHGSGSEMLLRAW  59



>gb|KEH36939.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=494

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  412  YTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            + V++   KV+IKFQ+PP CE+  +I  L + LGLK E  G GSDMILRAW
Sbjct  37   FLVSMSLLKVSIKFQIPPGCEVSQVIANLTAHLGLKSEGHGGGSDMILRAW  87



>emb|CDX83073.1| BnaA01g20730D [Brassica napus]
Length=380

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +1

Query  307  PTPNHSFLEELAMKEKNRLGELIKTKGMLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVL  486
            P PN++   ++A KE  R+ E I++KG    S PR+ V+++GQK+ +KF+VP +CE+P L
Sbjct  54   PPPNYA---DIARKEGTRIQEPIQSKGSQYCSCPRFNVSIRGQKITLKFKVPSSCEVPQL  110

Query  487  ITKLVSRLGLK  519
            I  + S    +
Sbjct  111  IANIGSHWWFR  121



>ref|XP_009381623.1| PREDICTED: cell division control protein 48-like [Musa acuminata 
subsp. malaccensis]
Length=455

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  388  MLIGSYPRYTVAVKGQKVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            M  GSYP YT++ +GQ+V IKF++PPTCE+  +IT LV  LG   +  G GS + L A+
Sbjct  1    MEKGSYPPYTLSARGQQVIIKFKIPPTCELSHIITDLVKNLGDTSKQLGGGSKIHLYAF  59



>ref|XP_010057886.1| PREDICTED: probable 26S protease regulatory subunit 10B isoform 
X2 [Eucalyptus grandis]
Length=508

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  436  KVAIKFQVPPTCEIPVLITKLVSRLGLKLEDXGSGSDMILRAW  564
            KV +KFQVPP CEI  LI  LVS LG+K E+   GSD++LR W
Sbjct  57   KVTLKFQVPPACEISQLIANLVSNLGVKAEEHSGGSDVLLRGW  99



Lambda      K        H        a         alpha
   0.316    0.130    0.381    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920