BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001I05

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009762874.1|  PREDICTED: F-box protein At1g47056-like            177   7e-49   Nicotiana sylvestris
ref|XP_009620452.1|  PREDICTED: F-box protein At1g47056-like            176   2e-48   Nicotiana tomentosiformis
ref|XP_006434705.1|  hypothetical protein CICLE_v10000831mg             170   2e-46   Citrus clementina [clementine]
gb|KDP41689.1|  hypothetical protein JCGZ_16096                         167   2e-45   Jatropha curcas
ref|XP_004238126.1|  PREDICTED: F-box protein At1g47056-like            162   2e-43   Solanum lycopersicum
ref|XP_009791823.1|  PREDICTED: F-box protein At1g47056-like            162   2e-43   Nicotiana sylvestris
ref|XP_010094658.1|  F-box protein                                      160   7e-43   Morus notabilis
ref|XP_006354845.1|  PREDICTED: F-box protein At1g47056-like            159   3e-42   Solanum tuberosum [potatoes]
ref|XP_011017158.1|  PREDICTED: F-box protein At1g47056-like            157   8e-42   Populus euphratica
ref|XP_007017145.1|  VIER F-box protein 1                               156   2e-41   
ref|XP_010270897.1|  PREDICTED: F-box protein At1g47056-like            156   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008351989.1|  PREDICTED: F-box protein At1g47056-like            155   4e-41   
ref|XP_009354159.1|  PREDICTED: F-box protein At1g47056-like            155   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_009598217.1|  PREDICTED: F-box protein At1g47056-like            155   5e-41   Nicotiana tomentosiformis
ref|XP_002301165.1|  F-box family protein                               154   9e-41   Populus trichocarpa [western balsam poplar]
gb|KJB14605.1|  hypothetical protein B456_002G133700                    154   1e-40   Gossypium raimondii
ref|XP_008220270.1|  PREDICTED: F-box protein At1g47056-like isof...    154   1e-40   Prunus mume [ume]
ref|XP_008220271.1|  PREDICTED: F-box protein At1g47056-like isof...    154   1e-40   Prunus mume [ume]
ref|XP_009360050.1|  PREDICTED: F-box protein At1g47056-like            154   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_011029349.1|  PREDICTED: F-box protein At1g47056-like            154   1e-40   Populus euphratica
ref|XP_004141272.1|  PREDICTED: F-box protein At1g47056-like            154   2e-40   Cucumis sativus [cucumbers]
ref|XP_008452600.1|  PREDICTED: F-box protein At1g47056-like            154   2e-40   Cucumis melo [Oriental melon]
ref|XP_010244251.1|  PREDICTED: F-box protein At1g47056-like            154   2e-40   Nelumbo nucifera [Indian lotus]
gb|KJB58522.1|  hypothetical protein B456_009G215400                    153   4e-40   Gossypium raimondii
emb|CDP01289.1|  unnamed protein product                                150   3e-39   Coffea canephora [robusta coffee]
gb|KJB63903.1|  hypothetical protein B456_010G022900                    150   4e-39   Gossypium raimondii
ref|XP_007225777.1|  hypothetical protein PRUPE_ppa004591mg             150   4e-39   
ref|XP_004291070.1|  PREDICTED: F-box protein At1g47056-like            149   8e-39   Fragaria vesca subsp. vesca
ref|XP_010555499.1|  PREDICTED: putative F-box/LRR-repeat protein...    149   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_010555498.1|  PREDICTED: putative F-box/LRR-repeat protein...    149   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_002284998.1|  PREDICTED: F-box protein At1g47056                 147   3e-38   Vitis vinifera
ref|XP_002510165.1|  skip-2, putative                                   147   3e-38   Ricinus communis
gb|KCW66359.1|  hypothetical protein EUGRSUZ_F00182                     142   5e-37   Eucalyptus grandis [rose gum]
ref|XP_010059893.1|  PREDICTED: F-box protein At1g47056-like            143   1e-36   Eucalyptus grandis [rose gum]
ref|XP_003550322.1|  PREDICTED: F-box protein At1g47056-like            142   4e-36   Glycine max [soybeans]
ref|XP_003544473.1|  PREDICTED: F-box protein At1g47056-like            139   2e-35   Glycine max [soybeans]
ref|XP_011074407.1|  PREDICTED: F-box protein At1g47056-like            139   4e-35   Sesamum indicum [beniseed]
gb|EYU36322.1|  hypothetical protein MIMGU_mgv1a010857mg                135   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_011069725.1|  PREDICTED: F-box protein At1g47056-like            138   6e-35   
ref|XP_006374882.1|  hypothetical protein POPTR_0014s02370g             137   1e-34   
ref|XP_003589128.1|  F-box protein                                      137   2e-34   Medicago truncatula
gb|EPS63306.1|  hypothetical protein M569_11480                         136   3e-34   Genlisea aurea
ref|XP_008813812.1|  PREDICTED: F-box protein At1g47056-like            134   1e-33   Phoenix dactylifera
ref|XP_007160881.1|  hypothetical protein PHAVU_001G024700g             134   2e-33   Phaseolus vulgaris [French bean]
ref|XP_010556431.1|  PREDICTED: putative F-box/LRR-repeat protein 8     134   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_011099097.1|  PREDICTED: F-box protein SKIP2                     132   9e-33   Sesamum indicum [beniseed]
ref|XP_009799715.1|  PREDICTED: F-box protein At1g47056-like            131   2e-32   Nicotiana sylvestris
ref|XP_009619626.1|  PREDICTED: F-box protein At1g47056-like            129   1e-31   Nicotiana tomentosiformis
ref|XP_006306435.1|  hypothetical protein CARUB_v10012377mg             128   2e-31   Capsella rubella
ref|XP_010911094.1|  PREDICTED: F-box protein At1g47056-like            128   2e-31   Elaeis guineensis
ref|XP_004231878.1|  PREDICTED: F-box protein SKIP2-like                128   2e-31   Solanum lycopersicum
ref|XP_010479114.1|  PREDICTED: F-box protein At1g47056 isoform X1      128   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010500236.1|  PREDICTED: F-box protein At1g47056-like            128   3e-31   Camelina sativa [gold-of-pleasure]
ref|NP_175151.1|  VIER F-box protein 1                                  127   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461510.1|  PREDICTED: F-box protein At1g47056-like            127   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004499020.1|  PREDICTED: F-box protein At1g47056-like            127   7e-31   Cicer arietinum [garbanzo]
ref|XP_002894031.1|  vier F-box protein 1                               126   8e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_006393625.1|  hypothetical protein EUTSA_v10011393mg             126   9e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010549251.1|  PREDICTED: F-box protein At1g47056-like            126   1e-30   Tarenaya hassleriana [spider flower]
gb|EYU44437.1|  hypothetical protein MIMGU_mgv1a027103mg                126   1e-30   Erythranthe guttata [common monkey flower]
ref|XP_010070601.1|  PREDICTED: F-box protein SKIP2-like                125   2e-30   Eucalyptus grandis [rose gum]
ref|XP_006339852.1|  PREDICTED: F-box protein SKIP2-like                125   2e-30   Solanum tuberosum [potatoes]
ref|XP_008797648.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...    119   3e-30   
ref|XP_008377999.1|  PREDICTED: F-box protein At1g47056-like            124   3e-30   
emb|CBI33774.3|  unnamed protein product                                122   4e-30   Vitis vinifera
ref|XP_006286719.1|  hypothetical protein CARUB_v10002927mg             125   5e-30   
ref|XP_010679539.1|  PREDICTED: F-box protein SKIP2                     124   6e-30   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP02535.1|  unnamed protein product                                124   6e-30   Coffea canephora [robusta coffee]
gb|AAP03878.1|  Avr9/Cf-9 rapidly elicited protein 189                  124   7e-30   Nicotiana tabacum [American tobacco]
ref|XP_006343196.1|  PREDICTED: F-box protein SKIP2-like                124   8e-30   Solanum tuberosum [potatoes]
gb|KFK44642.1|  hypothetical protein AALP_AA1G285200                    123   1e-29   Arabis alpina [alpine rockcress]
ref|XP_008799696.1|  PREDICTED: F-box protein At1g47056-like            123   1e-29   Phoenix dactylifera
ref|XP_002283593.1|  PREDICTED: F-box protein At1g47056 isoform X2      122   2e-29   Vitis vinifera
gb|EYU25467.1|  hypothetical protein MIMGU_mgv1a022622mg                122   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_004234661.1|  PREDICTED: F-box protein SKIP2-like                122   3e-29   Solanum lycopersicum
gb|KDO36473.1|  hypothetical protein CISIN_1g038746mg                   116   3e-29   Citrus sinensis [apfelsine]
gb|AAL07231.1|  putative SKP1 interacting partner SKIP2                 120   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006579900.1|  PREDICTED: F-box protein SKIP2-like isoform X1     122   3e-29   
ref|XP_010652772.1|  PREDICTED: F-box protein At1g47056 isoform X1      122   4e-29   Vitis vinifera
gb|KDO36634.1|  hypothetical protein CISIN_1g040130mg                   115   5e-29   Citrus sinensis [apfelsine]
ref|XP_010421728.1|  PREDICTED: putative F-box/LRR-repeat protein 8     121   5e-29   Camelina sativa [gold-of-pleasure]
emb|CAN59800.1|  hypothetical protein VITISV_038872                     124   5e-29   Vitis vinifera
ref|XP_002874480.1|  predicted protein                                  121   7e-29   
ref|XP_010095311.1|  F-box protein SKIP2                                120   2e-28   
ref|XP_003550997.1|  PREDICTED: F-box protein SKIP2-like                120   2e-28   Glycine max [soybeans]
dbj|BAE98487.1|  hypothetical protein                                   120   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_569047.1|  F-box protein SKIP2                                   120   2e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01426.1|  BnaA07g11990D                                          122   2e-28   
emb|CDY12824.1|  BnaC07g16090D                                          122   3e-28   Brassica napus [oilseed rape]
emb|CDY25663.1|  BnaC05g25420D                                          118   6e-28   Brassica napus [oilseed rape]
ref|NP_566928.1|  VIER F-box protein 2                                  118   7e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145044.1|  PREDICTED: F-box protein At1g47056                 118   8e-28   Brassica rapa
emb|CDY43846.1|  BnaA05g18580D                                          118   8e-28   Brassica napus [oilseed rape]
ref|XP_008393628.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...    117   1e-27   
ref|XP_002865015.1|  hypothetical protein ARALYDRAFT_919984             118   1e-27   Arabidopsis lyrata subsp. lyrata
gb|KDP31990.1|  hypothetical protein JCGZ_12451                         117   1e-27   Jatropha curcas
gb|KFK28417.1|  hypothetical protein AALP_AA8G512100                    117   1e-27   Arabis alpina [alpine rockcress]
ref|XP_006394452.1|  hypothetical protein EUTSA_v10003994mg             117   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010484524.1|  PREDICTED: F-box protein SKIP2-like                117   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_008351948.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...    117   2e-27   
ref|NP_567316.1|  VIER F-box protein 3                                  117   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061718.1|  PREDICTED: F-box protein At1g47056                 117   2e-27   Eucalyptus grandis [rose gum]
ref|XP_009372440.1|  PREDICTED: F-box protein SKIP2-like                117   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_010464300.1|  PREDICTED: F-box protein SKIP2-like                117   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006494494.1|  PREDICTED: F-box protein SKIP2-like                117   3e-27   Citrus sinensis [apfelsine]
ref|XP_006425977.1|  hypothetical protein CICLE_v10025355mg             117   3e-27   Citrus clementina [clementine]
ref|XP_003539331.1|  PREDICTED: F-box protein SKIP2-like                116   3e-27   Glycine max [soybeans]
ref|XP_009367537.1|  PREDICTED: F-box protein SKIP2-like                115   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_006858612.1|  hypothetical protein AMTR_s00198p00016850          116   4e-27   Amborella trichopoda
ref|XP_010444675.1|  PREDICTED: F-box protein SKIP2                     116   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010426552.1|  PREDICTED: F-box/LRR-repeat protein 16             116   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006404064.1|  hypothetical protein EUTSA_v10011152mg             116   4e-27   Eutrema salsugineum [saltwater cress]
gb|EPS69377.1|  hypothetical protein M569_05387                         115   6e-27   Genlisea aurea
ref|XP_006292484.1|  hypothetical protein CARUB_v10018713mg             115   8e-27   Capsella rubella
ref|XP_010550353.1|  PREDICTED: F-box protein SKIP2-like                115   9e-27   Tarenaya hassleriana [spider flower]
ref|XP_010688567.1|  PREDICTED: putative F-box/LRR-repeat protein 8     115   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004289192.1|  PREDICTED: F-box protein SKIP2                     115   1e-26   Fragaria vesca subsp. vesca
ref|XP_008338344.1|  PREDICTED: F-box protein SKIP2-like                115   1e-26   
ref|XP_006279774.1|  hypothetical protein CARUB_v10027824mg             115   1e-26   Capsella rubella
ref|XP_010943193.1|  PREDICTED: F-box protein At1g47056-like            114   2e-26   Elaeis guineensis
ref|XP_010503677.1|  PREDICTED: F-box/LRR-repeat protein 16-like        114   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010515374.1|  PREDICTED: F-box/LRR-repeat protein 16-like ...    114   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010515375.1|  PREDICTED: F-box/LRR-repeat protein 16-like ...    114   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010515373.1|  PREDICTED: F-box/LRR-repeat protein 16-like ...    114   2e-26   Camelina sativa [gold-of-pleasure]
gb|KFK34272.1|  hypothetical protein AALP_AA5G123400                    114   2e-26   Arabis alpina [alpine rockcress]
ref|XP_009103439.1|  PREDICTED: F-box protein SKIP2                     114   2e-26   Brassica rapa
ref|XP_008238850.1|  PREDICTED: F-box protein SKIP2                     114   3e-26   Prunus mume [ume]
ref|XP_008391502.1|  PREDICTED: F-box protein SKIP2-like                114   3e-26   
ref|XP_008391497.1|  PREDICTED: F-box protein SKIP2-like                114   3e-26   
ref|XP_007205025.1|  hypothetical protein PRUPE_ppa003978mg             114   4e-26   Prunus persica
ref|XP_011005818.1|  PREDICTED: F-box protein SKIP2-like                113   5e-26   Populus euphratica
ref|XP_009112366.1|  PREDICTED: F-box protein SKIP2-like                113   5e-26   Brassica rapa
ref|XP_002310119.2|  SKP1 INTERACTING PARTNER 2 family protein          113   6e-26   
ref|XP_008796478.1|  PREDICTED: F-box protein At1g47056-like            112   7e-26   Phoenix dactylifera
ref|XP_009418519.1|  PREDICTED: F-box protein At1g47056-like            113   7e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007047382.1|  SKP1/ASK1-interacting protein 2, putative          113   8e-26   
emb|CDY18646.1|  BnaA09g07490D                                          112   8e-26   Brassica napus [oilseed rape]
ref|XP_009101674.1|  PREDICTED: F-box/LRR-repeat protein 16             112   1e-25   Brassica rapa
emb|CDX81326.1|  BnaC09g07370D                                          112   1e-25   
ref|XP_009367488.1|  PREDICTED: F-box protein SKIP2                     112   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_009394539.1|  PREDICTED: F-box protein At1g47056                 112   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG04121.1|  F-box SKIP2 -like protein                               112   2e-25   Gossypium arboreum [tree cotton]
emb|CDX83114.1|  BnaA01g21140D                                          111   2e-25   
ref|XP_008362568.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...    112   3e-25   
ref|XP_009385196.1|  PREDICTED: F-box protein SKIP2-like                111   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008367984.1|  PREDICTED: F-box protein SKIP2-like                110   4e-25   
ref|XP_006573648.1|  PREDICTED: F-box protein SKIP2-like isoform X1     110   1e-24   Glycine max [soybeans]
emb|CDX68575.1|  BnaC01g26530D                                          109   1e-24   
ref|XP_002524918.1|  skip-2, putative                                   109   1e-24   Ricinus communis
gb|KJB71120.1|  hypothetical protein B456_011G106600                    109   2e-24   Gossypium raimondii
ref|XP_009396269.1|  PREDICTED: F-box protein At1g47056-like            109   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH31485.1|  F-box protein SKIP2                                     108   3e-24   Medicago truncatula
ref|XP_010558884.1|  PREDICTED: F-box protein SKIP2-like                108   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_004151915.1|  PREDICTED: F-box protein SKIP2-like                108   3e-24   Cucumis sativus [cucumbers]
ref|XP_004156789.1|  PREDICTED: F-box protein SKIP2-like                108   4e-24   
ref|XP_010030813.1|  PREDICTED: F-box protein At1g47056-like            102   5e-24   
ref|XP_008462840.1|  PREDICTED: F-box protein SKIP2                     108   5e-24   Cucumis melo [Oriental melon]
ref|XP_009417194.1|  PREDICTED: F-box protein At1g47056-like            105   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932212.1|  PREDICTED: F-box protein At1g47056-like            102   6e-22   Elaeis guineensis
ref|XP_010045605.1|  PREDICTED: F-box protein At1g47056-like          94.4    5e-21   
ref|XP_011008777.1|  PREDICTED: F-box protein SKIP2-like              99.8    5e-21   Populus euphratica
ref|XP_002307282.2|  SKP1 INTERACTING PARTNER 2 family protein        99.0    1e-20   
ref|XP_001780007.1|  predicted protein                                97.8    1e-20   
ref|XP_009418092.1|  PREDICTED: F-box protein SKIP2-like              98.6    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008663374.1|  PREDICTED: F-box protein At1g47056-like          98.2    2e-20   Zea mays [maize]
ref|XP_002462047.1|  hypothetical protein SORBIDRAFT_02g013790        97.8    2e-20   Sorghum bicolor [broomcorn]
gb|AFW58798.1|  hypothetical protein ZEAMMB73_653264                  96.3    4e-20   
dbj|BAD16491.1|  putative Avr9/Cf-9 rapidly elicited protein          97.1    5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150414.1|  LOC100284044                                     97.1    5e-20   
gb|ACN36605.1|  unknown                                               97.1    6e-20   Zea mays [maize]
gb|ACR36800.1|  unknown                                               97.1    6e-20   Zea mays [maize]
ref|XP_002876014.1|  vier F-box protein 2                             96.3    9e-20   
ref|XP_001764483.1|  predicted protein                                95.1    1e-19   
ref|XP_008652389.1|  PREDICTED: F-box protein At1g47056-like          95.9    2e-19   
ref|XP_007156764.1|  hypothetical protein PHAVU_002G015600g           93.6    9e-19   Phaseolus vulgaris [French bean]
ref|XP_003576858.1|  PREDICTED: F-box protein At1g47056               92.4    2e-18   Brachypodium distachyon [annual false brome]
ref|XP_008667802.1|  PREDICTED: hypothetical protein isoform X3       89.7    2e-17   Zea mays [maize]
ref|XP_008667801.1|  PREDICTED: hypothetical protein isoform X2       89.7    2e-17   
ref|NP_001146025.1|  hypothetical protein                             89.7    2e-17   Zea mays [maize]
ref|XP_008667804.1|  PREDICTED: hypothetical protein isoform X5       89.4    2e-17   Zea mays [maize]
ref|XP_008667803.1|  PREDICTED: hypothetical protein isoform X4       89.4    2e-17   
ref|XP_008667800.1|  PREDICTED: hypothetical protein isoform X1       89.7    3e-17   Zea mays [maize]
ref|XP_004956293.1|  PREDICTED: F-box protein At1g47056-like          88.2    6e-17   
ref|XP_010240100.1|  PREDICTED: F-box protein At1g47056-like          86.7    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_003527722.1|  PREDICTED: F-box protein SKIP2-like              84.3    6e-16   Glycine max [soybeans]
gb|EMT22616.1|  hypothetical protein F775_19643                       84.3    1e-15   
dbj|BAJ91417.1|  predicted protein                                    84.3    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98310.1|  predicted protein                                    84.3    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010036053.1|  PREDICTED: F-box protein SKIP2-like              84.3    1e-15   Eucalyptus grandis [rose gum]
emb|CAD41177.1|  OSJNBb0002J11.1                                      84.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67265.1|  OSIGBa0145C12.2                                      84.0    2e-15   Oryza sativa [red rice]
gb|EAY94777.1|  hypothetical protein OsI_16557                        83.6    2e-15   Oryza sativa Indica Group [Indian rice]
gb|ABK24412.1|  unknown                                               83.6    2e-15   Picea sitchensis
ref|XP_004976156.1|  PREDICTED: F-box protein SKIP2-like              83.2    3e-15   Setaria italica
ref|XP_002969264.1|  hypothetical protein SELMODRAFT_22039            82.0    3e-15   
dbj|BAJ86565.1|  predicted protein                                    82.4    5e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009413336.1|  PREDICTED: F-box protein At1g47056-like          80.5    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007014604.1|  VIER F-box protein 1                             80.5    3e-14   
ref|XP_002514498.1|  skip-2, putative                                 78.2    2e-13   
ref|XP_011019921.1|  PREDICTED: F-box protein SKIP2-like isoform X1   76.3    7e-13   Populus euphratica
ref|XP_011019922.1|  PREDICTED: F-box protein SKIP2-like isoform X2   76.3    7e-13   Populus euphratica
ref|XP_002309038.2|  hypothetical protein POPTR_0006s08160g           76.3    8e-13   
gb|KHN04478.1|  F-box protein SKIP2                                   75.1    2e-12   Glycine soja [wild soybean]
emb|CAN81430.1|  hypothetical protein VITISV_010695                   74.3    4e-12   Vitis vinifera
ref|XP_010665121.1|  PREDICTED: F-box protein SKIP2-like              73.6    6e-12   Vitis vinifera
ref|XP_011019923.1|  PREDICTED: F-box protein SKIP2-like isoform X3   73.6    7e-12   Populus euphratica
gb|KCW47577.1|  hypothetical protein EUGRSUZ_K01326                   72.8    1e-11   Eucalyptus grandis [rose gum]
gb|KCW59474.1|  hypothetical protein EUGRSUZ_H02221                   63.9    1e-09   Eucalyptus grandis [rose gum]
ref|XP_002987863.1|  hypothetical protein SELMODRAFT_43420            65.1    3e-09   
tpg|DAA37046.1|  TPA: hypothetical protein ZEAMMB73_673862            63.5    1e-08   
gb|ACF86198.1|  unknown                                               62.0    3e-08   Zea mays [maize]
tpg|DAA37044.1|  TPA: hypothetical protein ZEAMMB73_673862            62.0    3e-08   
ref|XP_002978355.1|  hypothetical protein SELMODRAFT_53002            57.8    8e-07   
ref|XP_002970190.1|  hypothetical protein SELMODRAFT_63069            57.0    1e-06   
ref|XP_010064602.1|  PREDICTED: F-box protein SKIP2-like              53.9    3e-06   Eucalyptus grandis [rose gum]
gb|EAY89731.1|  hypothetical protein OsI_11270                        52.8    4e-06   Oryza sativa Indica Group [Indian rice]
gb|EAZ26683.1|  hypothetical protein OsJ_10587                        52.8    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002990432.1|  hypothetical protein SELMODRAFT_43423            54.3    9e-06   
gb|ABF95568.1|  hypothetical protein LOC_Os03g19660                   53.1    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ACF87078.1|  unknown                                               53.1    3e-05   Zea mays [maize]
gb|EAZ16267.1|  hypothetical protein OsJ_31726                        50.4    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KCW61881.1|  hypothetical protein EUGRSUZ_H04564                   51.2    4e-05   Eucalyptus grandis [rose gum]
gb|EEE60833.1|  hypothetical protein OsJ_14449                        50.1    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAS07103.1|  tubulin beta subunit                                  49.3    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661027.1|  PREDICTED: F-box protein At1g47056-like          49.3    6e-04   



>ref|XP_009762874.1| PREDICTED: F-box protein At1g47056-like [Nicotiana sylvestris]
Length=538

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 104/132 (79%), Gaps = 4/132 (3%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSH--RGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDE  331
            MGQSAST    QN  H  R KSRST  ISPMKE+E SDDV D      G +DY+SNIPDE
Sbjct  1    MGQSASTTTAVQNHIHHSRSKSRSTGVISPMKENEDSDDVIDVFEV--GEFDYSSNIPDE  58

Query  332  CLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKL  511
            C+A IFQ LSSGDRKRCSLVCRRW +IEGQSRHRLSLNA +DLA V  SIFSRFD+VTKL
Sbjct  59   CVASIFQSLSSGDRKRCSLVCRRWFRIEGQSRHRLSLNAQSDLASVIPSIFSRFDSVTKL  118

Query  512  ALKCDRRSVSIG  547
            ALKCDRRS SIG
Sbjct  119  ALKCDRRSTSIG  130



>ref|XP_009620452.1| PREDICTED: F-box protein At1g47056-like [Nicotiana tomentosiformis]
Length=538

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 103/132 (78%), Gaps = 4/132 (3%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSH--RGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDE  331
            MGQSAST    QN  H  R KSRST  ISPMKESE SDDV D      G +DY+SNIPDE
Sbjct  1    MGQSASTTTAGQNHIHHSRSKSRSTGVISPMKESEDSDDVIDVFEV--GEFDYSSNIPDE  58

Query  332  CLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKL  511
            C+A IFQ LSSGDRKRCSLVC RW +IEGQSRHRLSLNA +DLA V  SIFSRFD+VTKL
Sbjct  59   CVASIFQSLSSGDRKRCSLVCHRWFRIEGQSRHRLSLNAQSDLASVIPSIFSRFDSVTKL  118

Query  512  ALKCDRRSVSIG  547
            ALKCDRRS SIG
Sbjct  119  ALKCDRRSTSIG  130



>ref|XP_006434705.1| hypothetical protein CICLE_v10000831mg [Citrus clementina]
 ref|XP_006473272.1| PREDICTED: F-box protein At1g47056-like [Citrus sinensis]
 gb|ESR47945.1| hypothetical protein CICLE_v10000831mg [Citrus clementina]
 gb|KDO84070.1| hypothetical protein CISIN_1g009671mg [Citrus sinensis]
Length=529

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 106/134 (79%), Gaps = 9/134 (7%)
 Frame = +2

Query  158  MGQSASTAAGAQ----NQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIP  325
            MGQSASTAA +     N S R KS+STA ISPM   ESS ++ DG+     AYDY SN+P
Sbjct  1    MGQSASTAAISSRREFNHSQRYKSKSTAVISPMHADESSAELPDGT-----AYDYISNLP  55

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLACIFQ LSSGDRKRCSLVCRRWL+IEGQSRHRLSLNA ++L  +  S+FSRFD VT
Sbjct  56   DECLACIFQSLSSGDRKRCSLVCRRWLRIEGQSRHRLSLNAQSELLPMIPSLFSRFDVVT  115

Query  506  KLALKCDRRSVSIG  547
            KLALKCDRRSVS+G
Sbjct  116  KLALKCDRRSVSVG  129



>gb|KDP41689.1| hypothetical protein JCGZ_16096 [Jatropha curcas]
Length=532

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 100/134 (75%), Gaps = 9/134 (7%)
 Frame = +2

Query  158  MGQSASTAAG----AQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIP  325
            MGQS+STAA       N +HR K++STA ISPM+  E S+          GA DY S++P
Sbjct  1    MGQSSSTAAVLSRRESNHNHRSKAKSTALISPMQAEEPSEHGLID-----GAPDYISDLP  55

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLACIFQ LSSGDRKRCSLVCRRWL IEGQSRHRLSLNA +DL  +   +FSRFDAVT
Sbjct  56   DECLACIFQSLSSGDRKRCSLVCRRWLLIEGQSRHRLSLNAQSDLLPIIPKLFSRFDAVT  115

Query  506  KLALKCDRRSVSIG  547
            KLALKCDRRS SIG
Sbjct  116  KLALKCDRRSASIG  129



>ref|XP_004238126.1| PREDICTED: F-box protein At1g47056-like [Solanum lycopersicum]
Length=534

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 101/130 (78%), Gaps = 5/130 (4%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQSAST AGAQN   R KSRS+  IS MKE + SDDV D      G +DY+SNIPDECL
Sbjct  1    MGQSASTVAGAQN---RIKSRSSPVISSMKEIDDSDDVIDVFDV--GEFDYSSNIPDECL  55

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            ACIF  LSSGDRK  SLVCRRWL++EGQSRHRLSLNA ++L  V   IFSRFD+VTKLAL
Sbjct  56   ACIFHFLSSGDRKSSSLVCRRWLRVEGQSRHRLSLNAQSELVAVVPVIFSRFDSVTKLAL  115

Query  518  KCDRRSVSIG  547
            KCDRRS SIG
Sbjct  116  KCDRRSASIG  125



>ref|XP_009791823.1| PREDICTED: F-box protein At1g47056-like [Nicotiana sylvestris]
Length=535

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQSAST AGAQN   R K RS++ +  MK S+ SDDV    + + G  DYT+ IPDECL
Sbjct  1    MGQSASTVAGAQN---RIKFRSSSPVYSMKNSDDSDDVVVVDVFEAGDLDYTNYIPDECL  57

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            ACIFQ LSSGDRK CSLVCRRWL++EGQSRHRLSLNA +DL  V   IFSRFD+VTKLAL
Sbjct  58   ACIFQSLSSGDRKSCSLVCRRWLRVEGQSRHRLSLNAQSDLVAVVPLIFSRFDSVTKLAL  117

Query  518  KCDRRSVSIG  547
            KCDRRS SIG
Sbjct  118  KCDRRSTSIG  127



>ref|XP_010094658.1| F-box protein [Morus notabilis]
 gb|EXB56509.1| F-box protein [Morus notabilis]
Length=540

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 100/134 (75%), Gaps = 7/134 (5%)
 Frame = +2

Query  158  MGQSASTAAGAQN----QSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIP  325
            MGQSASTAA   +     +HR K++STA ISPM+  E+       +    G  DY S++P
Sbjct  1    MGQSASTAAVPSSRESSHNHRLKAKSTALISPMQGDETDAPQVSTTN---GVSDYISDLP  57

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLA +FQ LSSGDRKRCSLVCRRWL++EGQSRHRLSLNA +DL  +  S+FSRFDAV 
Sbjct  58   DECLAFVFQSLSSGDRKRCSLVCRRWLKVEGQSRHRLSLNAQSDLFPMIPSLFSRFDAVR  117

Query  506  KLALKCDRRSVSIG  547
            KLALKCDRRSVSIG
Sbjct  118  KLALKCDRRSVSIG  131



>ref|XP_006354845.1| PREDICTED: F-box protein At1g47056-like [Solanum tuberosum]
Length=532

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 100/130 (77%), Gaps = 5/130 (4%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQSAST AGAQN   R K RS+  IS MKE + SDDV D      G +DY+SNIPDECL
Sbjct  1    MGQSASTVAGAQN---RIKFRSSPVISSMKEIDDSDDVIDVFEV--GEFDYSSNIPDECL  55

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            ACIF  LSSGDRK  SLVCRRWL++EGQ+RHRLSLNA ++L  V   IFSRFD+VTKLAL
Sbjct  56   ACIFHFLSSGDRKSSSLVCRRWLRVEGQNRHRLSLNAQSELVAVVPVIFSRFDSVTKLAL  115

Query  518  KCDRRSVSIG  547
            KCDRRS SIG
Sbjct  116  KCDRRSASIG  125



>ref|XP_011017158.1| PREDICTED: F-box protein At1g47056-like [Populus euphratica]
Length=533

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 98/135 (73%), Gaps = 11/135 (8%)
 Frame = +2

Query  158  MGQSASTAA-----GAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNI  322
            MGQ+ STA       +   S R KS+ T  I PM+  E ++ V +       A DY S++
Sbjct  1    MGQTTSTALITSRRDSNLSSQRSKSKFTVPIIPMQVEEQTEYVLEE------APDYISDL  54

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PDECLACIFQ LSSGDRKRCSLVCRRWL+IEGQSRHRLSLNA +DL    TS+FSRFDAV
Sbjct  55   PDECLACIFQSLSSGDRKRCSLVCRRWLRIEGQSRHRLSLNAQSDLLPFVTSLFSRFDAV  114

Query  503  TKLALKCDRRSVSIG  547
            TKLALKCDRRSVSIG
Sbjct  115  TKLALKCDRRSVSIG  129



>ref|XP_007017145.1| VIER F-box protein 1 [Theobroma cacao]
 gb|EOY14370.1| VIER F-box protein 1 [Theobroma cacao]
Length=533

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 96/134 (72%), Gaps = 7/134 (5%)
 Frame = +2

Query  158  MGQSASTAAGAQN----QSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIP  325
            MGQSASTA          S R KS+STA I PM+  E+ D          G  D+ S++P
Sbjct  1    MGQSASTAKLTSRRDCYHSQRSKSKSTALICPMQAEEAEDLDRRSID---GLSDFISDLP  57

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLACIFQ LS GDRKRCSLVC RWL+IEGQSRHRLSLNA +DL  +  SIFSRFDAVT
Sbjct  58   DECLACIFQSLSPGDRKRCSLVCWRWLRIEGQSRHRLSLNAQSDLHPLIPSIFSRFDAVT  117

Query  506  KLALKCDRRSVSIG  547
            KLALKCDRRSVSIG
Sbjct  118  KLALKCDRRSVSIG  131



>ref|XP_010270897.1| PREDICTED: F-box protein At1g47056-like [Nelumbo nucifera]
Length=538

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 96/137 (70%), Gaps = 11/137 (8%)
 Frame = +2

Query  158  MGQSASTAAGAQ-------NQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTS  316
            MGQS+STA           N SHR K+RST  ISPM+     +   +   +  G  DY S
Sbjct  1    MGQSSSTAGIPSASDRRDTNYSHRTKNRSTPVISPMQ----VELNPEIPRNVPGTCDYIS  56

Query  317  NIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFD  496
            ++PDECLACIFQ L SGDRK CSLVCRRW ++EGQSRHRLSL A +DL  +  SIFSRFD
Sbjct  57   DLPDECLACIFQSLGSGDRKSCSLVCRRWFRVEGQSRHRLSLKAESDLQSLIPSIFSRFD  116

Query  497  AVTKLALKCDRRSVSIG  547
            AVTKLALKCDRRSVSIG
Sbjct  117  AVTKLALKCDRRSVSIG  133



>ref|XP_008351989.1| PREDICTED: F-box protein At1g47056-like [Malus domestica]
Length=533

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 90/120 (75%), Gaps = 5/120 (4%)
 Frame = +2

Query  188  AQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECLACIFQCLSSG  367
            + N SHR KS++T AISPM + +              A D+ S++PDECLACIF  L SG
Sbjct  16   SNNHSHRSKSKATDAISPMLQPDEERSEIVDV-----ASDFISDLPDECLACIFHSLGSG  70

Query  368  DRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKCDRRSVSIG  547
            DRKRCSLVCRRWL+IEGQ+RHRLSLNA +DL  +  S+FSRFDAVTKLALKCDRRSVS+G
Sbjct  71   DRKRCSLVCRRWLRIEGQNRHRLSLNAQSDLLPIIPSLFSRFDAVTKLALKCDRRSVSVG  130



>ref|XP_009354159.1| PREDICTED: F-box protein At1g47056-like [Pyrus x bretschneideri]
Length=530

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 93/120 (78%), Gaps = 6/120 (5%)
 Frame = +2

Query  188  AQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECLACIFQCLSSG  367
            + N+ HR KS++TAAISPM ++E              + D+ S++PDECLACIFQ L SG
Sbjct  16   SNNRIHRSKSKATAAISPMLQAEEEGFEIVD------SADFISDLPDECLACIFQSLGSG  69

Query  368  DRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKCDRRSVSIG  547
            DRKRCSLVCRRWL+IEGQSRHRLSL+A +DL  +  S+FSRFDAVTKLALKCDRR+VS+G
Sbjct  70   DRKRCSLVCRRWLRIEGQSRHRLSLSAQSDLLPIIPSLFSRFDAVTKLALKCDRRAVSVG  129



>ref|XP_009598217.1| PREDICTED: F-box protein At1g47056-like [Nicotiana tomentosiformis]
Length=534

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 97/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQSAST AGA N   R K RS++ IS   +     D     + + G +DYT+ IPDECL
Sbjct  1    MGQSASTVAGAHN---RIKFRSSSPIS-SMKDSDDSDDAVIDVFEVGDFDYTNYIPDECL  56

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            ACIFQ LSSGDRK CSLVCRRWL++EGQSRHRLSLNA +DL  VA  IFSRFD+VTKLAL
Sbjct  57   ACIFQSLSSGDRKSCSLVCRRWLRVEGQSRHRLSLNAQSDLVTVAPLIFSRFDSVTKLAL  116

Query  518  KCDRRSVSIG  547
            KCDRRS SIG
Sbjct  117  KCDRRSTSIG  126



>ref|XP_002301165.1| F-box family protein [Populus trichocarpa]
 gb|EEE80438.1| F-box family protein [Populus trichocarpa]
Length=533

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 96/135 (71%), Gaps = 11/135 (8%)
 Frame = +2

Query  158  MGQSASTAA-----GAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNI  322
            MGQ+ STA       +   S R KS+ T  I PM+  E ++ V         A DY S++
Sbjct  1    MGQTTSTALITSRRDSNLSSQRSKSKFTVPIIPMQVEEQTEYVLVE------APDYISDL  54

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PDECLACIFQ LSSGDRK CSLVCRRWL+IEGQSRHRLSLNA +DL    TS+FSRFDAV
Sbjct  55   PDECLACIFQSLSSGDRKSCSLVCRRWLRIEGQSRHRLSLNAQSDLLPFVTSLFSRFDAV  114

Query  503  TKLALKCDRRSVSIG  547
            TKLALKCDRRSVSIG
Sbjct  115  TKLALKCDRRSVSIG  129



>gb|KJB14605.1| hypothetical protein B456_002G133700 [Gossypium raimondii]
Length=534

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 94/134 (70%), Gaps = 7/134 (5%)
 Frame = +2

Query  158  MGQSASTAAGAQ----NQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIP  325
            MGQS S A        N   R K +STA I PM+  E+ +     +    G+ D+ S++P
Sbjct  1    MGQSVSAAKLRNRRDWNHRQRSKPKSTALICPMQAEETEELERSNTD---GSSDFISDLP  57

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLACIFQ LS  DRKRCSLVCRRWL IEGQSRHRLSLNA +DL  +  SIFSRFDAVT
Sbjct  58   DECLACIFQSLSPADRKRCSLVCRRWLLIEGQSRHRLSLNAQSDLQPLIPSIFSRFDAVT  117

Query  506  KLALKCDRRSVSIG  547
            KLALKCDRRSVSIG
Sbjct  118  KLALKCDRRSVSIG  131



>ref|XP_008220270.1| PREDICTED: F-box protein At1g47056-like isoform X1 [Prunus mume]
Length=533

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 11/135 (8%)
 Frame = +2

Query  158  MGQSASTAA-----GAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNI  322
            MGQSAS AA      +   SHR K +STAAI PM+  + S ++ +       AYD+ S++
Sbjct  1    MGQSASAAAIPSRRESNRDSHRSKPKSTAAICPMEADDESSEIVN------AAYDFISDL  54

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PDECLACIFQ L S DRK+CSLVC RWL+IEGQSRHRLSL+A +DL     S+FSRFDAV
Sbjct  55   PDECLACIFQSLGSRDRKQCSLVCLRWLRIEGQSRHRLSLDAKSDLLPFIPSLFSRFDAV  114

Query  503  TKLALKCDRRSVSIG  547
            TKLALKCDRR+VSIG
Sbjct  115  TKLALKCDRRAVSIG  129



>ref|XP_008220271.1| PREDICTED: F-box protein At1g47056-like isoform X2 [Prunus mume]
Length=534

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 11/135 (8%)
 Frame = +2

Query  158  MGQSASTAA-----GAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNI  322
            MGQSAS AA      +   SHR K +STAAI PM+  + S ++ +       AYD+ S++
Sbjct  1    MGQSASAAAIPSRRESNRDSHRSKPKSTAAICPMEADDESSEIVN------AAYDFISDL  54

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PDECLACIFQ L S DRK+CSLVC RWL+IEGQSRHRLSL+A +DL     S+FSRFDAV
Sbjct  55   PDECLACIFQSLGSRDRKQCSLVCLRWLRIEGQSRHRLSLDAKSDLLPFIPSLFSRFDAV  114

Query  503  TKLALKCDRRSVSIG  547
            TKLALKCDRR+VSIG
Sbjct  115  TKLALKCDRRAVSIG  129



>ref|XP_009360050.1| PREDICTED: F-box protein At1g47056-like [Pyrus x bretschneideri]
Length=533

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = +2

Query  188  AQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECLACIFQCLSSG  367
            + N SHR KS++TAAISPM +++              A D  S++PDECLACIFQ L SG
Sbjct  16   SNNHSHRSKSKATAAISPMLQADEERSGIVDV-----ASDLISDLPDECLACIFQFLGSG  70

Query  368  DRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKCDRRSVSIG  547
            DRKRCSLVCRRWL+IEGQ+ HRLSLNA +DL  +  S+FSRFDAVTKLALKCDRRSVS+G
Sbjct  71   DRKRCSLVCRRWLRIEGQNCHRLSLNAQSDLLPIIPSLFSRFDAVTKLALKCDRRSVSVG  130



>ref|XP_011029349.1| PREDICTED: F-box protein At1g47056-like [Populus euphratica]
Length=533

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 96/135 (71%), Gaps = 11/135 (8%)
 Frame = +2

Query  158  MGQSASTAA-----GAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNI  322
            MGQSASTA       +   SHR K + T  I PM+  E ++ +           DY S++
Sbjct  1    MGQSASTALITSRRDSNRSSHRSKPKFTVPIIPMQVEEQTEFIICE------GPDYISDL  54

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PDECLACIFQ L+SGDRKRCSLVCRRWL+IEGQSRHRLSLNA +DL  +   +FSRFD+V
Sbjct  55   PDECLACIFQSLNSGDRKRCSLVCRRWLRIEGQSRHRLSLNAQSDLLPLVPFLFSRFDSV  114

Query  503  TKLALKCDRRSVSIG  547
            TKLALKCDRRSVSIG
Sbjct  115  TKLALKCDRRSVSIG  129



>ref|XP_004141272.1| PREDICTED: F-box protein At1g47056-like [Cucumis sativus]
 ref|XP_004164584.1| PREDICTED: F-box protein At1g47056-like [Cucumis sativus]
 gb|KGN55231.1| hypothetical protein Csa_4G641640 [Cucumis sativus]
Length=535

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 96/133 (72%), Gaps = 8/133 (6%)
 Frame = +2

Query  158  MGQSASTAAGAQ----NQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIP  325
            MGQSAS+AA       N SHR K +STA ISPM   E+ D          GA D+ S++P
Sbjct  1    MGQSASSAAILSRRDSNHSHRSKIKSTALISPMHLDETDDVQEIIH----GASDFISDLP  56

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLACIFQ LSS DRK CSLVCRRW ++EGQSRHRLSL A ADL+ +  S+F+RFDAVT
Sbjct  57   DECLACIFQSLSSVDRKGCSLVCRRWFKVEGQSRHRLSLKAEADLSSMIPSLFTRFDAVT  116

Query  506  KLALKCDRRSVSI  544
            KLALKCDRRS SI
Sbjct  117  KLALKCDRRSTSI  129



>ref|XP_008452600.1| PREDICTED: F-box protein At1g47056-like [Cucumis melo]
Length=534

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 96/133 (72%), Gaps = 8/133 (6%)
 Frame = +2

Query  158  MGQSASTAAGAQ----NQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIP  325
            MGQS S+AA       N SHR K +STA ISPM   E+ D          GA D+ S++P
Sbjct  1    MGQSTSSAAILSRRDSNHSHRSKIKSTALISPMHLDETDDVQEIIH----GASDFISDLP  56

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLACIFQ LSS DRK CSLVCRRWL++EGQSRHRLSL A ADL+ +  S+F+RFDAVT
Sbjct  57   DECLACIFQSLSSVDRKGCSLVCRRWLKVEGQSRHRLSLKAEADLSSMIPSLFTRFDAVT  116

Query  506  KLALKCDRRSVSI  544
            KLALKCDRRS SI
Sbjct  117  KLALKCDRRSTSI  129



>ref|XP_010244251.1| PREDICTED: F-box protein At1g47056-like [Nelumbo nucifera]
Length=539

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 99/138 (72%), Gaps = 13/138 (9%)
 Frame = +2

Query  158  MGQSASTAA--------GAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYT  313
            MGQS STA          + N SHR K+RS  +ISP++      DVT    + DG  DY 
Sbjct  1    MGQSVSTAGIPSASNRRDSINPSHRTKNRSMGSISPVQ-----VDVTPELQNVDGTCDYI  55

Query  314  SNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRF  493
            S++PDECLACIFQ L SGDRKRCSLVCRRW ++EGQSRHRLSL A +DL  +  S+FSRF
Sbjct  56   SDLPDECLACIFQSLGSGDRKRCSLVCRRWFRVEGQSRHRLSLKAESDLQPLIPSLFSRF  115

Query  494  DAVTKLALKCDRRSVSIG  547
            DAVTKLALKCDRRSVSIG
Sbjct  116  DAVTKLALKCDRRSVSIG  133



>gb|KJB58522.1| hypothetical protein B456_009G215400 [Gossypium raimondii]
Length=534

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 95/134 (71%), Gaps = 7/134 (5%)
 Frame = +2

Query  158  MGQSASTAAGAQ----NQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIP  325
            MGQS STA        N+S R KS+STA I  M+  E+ +   +      G  D  S +P
Sbjct  1    MGQSVSTAKLTSRRDCNRSQRSKSKSTALIGQMQAEEAEEVERNSID---GLSDIISVLP  57

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLACIFQ L+ GDRKRCSLVCRRWL+IEGQSRHRLSLNA +DL     SIFSRFDAVT
Sbjct  58   DECLACIFQSLTPGDRKRCSLVCRRWLRIEGQSRHRLSLNAQSDLHPHIPSIFSRFDAVT  117

Query  506  KLALKCDRRSVSIG  547
            KLALKCDRRSVSIG
Sbjct  118  KLALKCDRRSVSIG  131



>emb|CDP01289.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 95/139 (68%), Gaps = 9/139 (6%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHR---GKSRSTAAI--SPMKESEssd----dvtdgsidddGAYDY  310
            MGQSAS+ AGAQ   H     K RSTAA+  + MK     +             +G  DY
Sbjct  1    MGQSASSIAGAQALHHHHRPSKPRSTAAVISTGMKIHNYIENDPDADPADVFTGEGLADY  60

Query  311  TSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSR  490
             SN+PDECLA IFQ LSSGDRKRCSLVCRRWL +EGQSRHRLSLNA A+L     SIF+R
Sbjct  61   ISNLPDECLAYIFQSLSSGDRKRCSLVCRRWLLVEGQSRHRLSLNAQAELLTFIPSIFTR  120

Query  491  FDAVTKLALKCDRRSVSIG  547
            FDAVTKLALKCDRRS SIG
Sbjct  121  FDAVTKLALKCDRRSASIG  139



>gb|KJB63903.1| hypothetical protein B456_010G022900 [Gossypium raimondii]
Length=528

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 91/134 (68%), Gaps = 12/134 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQ----NQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIP  325
            MGQS S+A        N S R  S+S   ISPMK  E+               D+ S++P
Sbjct  1    MGQSVSSAKLTARRDCNHSQRSYSKSAVLISPMKTEEAEVIDELS--------DFISDLP  52

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLAC+FQ L+  DRKRCSLVCRRWL+IEGQSRHRLSLNA +DL  +  SIFSRFDAVT
Sbjct  53   DECLACVFQSLTPADRKRCSLVCRRWLRIEGQSRHRLSLNAQSDLHPLIPSIFSRFDAVT  112

Query  506  KLALKCDRRSVSIG  547
            KLALKCDRRSV IG
Sbjct  113  KLALKCDRRSVGIG  126



>ref|XP_007225777.1| hypothetical protein PRUPE_ppa004591mg [Prunus persica]
 gb|EMJ26976.1| hypothetical protein PRUPE_ppa004591mg [Prunus persica]
Length=501

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 11/135 (8%)
 Frame = +2

Query  158  MGQSASTAA-----GAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNI  322
            MGQSAS AA      +   S+R K +STAAI PM+  + S ++ +       AYD+ S++
Sbjct  1    MGQSASAAAIPSRRESNRDSNRSKPKSTAAICPMEAEDESSEIVN------AAYDFISDL  54

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PDECLACIFQ L S DRK+CSLVC RWL+IEGQSRHRLSL+A +DL     S+FSRFDAV
Sbjct  55   PDECLACIFQSLGSRDRKQCSLVCLRWLRIEGQSRHRLSLDAKSDLLPFIPSLFSRFDAV  114

Query  503  TKLALKCDRRSVSIG  547
            TKLALKCDR+ VSIG
Sbjct  115  TKLALKCDRKVVSIG  129



>ref|XP_004291070.1| PREDICTED: F-box protein At1g47056-like [Fragaria vesca subsp. 
vesca]
Length=528

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = +2

Query  191  QNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECLACIFQCLSSGD  370
             N SHR KS + A ISPM   E S +V D       A DY S++PDECLACIF  L SGD
Sbjct  16   NNHSHRSKSIAAALISPMLAPEESGEVLDF------ATDYISDLPDECLACIFHSLGSGD  69

Query  371  RKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKCDRRSVSIG  547
            RKRCSLVCRRWL +EGQSRHRLSLNA ADL     S+FSRFDAVTKLALKC+RRS SIG
Sbjct  70   RKRCSLVCRRWLTVEGQSRHRLSLNAQADLQPSIGSLFSRFDAVTKLALKCERRSTSIG  128



>ref|XP_010555499.1| PREDICTED: putative F-box/LRR-repeat protein 8 isoform X2 [Tarenaya 
hassleriana]
Length=549

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 94/136 (69%), Gaps = 6/136 (4%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGA------YDYTSN  319
            MGQS S  +    +  +  S STA ISP+   E  ++      +   A      YDY S+
Sbjct  1    MGQSVSVVSALCRRRCKAPSNSTAVISPVVADEGEEEDEGEEENSSTAAVADDPYDYISD  60

Query  320  IPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDA  499
            +P+ECLACIF  LSSGDRKRCSLVCRRWL+IEGQSRHRLSLNA +DL  V  S+FSRFDA
Sbjct  61   LPEECLACIFHLLSSGDRKRCSLVCRRWLRIEGQSRHRLSLNAQSDLLLVIPSLFSRFDA  120

Query  500  VTKLALKCDRRSVSIG  547
            VTKLALKCDRRS SIG
Sbjct  121  VTKLALKCDRRSPSIG  136



>ref|XP_010555498.1| PREDICTED: putative F-box/LRR-repeat protein 8 isoform X1 [Tarenaya 
hassleriana]
Length=542

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 94/136 (69%), Gaps = 6/136 (4%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGA------YDYTSN  319
            MGQS S  +    +  +  S STA ISP+   E  ++      +   A      YDY S+
Sbjct  1    MGQSVSVVSALCRRRCKAPSNSTAVISPVVADEGEEEDEGEEENSSTAAVADDPYDYISD  60

Query  320  IPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDA  499
            +P+ECLACIF  LSSGDRKRCSLVCRRWL+IEGQSRHRLSLNA +DL  V  S+FSRFDA
Sbjct  61   LPEECLACIFHLLSSGDRKRCSLVCRRWLRIEGQSRHRLSLNAQSDLLLVIPSLFSRFDA  120

Query  500  VTKLALKCDRRSVSIG  547
            VTKLALKCDRRS SIG
Sbjct  121  VTKLALKCDRRSPSIG  136



>ref|XP_002284998.1| PREDICTED: F-box protein At1g47056 [Vitis vinifera]
Length=541

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 85/118 (72%), Gaps = 5/118 (4%)
 Frame = +2

Query  194  NQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECLACIFQCLSSGDR  373
            N  HR +S+S   I  M+  E+               DY S++PDECLACIFQ L SGDR
Sbjct  20   NHPHRSRSKSMVQIPSMQVEENVQFRQIDED-----LDYISDLPDECLACIFQSLGSGDR  74

Query  374  KRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKCDRRSVSIG  547
            K+CSLVCRRWL+IEGQ+RHRLSLNA +DL  V  S+FSRFDAVTKLALKCDRRSVSIG
Sbjct  75   KQCSLVCRRWLRIEGQTRHRLSLNAHSDLLTVVPSLFSRFDAVTKLALKCDRRSVSIG  132



>ref|XP_002510165.1| skip-2, putative [Ricinus communis]
 gb|EEF52352.1| skip-2, putative [Ricinus communis]
Length=536

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = +2

Query  158  MGQSASTAAGAQNQS--HRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDE  331
            MGQS+S+ A    +   +R KS+STA ISPM ++E  +D  D  +  + + DY S++PDE
Sbjct  1    MGQSSSSTAILTRRESIYRSKSKSTALISPM-QTEEPNDKDDVVLIINESPDYISDLPDE  59

Query  332  CLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKL  511
            CLACIFQ LS  DR+RCSLVCRRWL+IEGQSRHRLSL+A +DL  V +++F+RFDAVTKL
Sbjct  60   CLACIFQSLSPSDRQRCSLVCRRWLRIEGQSRHRLSLHAQSDLLPVISALFTRFDAVTKL  119

Query  512  ALKCDRRSVSIG  547
            AL+CDR+S SIG
Sbjct  120  ALRCDRKSASIG  131



>gb|KCW66359.1| hypothetical protein EUGRSUZ_F00182 [Eucalyptus grandis]
Length=383

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  YTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFS  487
            Y S +PDECLAC+FQCL +GDRKRCSLVCRRWL +EGQSRHRLSLNA ADL  + TS+FS
Sbjct  60   YISQLPDECLACVFQCLGTGDRKRCSLVCRRWLAVEGQSRHRLSLNARADLLPLVTSLFS  119

Query  488  RFDAVTKLALKCDRRSVSIG  547
            RFDAVTKLALKCDRRS SIG
Sbjct  120  RFDAVTKLALKCDRRSASIG  139



>ref|XP_010059893.1| PREDICTED: F-box protein At1g47056-like [Eucalyptus grandis]
Length=543

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  YTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFS  487
            Y S +PDECLAC+FQCL +GDRKRCSLVCRRWL +EGQSRHRLSLNA ADL  + TS+FS
Sbjct  60   YISQLPDECLACVFQCLGTGDRKRCSLVCRRWLAVEGQSRHRLSLNARADLLPLVTSLFS  119

Query  488  RFDAVTKLALKCDRRSVSIG  547
            RFDAVTKLALKCDRRS SIG
Sbjct  120  RFDAVTKLALKCDRRSASIG  139



>ref|XP_003550322.1| PREDICTED: F-box protein At1g47056-like [Glycine max]
Length=563

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 97/145 (67%), Gaps = 20/145 (14%)
 Frame = +2

Query  158  MGQSASTAAGA----QNQSHRG----KSRSTAAISPM--------KESEssddvtdgsid  289
            MGQS S+AA A    ++Q HR     K+R TA++SPM        +E E+          
Sbjct  1    MGQSVSSAAVASRRERDQGHRSVNSSKTRFTASVSPMAGYSSGAAEEGENHRVEAVADE-  59

Query  290  ddGAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADV  469
               + DY S++P+ECLA +FQ LSS DR RCSLVCRRWLQIEGQSRHRLSLNA  DL   
Sbjct  60   ---STDYISDLPNECLASVFQFLSSADRSRCSLVCRRWLQIEGQSRHRLSLNAELDLFPA  116

Query  470  ATSIFSRFDAVTKLALKCDRRSVSI  544
              S+FSRFD+VTKLALKCDRRSVSI
Sbjct  117  IPSLFSRFDSVTKLALKCDRRSVSI  141



>ref|XP_003544473.1| PREDICTED: F-box protein At1g47056-like [Glycine max]
Length=549

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 93/142 (65%), Gaps = 13/142 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQNQS--------HRGKSRSTAAISPMK-----ESEssddvtdgsidddG  298
            MGQS S+AA A  +         +  K+RSTA I+PM        E   +   G    D 
Sbjct  1    MGQSVSSAAVASRRERDPGHLSVNTSKTRSTALITPMAGYSSGAGEDESENRRGEAVTDE  60

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
              DY S++P+ECLA +FQ LSS DR RCSLVCRRWLQIEGQSRHRLSLNA  DL     S
Sbjct  61   TTDYISDLPNECLASVFQFLSSADRNRCSLVCRRWLQIEGQSRHRLSLNADEDLFPAIPS  120

Query  479  IFSRFDAVTKLALKCDRRSVSI  544
            +FSRFD+VTKLALKCDRRSVSI
Sbjct  121  LFSRFDSVTKLALKCDRRSVSI  142



>ref|XP_011074407.1| PREDICTED: F-box protein At1g47056-like [Sesamum indicum]
Length=536

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT N+PDECLACIFQ LS+GDRKR SLVCRRWL +EGQSRHRLSLNA + L +V   +F
Sbjct  46   DYTLNLPDECLACIFQSLSAGDRKRSSLVCRRWLTVEGQSRHRLSLNAQSQLVNVVPGLF  105

Query  485  SRFDAVTKLALKCDRRSVSIG  547
            SRFDAVTKLALKCDRRSVSIG
Sbjct  106  SRFDAVTKLALKCDRRSVSIG  126



>gb|EYU36322.1| hypothetical protein MIMGU_mgv1a010857mg [Erythranthe guttata]
Length=299

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 86/132 (65%), Gaps = 9/132 (7%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISP-MKESEssddvtdgsidddG-AYDYTSNIPDE  331
            MGQS+ST       S     +  A ISP + ESE          D     YDYT N+PDE
Sbjct  1    MGQSSST-------SRPVSFKPAAVISPSVSESEPRRSPAGLEPDSGDVGYDYTLNLPDE  53

Query  332  CLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKL  511
            CLACIF  LS+ DRKR SLVCRRWL I+GQSRHRLSLNA + LA     +FSRFDAVTKL
Sbjct  54   CLACIFHSLSAADRKRSSLVCRRWLTIDGQSRHRLSLNAQSQLASAVPKLFSRFDAVTKL  113

Query  512  ALKCDRRSVSIG  547
             LKCDRRSVSIG
Sbjct  114  GLKCDRRSVSIG  125



>ref|XP_011069725.1| PREDICTED: F-box protein At1g47056-like [Sesamum indicum]
Length=526

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 94/134 (70%), Gaps = 12/134 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAI--SPMKE--SEssddvtdgsidddGAYDYTSNIP  325
            MGQ+AS +        R K   +AA+   P+ E  SE+ D+V D   D     DYT NIP
Sbjct  1    MGQAASAS--------RPKFLKSAAVISPPVAEPGSENPDEVGDDLDDSVAGNDYTLNIP  52

Query  326  DECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVT  505
            DECLACIF  LSSGDRKR SLVCRRWL++EGQSRHRLSLNA  +LA V   +F RFDAVT
Sbjct  53   DECLACIFHSLSSGDRKRASLVCRRWLRVEGQSRHRLSLNAQTELASVIPRLFLRFDAVT  112

Query  506  KLALKCDRRSVSIG  547
            KLALKCDRRSVSIG
Sbjct  113  KLALKCDRRSVSIG  126



>ref|XP_006374882.1| hypothetical protein POPTR_0014s02370g [Populus trichocarpa]
 gb|ERP52679.1| hypothetical protein POPTR_0014s02370g [Populus trichocarpa]
Length=534

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 96/136 (71%), Gaps = 12/136 (9%)
 Frame = +2

Query  158  MGQSASTA------AGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSN  319
            MGQSASTA         ++ SHR KS+ T  I P++  E ++ +           DY S+
Sbjct  1    MGQSASTALITSRRDSNRSSSHRSKSKFTVPIMPVQVEEQTEFIFCE------GPDYISD  54

Query  320  IPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDA  499
            +PDECLACIFQ L+SGDRK CSLVCRRWL+IEGQSRHRLSLNA +DL  +   +FSRFD+
Sbjct  55   LPDECLACIFQSLNSGDRKHCSLVCRRWLRIEGQSRHRLSLNAQSDLLPLVPFLFSRFDS  114

Query  500  VTKLALKCDRRSVSIG  547
            VTKLALKCDRRS SIG
Sbjct  115  VTKLALKCDRRSTSIG  130



>ref|XP_003589128.1| F-box protein [Medicago truncatula]
 gb|ABD32619.1| Cyclin-like F-box [Medicago truncatula]
 gb|AES59379.1| F-box SKIP2-like protein [Medicago truncatula]
Length=547

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 93/138 (67%), Gaps = 9/138 (7%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGK-----SRSTAAISPMKESEssddvtdgs----idddGAYDY  310
            MGQ+AST  G   +   G      +RSTA +SPM  ++  DDV D       D  G  DY
Sbjct  1    MGQAASTVTGTNRRESAGNRSTKTTRSTALVSPMISTDDGDDVADPVDGDGNDGIGNSDY  60

Query  311  TSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSR  490
             S++PDECLA +FQ L+  DR +CSLVCRRWL +EGQSR RLSLNA  DL  V  S+F+R
Sbjct  61   ISDLPDECLAIVFQSLNPSDRNQCSLVCRRWLHVEGQSRQRLSLNAKLDLLPVIPSLFNR  120

Query  491  FDAVTKLALKCDRRSVSI  544
            FD+VTKLALKCDRRSVSI
Sbjct  121  FDSVTKLALKCDRRSVSI  138



>gb|EPS63306.1| hypothetical protein M569_11480 [Genlisea aurea]
Length=538

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 89/129 (69%), Gaps = 4/129 (3%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQ +STA  A++      S +  ++ P +ES    D          A DYT N+PDECL
Sbjct  1    MGQFSSTAKPARSDE---SSAAVVSLVPNRESPVEIDSDSDEPPPV-AVDYTLNLPDECL  56

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            AC+ Q LSSGDRKR SLVCRRWL+++GQSRHRLSLNA ADLA V   +F RFDAV+KLAL
Sbjct  57   ACVLQSLSSGDRKRSSLVCRRWLRVDGQSRHRLSLNAQADLAAVVPRLFVRFDAVSKLAL  116

Query  518  KCDRRSVSI  544
             CDRRSVSI
Sbjct  117  NCDRRSVSI  125



>ref|XP_008813812.1| PREDICTED: F-box protein At1g47056-like [Phoenix dactylifera]
Length=528

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 88/130 (68%), Gaps = 8/130 (6%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS+ST    + +      R +A + P        +    +      +D+T+++PDECL
Sbjct  1    MGQSSSTPCHRRPKPPFAAPRPSATMIP--------EAAISTDSTGSVWDHTADLPDECL  52

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A IFQ L SGDRKRCSLVCRRWL +EGQSRHRLSL+A A L +VA S+F+RFDAV KLAL
Sbjct  53   ALIFQSLGSGDRKRCSLVCRRWLAVEGQSRHRLSLDARAALLEVAPSVFARFDAVCKLAL  112

Query  518  KCDRRSVSIG  547
            KCDRRS SIG
Sbjct  113  KCDRRSDSIG  122



>ref|XP_007160881.1| hypothetical protein PHAVU_001G024700g [Phaseolus vulgaris]
 gb|ESW32875.1| hypothetical protein PHAVU_001G024700g [Phaseolus vulgaris]
Length=555

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 5/116 (4%)
 Frame = +2

Query  212  KSRSTAAISPM-----KESEssddvtdgsidddGAYDYTSNIPDECLACIFQCLSSGDRK  376
             +RSTA++ PM        E   D     +  DG  DY S++P+ECLA +FQ LSS DR 
Sbjct  28   NTRSTASVLPMVGYSCSTGEGDSDNRRVEVVSDGTTDYISDLPNECLASVFQFLSSADRN  87

Query  377  RCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKCDRRSVSI  544
            RCSLVC+RWLQIEGQSRHRLSLNA ADL    +S+FSRFD+VTKLALKC+RRSVSI
Sbjct  88   RCSLVCQRWLQIEGQSRHRLSLNAEADLLSAISSLFSRFDSVTKLALKCNRRSVSI  143



>ref|XP_010556431.1| PREDICTED: putative F-box/LRR-repeat protein 8 [Tarenaya hassleriana]
Length=543

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEss---ddvtdgsidddGAYDYTSNIPD  328
            MGQS+S  +  +    +  S S+A I     SE     ++ T  +      YDYTSN+PD
Sbjct  1    MGQSSSVVSVLRRGRSKAPSTSSAVILQAIASEGGGRGEEDTSTATVSGDTYDYTSNLPD  60

Query  329  ECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTK  508
            +CLACIFQ LSSGDRK+CSLVC RWL+IEGQSR RLSL A  DL  +  S+FSRFDAV K
Sbjct  61   DCLACIFQSLSSGDRKQCSLVCHRWLRIEGQSRRRLSLKAQPDLLLMIPSLFSRFDAVIK  120

Query  509  LALKCDRRSVSI  544
            LALKCDRRS SI
Sbjct  121  LALKCDRRSPSI  132



>ref|XP_011099097.1| PREDICTED: F-box protein SKIP2 [Sesamum indicum]
Length=544

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
             DYTS IPDECLA IFQ LSSGDRKRCSLVCRRW  +EGQSRHRL+LNA  ++AD   SI
Sbjct  47   LDYTSEIPDECLALIFQSLSSGDRKRCSLVCRRWFSVEGQSRHRLALNASLEVADHLPSI  106

Query  482  FSRFDAVTKLALKCDRRSVSI  544
            F RFD+VTKLAL+CDR+SVSI
Sbjct  107  FKRFDSVTKLALRCDRKSVSI  127



>ref|XP_009799715.1| PREDICTED: F-box protein At1g47056-like [Nicotiana sylvestris]
Length=550

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT  +PDECLA IFQCLSSGDRK+CSLVCRRWL +EGQSRHRLSLNA A+      +IF
Sbjct  58   DYTYELPDECLALIFQCLSSGDRKKCSLVCRRWLLVEGQSRHRLSLNAKAEFLPHIPTIF  117

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRFD+VTKLAL+CDR+SVSI
Sbjct  118  SRFDSVTKLALRCDRKSVSI  137



>ref|XP_009619626.1| PREDICTED: F-box protein At1g47056-like [Nicotiana tomentosiformis]
Length=550

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT  +PDECLA IFQCLSSGDRK+CSLVC+RWL +EGQSRHRLSLNA A+      ++F
Sbjct  58   DYTYELPDECLALIFQCLSSGDRKKCSLVCQRWLLVEGQSRHRLSLNAKAEFLPHIPTVF  117

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRFD+VTKLAL+CDR+SVSI
Sbjct  118  SRFDSVTKLALRCDRKSVSI  137



>ref|XP_006306435.1| hypothetical protein CARUB_v10012377mg [Capsella rubella]
 gb|EOA39333.1| hypothetical protein CARUB_v10012377mg [Capsella rubella]
Length=521

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 92/130 (71%), Gaps = 12/130 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS S AAG    +HR K++S +   P++  ES               DYTS +PDECL
Sbjct  1    MGQSTS-AAGNSIFNHR-KTKSFSLKFPIQPIESEVSQP----------DYTSCLPDECL  48

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A +FQ L++G+RKRC+LVCRRW+ +EGQ+R+RLSL+A +DL     S+FSRFD+VTKL+L
Sbjct  49   ALVFQFLNTGNRKRCALVCRRWMIVEGQNRYRLSLHARSDLITSVPSLFSRFDSVTKLSL  108

Query  518  KCDRRSVSIG  547
            KCDRRSVSIG
Sbjct  109  KCDRRSVSIG  118



>ref|XP_010911094.1| PREDICTED: F-box protein At1g47056-like [Elaeis guineensis]
Length=520

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 88/130 (68%), Gaps = 11/130 (8%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQSASTA   + +     +R +AA+ P   S S             + D+T+++PDECL
Sbjct  1    MGQSASTACHRRPKPFSA-ARPSAAMIPAAVSTSFGP----------SRDHTADLPDECL  49

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A IFQ L SGDRKRCSLVCRRWL +EGQ RHRL L+A + L +   S+FSRFDAVTKLAL
Sbjct  50   ALIFQSLGSGDRKRCSLVCRRWLVVEGQGRHRLVLDARSALLEAVPSLFSRFDAVTKLAL  109

Query  518  KCDRRSVSIG  547
            +CDRRS SIG
Sbjct  110  RCDRRSDSIG  119



>ref|XP_004231878.1| PREDICTED: F-box protein SKIP2-like [Solanum lycopersicum]
Length=550

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G  DYT ++PDECLA IFQCLSSGDRK+CSLV RRWL +EGQSRHRL+LNA  ++     
Sbjct  58   GNRDYTDDLPDECLALIFQCLSSGDRKKCSLVSRRWLLVEGQSRHRLALNAKVEILPHVP  117

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
            +IFSRFD+VTKLAL+CDR+SVSI
Sbjct  118  TIFSRFDSVTKLALRCDRKSVSI  140



>ref|XP_010479114.1| PREDICTED: F-box protein At1g47056 isoform X1 [Camelina sativa]
 ref|XP_010479115.1| PREDICTED: F-box protein At1g47056 isoform X2 [Camelina sativa]
Length=519

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 86/130 (66%), Gaps = 12/130 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS S A  +     R KS S        ESE S              DYTS +PDECL
Sbjct  1    MGQSTSAAGNSILNQRRTKSFSLKFPIQSLESEISQP------------DYTSYLPDECL  48

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A +FQ L+SG+RKRC+LVCRRW+ +EGQ+R+RLSL+A +DL     S+FSRFD+VTKL+L
Sbjct  49   ALVFQFLNSGNRKRCALVCRRWMIVEGQNRYRLSLHARSDLITSVPSLFSRFDSVTKLSL  108

Query  518  KCDRRSVSIG  547
            KCDRRSVSIG
Sbjct  109  KCDRRSVSIG  118



>ref|XP_010500236.1| PREDICTED: F-box protein At1g47056-like [Camelina sativa]
Length=520

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 86/130 (66%), Gaps = 12/130 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS S A  +     R KS S        ESE S              DYTS +PDECL
Sbjct  1    MGQSTSAAGNSILNQRRTKSFSLKFPIQSLESEVSQP------------DYTSYLPDECL  48

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A +FQ L+SG+RKRC+LVCRRW+ +EGQ+R+RLSL+A +DL     S+FSRFD+VTKL+L
Sbjct  49   ALVFQFLNSGNRKRCALVCRRWMIVEGQNRYRLSLHARSDLITSVPSLFSRFDSVTKLSL  108

Query  518  KCDRRSVSIG  547
            KCDRRSVSIG
Sbjct  109  KCDRRSVSIG  118



>ref|NP_175151.1| VIER F-box protein 1 [Arabidopsis thaliana]
 sp|Q9C626.1|FB37_ARATH RecName: Full=F-box protein At1g47056 [Arabidopsis thaliana]
 gb|AAG50633.1|AC083835_18 hypothetical protein [Arabidopsis thaliana]
 gb|AEE32134.1| VIER F-box protein 1 [Arabidopsis thaliana]
Length=518

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 91/130 (70%), Gaps = 12/130 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS  T+A   +  +R +S+S     P++  ES               DYTS++PDECL
Sbjct  1    MGQS--TSAAGNSILNRRRSKSFTLKFPIESIESEISQP----------DYTSSLPDECL  48

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A +FQ L+SG+RKRC+LVCRRW+ +EGQ+R+RLSL+A +DL     S+FSRFD+VTKL+L
Sbjct  49   ALVFQFLNSGNRKRCALVCRRWMIVEGQNRYRLSLHARSDLITSIPSLFSRFDSVTKLSL  108

Query  518  KCDRRSVSIG  547
            KCDRRSVSIG
Sbjct  109  KCDRRSVSIG  118



>ref|XP_010461510.1| PREDICTED: F-box protein At1g47056-like [Camelina sativa]
Length=519

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 86/130 (66%), Gaps = 12/130 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS S A  +     R K+ S        ESE S              DYTS +PDECL
Sbjct  1    MGQSTSAAGNSILNQRRSKAFSLKFPIQSLESEVSQP------------DYTSYLPDECL  48

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A +FQ L+SG+RKRC+LVCRRW+ +EGQ+R+RLSL+A +DL     S+FSRFD+VTKL+L
Sbjct  49   ALVFQFLNSGNRKRCALVCRRWMIVEGQNRYRLSLHARSDLITSVPSLFSRFDSVTKLSL  108

Query  518  KCDRRSVSIG  547
            KCDRRSVSIG
Sbjct  109  KCDRRSVSIG  118



>ref|XP_004499020.1| PREDICTED: F-box protein At1g47056-like [Cicer arietinum]
Length=546

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DY S++PDECLA +FQ LSS DR RCSLVCRRWL +EGQSR RLSLNA  DL  V  S+F
Sbjct  57   DYISDLPDECLAIVFQSLSSADRNRCSLVCRRWLLVEGQSRQRLSLNAQLDLLPVIDSLF  116

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLALKCDRRSVSI
Sbjct  117  TRFDSVTKLALKCDRRSVSI  136



>ref|XP_002894031.1| vier F-box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70290.1| vier F-box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 90/130 (69%), Gaps = 11/130 (8%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS  T+A   +  +R +S+S +   PM+              +    DYTS +PDECL
Sbjct  1    MGQS--TSAAGNSILNRRRSKSFSLKFPMES---------IIKPEISQPDYTSCLPDECL  49

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A +FQ L+SG+RKRC+LVCRRW+ +EGQ+R+RLSL+A +DL     SIFSRFD+VTKL+L
Sbjct  50   ALVFQFLNSGNRKRCALVCRRWMIVEGQNRYRLSLHARSDLITSIPSIFSRFDSVTKLSL  109

Query  518  KCDRRSVSIG  547
            KCDRRSVSIG
Sbjct  110  KCDRRSVSIG  119



>ref|XP_006393625.1| hypothetical protein EUTSA_v10011393mg [Eutrema salsugineum]
 gb|ESQ30911.1| hypothetical protein EUTSA_v10011393mg [Eutrema salsugineum]
Length=518

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 87/130 (67%), Gaps = 13/130 (10%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS S A  +     R K+ S+       +SE               +DY+S++PDECL
Sbjct  1    MGQSTSAAGNSILNRRRTKTFSSKFPIEPDKSEVL-------------FDYSSSLPDECL  47

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A +FQ L+SG+RKRC+LVCRRW  +EGQ+R+RLSL+A ADL     S+FSRFD+VTKL+L
Sbjct  48   ALVFQFLNSGNRKRCALVCRRWKIVEGQNRYRLSLHARADLITSIPSLFSRFDSVTKLSL  107

Query  518  KCDRRSVSIG  547
            KCDRRSVSIG
Sbjct  108  KCDRRSVSIG  117



>ref|XP_010549251.1| PREDICTED: F-box protein At1g47056-like [Tarenaya hassleriana]
Length=508

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 84/130 (65%), Gaps = 15/130 (12%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS+S    +  +S  G    + ++SP+K                G+ D+T  +PDECL
Sbjct  1    MGQSSSLTGTSIARSS-GDGHRSRSLSPVKSD--------------GSSDHTWRLPDECL  45

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
             C+FQ LSSGDRKRCSLVCRRW+ +E +SRH LSL A  DL     S+FSRFD+VTKL L
Sbjct  46   VCVFQLLSSGDRKRCSLVCRRWMTVEARSRHHLSLYAKWDLFPAIPSLFSRFDSVTKLTL  105

Query  518  KCDRRSVSIG  547
            KCDRRS+SIG
Sbjct  106  KCDRRSISIG  115



>gb|EYU44437.1| hypothetical protein MIMGU_mgv1a027103mg [Erythranthe guttata]
Length=548

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
             DY+S IPDECLA IFQ LSSGDRKR SLVCRRW  +EGQSRHRL+LNA  D+A    SI
Sbjct  49   LDYSSEIPDECLALIFQSLSSGDRKRSSLVCRRWFSVEGQSRHRLALNASVDVAGHLPSI  108

Query  482  FSRFDAVTKLALKCDRRSVSI  544
            F+RFD+VTKLAL+CDR+SVSI
Sbjct  109  FTRFDSVTKLALRCDRKSVSI  129



>ref|XP_010070601.1| PREDICTED: F-box protein SKIP2-like [Eucalyptus grandis]
Length=534

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
            YDYT ++PDECLA +F  L +GDRKRCS+VCRRW +++G+SRHRLSLNA ADL     S+
Sbjct  56   YDYTGDLPDECLAHVFHFLGTGDRKRCSVVCRRWRRVDGESRHRLSLNAQADLLLSLPSV  115

Query  482  FSRFDAVTKLALKCDRRSVSIG  547
            FSRFDAVTKLAL+CDR+SVS+G
Sbjct  116  FSRFDAVTKLALRCDRKSVSLG  137



>ref|XP_006339852.1| PREDICTED: F-box protein SKIP2-like [Solanum tuberosum]
Length=550

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G  DYT ++PDECLA IFQCLSSGDRK+CSLV RRWL +EGQS HRL+LNA  ++     
Sbjct  58   GNRDYTDDLPDECLALIFQCLSSGDRKKCSLVSRRWLLVEGQSHHRLALNAKVEILPHVP  117

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
            +IF+RFD+VTKLAL+CDR+SVSI
Sbjct  118  TIFTRFDSVTKLALRCDRKSVSI  140



>ref|XP_008797648.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At1g47056-like 
[Phoenix dactylifera]
Length=173

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++P++CLA IFQ L SGDRKRCSL CRRWL +EGQSRHRLSL++ A L + A S+F
Sbjct  15   DHTEDLPNDCLALIFQSLGSGDRKRCSLXCRRWLVVEGQSRHRLSLDSRAALLEAAPSLF  74

Query  485  SRFDAVTKLALKCDRRSVSIG  547
            SRFD V+KLALKCDRRS SIG
Sbjct  75   SRFDGVSKLALKCDRRSDSIG  95



>ref|XP_008377999.1| PREDICTED: F-box protein At1g47056-like [Malus domestica]
Length=482

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A D+ S++ DECLACIF+ L SGDRKRCSLVCRRWL+IEGQSR RLSL+A +DL  +  S
Sbjct  42   ATDFISDLSDECLACIFRSLGSGDRKRCSLVCRRWLRIEGQSRLRLSLHAQSDLLPIIPS  101

Query  479  IFSRFDAVTKLALKCDRRSVSIG  547
            +FSRFDAVTKL+LKCD R VS+G
Sbjct  102  LFSRFDAVTKLSLKCDSRCVSVG  124



>emb|CBI33774.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            +  + S+A G   +      RSTA  SP+  S    D    S + DG  DYTS++PD+ L
Sbjct  56   LAPAMSSAPGMYLRESNSSLRSTAR-SPLYISMPETDDCVESSEVDGP-DYTSDLPDDIL  113

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            ACIFQ LS+GDRKRCSLVC+RWL +EG+SRHRLSLNA +++  +   IF RFD+V+KL L
Sbjct  114  ACIFQFLSTGDRKRCSLVCQRWLLVEGRSRHRLSLNAQSEIIPLIPCIFFRFDSVSKLTL  173

Query  518  KCDRRSVSI  544
            KCDRRS+SI
Sbjct  174  KCDRRSISI  182



>ref|XP_006286719.1| hypothetical protein CARUB_v10002927mg, partial [Capsella rubella]
 gb|EOA19617.1| hypothetical protein CARUB_v10002927mg, partial [Capsella rubella]
Length=568

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 80/129 (62%), Gaps = 19/129 (15%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS ST         R KS  T+ + P +  E               YDYTS +PDECL
Sbjct  62   MGQSTSTF-------RRSKSNFTSPLLPNEAEEDE------------PYDYTSILPDECL  102

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
              IFQ L+  DRKRCSLVCRRWL+IEGQ RHRLSL A +DL  V  S+FSRFD+VTKL L
Sbjct  103  PLIFQSLTCADRKRCSLVCRRWLEIEGQCRHRLSLKAQSDLISVIPSLFSRFDSVTKLVL  162

Query  518  KCDRRSVSI  544
            + DRRS+ I
Sbjct  163  RSDRRSLGI  171



>ref|XP_010679539.1| PREDICTED: F-box protein SKIP2 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 94/139 (68%), Gaps = 10/139 (7%)
 Frame = +2

Query  158  MGQSASTAAGA------QNQSHRGKSRSTAAI----SPMKESEssddvtdgsidddGAYD  307
            MGQS S  A +       ++S    +R T++     +PM    SS      +  +    D
Sbjct  1    MGQSPSIPANSPELTRHHSRSFSFTTRLTSSTRKKQTPMIHPPSSPTHDPLTEPEYNLPD  60

Query  308  YTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFS  487
             TS+IPDECLA IFQ LSSGDRKRCSLVC+RWL++EGQSR RLSLN+ ++++   +S+FS
Sbjct  61   PTSDIPDECLAHIFQSLSSGDRKRCSLVCKRWLRVEGQSRFRLSLNSNSEISTHLSSLFS  120

Query  488  RFDAVTKLALKCDRRSVSI  544
            RFD+VTKLAL+CDRRS+SI
Sbjct  121  RFDSVTKLALRCDRRSISI  139



>emb|CDP02535.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKS--RSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDE  331
            MGQSAS    +   S    S  R   A  P   S +  +            DYTS IPDE
Sbjct  1    MGQSASVHVYSPGGSTPTSSHCRCITANQPDAVSSTDVNAQLTLPIFGDEQDYTSEIPDE  60

Query  332  CLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKL  511
            CLA IFQ LSSGDRK CSLV +RWL +EGQSRHRLSLNA AD+     +IFSRFD+VTKL
Sbjct  61   CLALIFQSLSSGDRKSCSLVSKRWLLVEGQSRHRLSLNATADIYSQIPAIFSRFDSVTKL  120

Query  512  ALKCDRRSVSI  544
            AL+CDR+S SI
Sbjct  121  ALRCDRKSSSI  131



>gb|AAP03878.1| Avr9/Cf-9 rapidly elicited protein 189 [Nicotiana tabacum]
Length=550

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT  +PDECLA IFQCLSSGDRK+CSLV RRWL +EGQSRHRLSLNA A+      +IF
Sbjct  58   DYTYELPDECLALIFQCLSSGDRKKCSLVWRRWLLVEGQSRHRLSLNAKAEFLPHIPTIF  117

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRFD+ TKLAL+CDR+SVSI
Sbjct  118  SRFDSGTKLALRCDRKSVSI  137



>ref|XP_006343196.1| PREDICTED: F-box protein SKIP2-like [Solanum tuberosum]
Length=549

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT  +PDECLA IFQ LSSGDRKR SLVCRRWL +EG SRHRLSLNA A++     +IF
Sbjct  53   DYTDGLPDECLALIFQSLSSGDRKRSSLVCRRWLLVEGVSRHRLSLNAKAEIIPDIPTIF  112

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRFD+VTKLAL+CDRRSVSI
Sbjct  113  SRFDSVTKLALRCDRRSVSI  132



>gb|KFK44642.1| hypothetical protein AALP_AA1G285200 [Arabis alpina]
Length=519

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 91/135 (67%), Gaps = 20/135 (15%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPM-----KESEssddvtdgsidddGAYDYTSNI  322
            MGQS  T+A   +  HR +++S A   P+      ESE              + DYTS +
Sbjct  1    MGQS--TSAAGNSTLHRRRTKSFAFRLPIATVGSHESEI-------------SPDYTSYL  45

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PD+CLA +FQ L+SGDRKRC+LV +RW+ IEGQ+R+R+SL+A +DL     S+FSRFD+V
Sbjct  46   PDDCLALVFQLLNSGDRKRCALVSKRWMIIEGQNRYRISLHARSDLLTSIPSLFSRFDSV  105

Query  503  TKLALKCDRRSVSIG  547
            TKL+LKCDRRSVSIG
Sbjct  106  TKLSLKCDRRSVSIG  120



>ref|XP_008799696.1| PREDICTED: F-box protein At1g47056-like [Phoenix dactylifera]
Length=525

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++P++CLA IFQ L SGDRKRCSLVCRRWL +EGQSRHRLSL++ A L + A S+F
Sbjct  39   DHTEDLPNDCLALIFQSLGSGDRKRCSLVCRRWLVVEGQSRHRLSLDSRAALLEAAPSLF  98

Query  485  SRFDAVTKLALKCDRRSVSIG  547
            SRFD V+KLALKCDRRS SIG
Sbjct  99   SRFDGVSKLALKCDRRSDSIG  119



>ref|XP_002283593.1| PREDICTED: F-box protein At1g47056 isoform X2 [Vitis vinifera]
Length=515

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            +  + S+A G   +      RSTA  SP+  S    D    S + DG  DYTS++PD+ L
Sbjct  30   LAPAMSSAPGMYLRESNSSLRSTAR-SPLYISMPETDDCVESSEVDGP-DYTSDLPDDIL  87

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            ACIFQ LS+GDRKRCSLVC+RWL +EG+SRHRLSLNA +++  +   IF RFD+V+KL L
Sbjct  88   ACIFQFLSTGDRKRCSLVCQRWLLVEGRSRHRLSLNAQSEIIPLIPCIFFRFDSVSKLTL  147

Query  518  KCDRRSVSI  544
            KCDRRS+SI
Sbjct  148  KCDRRSISI  156



>gb|EYU25467.1| hypothetical protein MIMGU_mgv1a022622mg, partial [Erythranthe 
guttata]
Length=457

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTSN+PDECLA IF  LSSGDRKR SLVCRRWL++EGQSR RLSLN+ ++LAD    + 
Sbjct  3    DYTSNLPDECLASIFDSLSSGDRKRSSLVCRRWLRVEGQSRDRLSLNSKSELADFLPRLL  62

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD+VTKL+LKCDRRS+SI
Sbjct  63   LRFDSVTKLSLKCDRRSISI  82



>ref|XP_004234661.1| PREDICTED: F-box protein SKIP2-like [Solanum lycopersicum]
Length=549

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT  +PDECLA IFQ LSSGDRKR SLVCRRWL +EG SRHRLSLNA +++     +IF
Sbjct  53   DYTDGLPDECLALIFQSLSSGDRKRSSLVCRRWLLVEGISRHRLSLNAKSEIIPDIPTIF  112

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRFD+VTKLAL+CDRRSVSI
Sbjct  113  SRFDSVTKLALRCDRRSVSI  132



>gb|KDO36473.1| hypothetical protein CISIN_1g038746mg, partial [Citrus sinensis]
Length=147

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 90/129 (70%), Gaps = 11/129 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQ+ STA    + S R    S A +S        +D  + S + D A D+T ++PD+CL
Sbjct  1    MGQTPSTAI---DPSDRFNILSPAIVS--------NDGVEFSDELDKARDFTGDLPDDCL  49

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A IFQ L SGDRKRCSLVC+RWL+++G SR+RLSLNA +++     S+FSRFD+VTKLAL
Sbjct  50   AYIFQFLGSGDRKRCSLVCKRWLRVDGGSRYRLSLNAQSEILSSLPSVFSRFDSVTKLAL  109

Query  518  KCDRRSVSI  544
            +CDR+S+S+
Sbjct  110  RCDRKSISL  118



>gb|AAL07231.1| putative SKP1 interacting partner SKIP2 [Arabidopsis thaliana]
Length=304

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQSRHRLSL+A  +++   TS+F
Sbjct  41   DFTGDLPDECLAHVFQFLGAGDRKRCSLVCKRWLLVDGQSRHRLSLDAKDEISSFLTSMF  100

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  101  NRFDSVTKLALRCDRKSVSL  120



>ref|XP_006579900.1| PREDICTED: F-box protein SKIP2-like isoform X1 [Glycine max]
 ref|XP_006579901.1| PREDICTED: F-box protein SKIP2-like isoform X2 [Glycine max]
 ref|XP_006579902.1| PREDICTED: F-box protein SKIP2-like isoform X3 [Glycine max]
 ref|XP_006579903.1| PREDICTED: F-box protein SKIP2-like isoform X4 [Glycine max]
 ref|XP_006579904.1| PREDICTED: F-box protein SKIP2-like isoform X5 [Glycine max]
 ref|XP_006579905.1| PREDICTED: F-box protein SKIP2-like isoform X6 [Glycine max]
 ref|XP_006579906.1| PREDICTED: F-box protein SKIP2-like isoform X7 [Glycine max]
Length=559

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 85/138 (62%), Gaps = 21/138 (15%)
 Frame = +2

Query  131  YVVSRTVEWMGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDY  310
            +++   +  MGQ+ ST   + + SHR    +  +I                       DY
Sbjct  19   HIIFFFISPMGQAPSTPVSSTDLSHRDIFTTDESI---------------------GRDY  57

Query  311  TSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSR  490
            T++IPDECLA IFQ LSS DRK CS VCRRWL+++G++R RLSLNA A L D   S+FSR
Sbjct  58   TADIPDECLAGIFQFLSSVDRKTCSAVCRRWLRVDGENRQRLSLNAKASLVDFVPSLFSR  117

Query  491  FDAVTKLALKCDRRSVSI  544
            FD+VTKLAL+CDR+S S+
Sbjct  118  FDSVTKLALRCDRKSTSV  135



>ref|XP_010652772.1| PREDICTED: F-box protein At1g47056 isoform X1 [Vitis vinifera]
Length=563

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++PD+ LACIFQ LS+GDRKRCSLVC+RWL +EG+SRHRLSLNA +++  +   IF
Sbjct  77   DYTSDLPDDILACIFQFLSTGDRKRCSLVCQRWLLVEGRSRHRLSLNAQSEIIPLIPCIF  136

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD+V+KL LKCDRRS+SI
Sbjct  137  FRFDSVSKLTLKCDRRSISI  156



>gb|KDO36634.1| hypothetical protein CISIN_1g040130mg, partial [Citrus sinensis]
Length=147

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A D+T ++PD+CLA IFQ L SGDRKRCSLVC+RWL+++G SR+RLSLNA +++     S
Sbjct  37   ARDFTGDLPDDCLAYIFQFLGSGDRKRCSLVCKRWLRVDGGSRYRLSLNAQSEILSSLPS  96

Query  479  IFSRFDAVTKLALKCDRRSVSI  544
            +FSRFD+VTKLAL+CDR+S+S+
Sbjct  97   VFSRFDSVTKLALRCDRKSISL  118



>ref|XP_010421728.1| PREDICTED: putative F-box/LRR-repeat protein 8 [Camelina sativa]
Length=516

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 82/130 (63%), Gaps = 20/130 (15%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQSAS       +  R K + T+ + P +  E               YDYT N+PDEC+
Sbjct  1    MGQSAS-------RFRRSKGKFTSPVLPDEAEEDE------------PYDYTCNLPDECV  41

Query  338  ACIFQCLSSG-DRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLA  514
            + IFQ L+ G DRKRCSLVCRRWL+IEGQ RHRLSL A +DL     S+FSRFD+VTKL 
Sbjct  42   SLIFQSLTCGADRKRCSLVCRRWLKIEGQCRHRLSLKAQSDLISAVPSLFSRFDSVTKLV  101

Query  515  LKCDRRSVSI  544
            L+ DRRS+ I
Sbjct  102  LRSDRRSLGI  111



>emb|CAN59800.1| hypothetical protein VITISV_038872 [Vitis vinifera]
Length=1151

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            +  + S+A G   +      RSTA  SP+  S    D    S + DG  DYTS++PD+ L
Sbjct  30   LAPAMSSAPGMYLRESNSSLRSTAR-SPLYISMPETDDCVESSEVDGP-DYTSDLPDDIL  87

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            ACIFQ LS+GDRKRCSLVC+RWL +EG+SRHRLSLNA +++  +   IF RFD+V+KL L
Sbjct  88   ACIFQFLSTGDRKRCSLVCQRWLLVEGRSRHRLSLNAQSEIIPLIPXIFFRFDSVSKLXL  147

Query  518  KCDRRSVSI  544
            KCDRRS+SI
Sbjct  148  KCDRRSISI  156



>ref|XP_002874480.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50739.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 82/129 (64%), Gaps = 15/129 (12%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS ST         R K+  T+ + P  E E +    +        YD TSN+PDECL
Sbjct  28   MGQSTSTF-------RRSKASFTSPVLP-NEGEHNSGADE-------PYDCTSNLPDECL  72

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            + IFQ L+  DRKRCSLVCRRWL IEGQ RHRLSL A +DL  V  S+FSRFD+VTKL L
Sbjct  73   SLIFQSLTCADRKRCSLVCRRWLTIEGQCRHRLSLKAQSDLISVIPSLFSRFDSVTKLVL  132

Query  518  KCDRRSVSI  544
            + DRRS+ I
Sbjct  133  RSDRRSLGI  141



>ref|XP_010095311.1| F-box protein SKIP2 [Morus notabilis]
 gb|EXB59522.1| F-box protein SKIP2 [Morus notabilis]
Length=567

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +2

Query  200  SHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECLACIFQCLSSGDRKR  379
            S R   R +A IS +++ E  +     S    G  DYT ++PDECLA +FQ L +GDRKR
Sbjct  13   SRRFSFRPSAVISSVEQIEEPEVSESVS----GGRDYTFDLPDECLALVFQFLGAGDRKR  68

Query  380  CSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKCDRRSVSI  544
            CSLVC+RW +++GQ+R RLSLNA +D+     S+F+RFD+VTKLAL+CDR+S+SI
Sbjct  69   CSLVCKRWFRVDGQNRCRLSLNAQSDILPFVPSLFARFDSVTKLALRCDRKSISI  123



>ref|XP_003550997.1| PREDICTED: F-box protein SKIP2-like [Glycine max]
Length=539

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G  DYT++IPDECLA IFQ LSS DRK CS VCRRWL+++G++R RLSLNA A L D   
Sbjct  34   GGRDYTADIPDECLAGIFQFLSSVDRKTCSAVCRRWLRVDGENRQRLSLNAKASLVDFVP  93

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
            S+FSRFD+VTKLAL+CDR+S S+
Sbjct  94   SLFSRFDSVTKLALRCDRKSASV  116



>dbj|BAE98487.1| hypothetical protein [Arabidopsis thaliana]
Length=527

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQSRHRLSL+A  +++   TS+F
Sbjct  41   DFTGDLPDECLAHVFQFLGAGDRKRCSLVCKRWLLVDGQSRHRLSLDAKDEISSFLTSMF  100

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  101  NRFDSVTKLALRCDRKSVSL  120



>ref|NP_569047.1| F-box protein SKIP2 [Arabidopsis thaliana]
 sp|Q9FE83.1|SKIP2_ARATH RecName: Full=F-box protein SKIP2; AltName: Full=SKP1-interacting 
partner 2 [Arabidopsis thaliana]
 dbj|BAB10959.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAG21977.1| SKP1 interacting partner 2 [Arabidopsis thaliana]
 gb|AAO00833.1| SKP1 interacting partner 2 (SKIP2) [Arabidopsis thaliana]
 gb|AAP68325.1| At5g67250 [Arabidopsis thaliana]
 gb|AED98320.1| F-box protein SKIP2 [Arabidopsis thaliana]
Length=527

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQSRHRLSL+A  +++   TS+F
Sbjct  41   DFTGDLPDECLAHVFQFLGAGDRKRCSLVCKRWLLVDGQSRHRLSLDAKDEISSFLTSMF  100

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  101  NRFDSVTKLALRCDRKSVSL  120



>emb|CDY01426.1| BnaA07g11990D [Brassica napus]
Length=1083

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQ+RHRLSL+A A++    TS+F
Sbjct  42   DYTLDLPDECLAHVFQYLGAGDRKRCSLVCKRWLFVDGQNRHRLSLDARAEIFSFLTSMF  101

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD+VTKLAL+CDR+SVS+
Sbjct  102  DRFDSVTKLALRCDRKSVSL  121



>emb|CDY12824.1| BnaC07g16090D [Brassica napus]
Length=1090

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQ+RHRLSL+A A++    TS+F
Sbjct  42   DYTLDLPDECLAHVFQYLGAGDRKRCSLVCKRWLFVDGQNRHRLSLDARAEIFSFLTSMF  101

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD+VTKLAL+CDR+SVS+
Sbjct  102  DRFDSVTKLALRCDRKSVSL  121



>emb|CDY25663.1| BnaC05g25420D [Brassica napus]
Length=514

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 85/129 (66%), Gaps = 16/129 (12%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS S A        R K  S+   SP+ E+E              + DYTS +PDECL
Sbjct  1    MGQSTSAAGKIILNGRRTKLLSSK--SPI-ETEV-------------SPDYTSYLPDECL  44

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A +FQ L+SG+RKRC+LVCRRW+ +EG++RHRLSL+A + L     S+FSRFD+V KL+L
Sbjct  45   ALVFQFLNSGNRKRCALVCRRWMIVEGRNRHRLSLHARSALITSIPSLFSRFDSVVKLSL  104

Query  518  KCDRRSVSI  544
            KCDRRSVSI
Sbjct  105  KCDRRSVSI  113



>ref|NP_566928.1| VIER F-box protein 2 [Arabidopsis thaliana]
 sp|Q9SN10.1|FBL16_ARATH RecName: Full=F-box/LRR-repeat protein 16 [Arabidopsis thaliana]
 emb|CAB62116.1| putative protein [Arabidopsis thaliana]
 gb|ABO09882.1| At3g50080 [Arabidopsis thaliana]
 gb|AEE78624.1| VIER F-box protein 2 [Arabidopsis thaliana]
Length=522

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G YD+T+N+PD+CLA IFQ LS+GDRKRCSLV +RWL ++GQ+RHRLSL+A +++     
Sbjct  36   GDYDFTANLPDDCLAHIFQFLSAGDRKRCSLVSKRWLLVDGQNRHRLSLDAKSEILPFLP  95

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
             IF+RFD+VTKLAL+CDRRS S+
Sbjct  96   CIFNRFDSVTKLALRCDRRSFSL  118



>ref|XP_009145044.1| PREDICTED: F-box protein At1g47056 [Brassica rapa]
Length=514

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS IPDECLA +FQ L+SG+RKRC+LVCRRW+ +EG++RHRLSL+A + L     S+F
Sbjct  34   DYTSYIPDECLALVFQFLNSGNRKRCALVCRRWMIVEGRNRHRLSLHARSALITWIPSLF  93

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRFD+V KL+LKCDRRSVSI
Sbjct  94   SRFDSVVKLSLKCDRRSVSI  113



>emb|CDY43846.1| BnaA05g18580D [Brassica napus]
Length=514

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS IPDECLA +FQ L+SG+RKRC+LVCRRW+ +EG++RHRLSL+A + L     S+F
Sbjct  34   DYTSYIPDECLALVFQFLNSGNRKRCALVCRRWMIVEGRNRHRLSLHARSALITWIPSLF  93

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRFD+V KL+LKCDRRSVSI
Sbjct  94   SRFDSVVKLSLKCDRRSVSI  113



>ref|XP_008393628.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein SKIP2-like [Malus 
domestica]
Length=447

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++PDECLA IF  L +GDRKR SLVC RWL+++GQSRHRLS NA A L     ++F
Sbjct  52   DYTSDLPDECLASIFHFLCAGDRKRSSLVCHRWLRVDGQSRHRLSJNAQAGLXPFLPALF  111

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+S+S+
Sbjct  112  ARFDSVTKLALRCDRKSISL  131



>ref|XP_002865015.1| hypothetical protein ARALYDRAFT_919984 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41274.1| hypothetical protein ARALYDRAFT_919984 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQ+RHRLSL+A  ++    TS+F
Sbjct  44   DFTGDLPDECLAHVFQFLGAGDRKRCSLVCKRWLYVDGQNRHRLSLDAKDEIFPFLTSMF  103

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  104  NRFDSVTKLALRCDRKSVSL  123



>gb|KDP31990.1| hypothetical protein JCGZ_12451 [Jatropha curcas]
Length=523

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 13/129 (10%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQSAST   + N+       S+   SP    E + D            DYT  IPDECL
Sbjct  1    MGQSASTTNSSANRVLTPAFLSSE--SPQLVEEMTTD-----------VDYTEYIPDECL  47

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A IF  LS+GDRKRCS VCRRWL ++G+SRHRLSLNA A++     ++F RFD+VTKLAL
Sbjct  48   AYIFHFLSAGDRKRCSSVCRRWLFVDGRSRHRLSLNAKAEIVSYVPNLFMRFDSVTKLAL  107

Query  518  KCDRRSVSI  544
            +CDR+S+S+
Sbjct  108  RCDRKSMSL  116



>gb|KFK28417.1| hypothetical protein AALP_AA8G512100 [Arabis alpina]
Length=536

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQ+RHRLSL+A  ++    TS+F
Sbjct  42   DFTGDLPDECLAHVFQFLGAGDRKRCSLVCKRWLFVDGQNRHRLSLDARDEIFSFITSMF  101

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  102  NRFDSVTKLALRCDRKSVSL  121



>ref|XP_006394452.1| hypothetical protein EUTSA_v10003994mg [Eutrema salsugineum]
 gb|ESQ31738.1| hypothetical protein EUTSA_v10003994mg [Eutrema salsugineum]
Length=523

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQ+RHRLSL+A  ++    TS+F
Sbjct  44   DFTGDLPDECLAHVFQYLGAGDRKRCSLVCKRWLFVDGQNRHRLSLDAKDEIFSFLTSMF  103

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  104  NRFDSVTKLALRCDRKSVSL  123



>ref|XP_010484524.1| PREDICTED: F-box protein SKIP2-like [Camelina sativa]
Length=539

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQ RHRLSL+A  ++    TSIF
Sbjct  49   DFTGDLPDECLAHVFQFLGAGDRKRCSLVCKRWLFVDGQYRHRLSLDAKDEIFSFLTSIF  108

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  109  NRFDSVTKLALRCDRKSVSL  128



>ref|XP_008351948.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein SKIP2-like [Malus 
domestica]
Length=447

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++PDECLA IF  L +GDRKR SLVC RWL+++G+SRHRLSLNA A L     ++F
Sbjct  52   DYTSDLPDECLASIFHFLCAGDRKRSSLVCHRWLRVDGZSRHRLSLNAQAGLXPFLPALF  111

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+S+S+
Sbjct  112  ARFDSVTKLALRCDRKSISL  131



>ref|NP_567316.1| VIER F-box protein 3 [Arabidopsis thaliana]
 sp|Q9S9X4.1|FBL8_ARATH RecName: Full=Putative F-box/LRR-repeat protein 8 [Arabidopsis 
thaliana]
 gb|AAD48947.1|AF147262_10 contains similarity to the Pfam family PF00646 - F-box domain; 
score=10.1, E=1.2, N=1 [Arabidopsis thaliana]
 emb|CAB81110.1| AT4g07400 [Arabidopsis thaliana]
 gb|AEE82565.1| VIER F-box protein 3 [Arabidopsis thaliana]
Length=554

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
            YDY SN+PDECL+ IFQ L+  D KRCSLVCRRWL IEGQ RHRLSL A +DL  V  S+
Sbjct  71   YDYISNLPDECLSLIFQSLTCADLKRCSLVCRRWLTIEGQCRHRLSLKAQSDLISVIPSL  130

Query  482  FSRFDAVTKLALKCDRRSVSI  544
            F+RFD+VTKL L+ DRRS+ I
Sbjct  131  FTRFDSVTKLVLRSDRRSLGI  151



>ref|XP_010061718.1| PREDICTED: F-box protein At1g47056 [Eucalyptus grandis]
Length=538

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  SNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRF  493
            S++PDECLAC+FQ L SGDR RCSLVCRRWL +EGQSR RL+L+A ++L +   ++F+RF
Sbjct  58   SDLPDECLACVFQYLGSGDRARCSLVCRRWLAVEGQSRQRLALHAQSELLEAVPALFARF  117

Query  494  DAVTKLALKCDRRSVSIG  547
            D+V+KLALKCDR+++SIG
Sbjct  118  DSVSKLALKCDRKALSIG  135



>ref|XP_009372440.1| PREDICTED: F-box protein SKIP2-like [Pyrus x bretschneideri]
Length=533

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++PDECLA IF  L +GDRKR SLVC RWL+++GQSRHRLSLNA A L      +F
Sbjct  52   DYTSDLPDECLASIFHFLGAGDRKRSSLVCHRWLRVDGQSRHRLSLNAQAGLLPFLPVLF  111

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+S+S+
Sbjct  112  ARFDSVTKLALRCDRKSISL  131



>ref|XP_010464300.1| PREDICTED: F-box protein SKIP2-like [Camelina sativa]
Length=540

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA IFQ L +GDRKRCSLVC+RWL ++GQ RHRLSL+A  ++    TS+F
Sbjct  53   DFTGDLPDECLAHIFQFLGAGDRKRCSLVCKRWLFVDGQYRHRLSLDAKDEIFSFLTSMF  112

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  113  NRFDSVTKLALRCDRKSVSL  132



>ref|XP_006494494.1| PREDICTED: F-box protein SKIP2-like [Citrus sinensis]
Length=525

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A D+T ++PD+CLA IFQ L SGDRKRCSLVC+RWL+++G SR+RLSLNA +++     S
Sbjct  37   ARDFTGDLPDDCLAYIFQFLGSGDRKRCSLVCKRWLRVDGGSRYRLSLNAQSEILSSLPS  96

Query  479  IFSRFDAVTKLALKCDRRSVSI  544
            +FSRFD+VTKLAL+CDR+S+S+
Sbjct  97   VFSRFDSVTKLALRCDRKSISL  118



>ref|XP_006425977.1| hypothetical protein CICLE_v10025355mg [Citrus clementina]
 gb|ESR39217.1| hypothetical protein CICLE_v10025355mg [Citrus clementina]
Length=525

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A D+T ++PD+CLA IFQ L SGDRKRCSLVC+RWL+++G SR+RLSLNA +++     S
Sbjct  37   ARDFTGDLPDDCLAYIFQFLGSGDRKRCSLVCKRWLRVDGGSRYRLSLNAQSEILSSLPS  96

Query  479  IFSRFDAVTKLALKCDRRSVSI  544
            +FSRFD+VTKLAL+CDR+S+S+
Sbjct  97   VFSRFDSVTKLALRCDRKSISL  118



>ref|XP_003539331.1| PREDICTED: F-box protein SKIP2-like [Glycine max]
Length=526

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 79/129 (61%), Gaps = 17/129 (13%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS ST A      +R        I P  +S+ +              DYT  + D+CL
Sbjct  1    MGQSPSTTAAPPPDLNR---HQIPQIHPNTDSDFT--------------DYTLRLSDDCL  43

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A IF  LS+ DRKRCSLVCRRWL+++GQ RHRLSLNA  +L D   S+F+RFD+VTKLAL
Sbjct  44   AAIFHFLSTADRKRCSLVCRRWLRVDGQRRHRLSLNAQPELLDFVPSLFNRFDSVTKLAL  103

Query  518  KCDRRSVSI  544
            +CDR+  SI
Sbjct  104  RCDRKCASI  112



>ref|XP_009367537.1| PREDICTED: F-box protein SKIP2-like [Pyrus x bretschneideri]
Length=407

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 83/136 (61%), Gaps = 12/136 (9%)
 Frame = +2

Query  158  MGQS-------ASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTS  316
            MGQS       A  +    + S R      A +SP+ + +S               DYTS
Sbjct  1    MGQSYSFPESPAEHSPSEISTSRRFSFNPVAIVSPLNDKDSEFHGEVTQ-----GRDYTS  55

Query  317  NIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFD  496
            ++PDE LA IF  L +GDRKR SLVCRRWL+++GQSRHRLSLNA A L     + F+RFD
Sbjct  56   DLPDELLASIFHFLGAGDRKRSSLVCRRWLRVDGQSRHRLSLNAHAGLLRFLPAFFARFD  115

Query  497  AVTKLALKCDRRSVSI  544
            +VTKLAL+CDR+S+S+
Sbjct  116  SVTKLALRCDRKSISL  131



>ref|XP_006858612.1| hypothetical protein AMTR_s00198p00016850 [Amborella trichopoda]
 gb|ERN20079.1| hypothetical protein AMTR_s00198p00016850 [Amborella trichopoda]
Length=517

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D  S +PDECLACIFQ L  GDRKRCSLVC+RWL++EGQSR RLSL+A + L     S+F
Sbjct  34   DLISELPDECLACIFQSLGPGDRKRCSLVCKRWLRVEGQSRQRLSLDATSHLLTAIPSLF  93

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD V+KLALKCDRR +SI
Sbjct  94   VRFDRVSKLALKCDRRMLSI  113



>ref|XP_010444675.1| PREDICTED: F-box protein SKIP2 [Camelina sativa]
Length=538

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA +FQ L +GDRKRCSLVC+RWL ++GQ RHRLSL+A  ++    TS+F
Sbjct  47   DFTGDLPDECLAHVFQFLGAGDRKRCSLVCKRWLFVDGQYRHRLSLDAKDEIFSFLTSMF  106

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  107  NRFDSVTKLALRCDRKSVSL  126



>ref|XP_010426552.1| PREDICTED: F-box/LRR-repeat protein 16 [Camelina sativa]
Length=522

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G YD+T+++PD+CLA IFQ LS+GDRKR SLVC+RWL ++GQ+RHRLSL+A A++     
Sbjct  38   GDYDFTADLPDDCLAHIFQFLSAGDRKRSSLVCKRWLFVDGQNRHRLSLDAKAEILPFLP  97

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
             +F RFD+VTKLAL+CDRRS S+
Sbjct  98   CMFDRFDSVTKLALRCDRRSFSL  120



>ref|XP_006404064.1| hypothetical protein EUTSA_v10011152mg [Eutrema salsugineum]
 gb|ESQ45517.1| hypothetical protein EUTSA_v10011152mg [Eutrema salsugineum]
Length=525

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G +D+T ++PD+CLA +FQ L +GDRKRCSLVC+RWL I+GQ+RHRLSL+A A++     
Sbjct  40   GHHDFTGDLPDDCLAHVFQFLGAGDRKRCSLVCKRWLLIDGQNRHRLSLDAKAEILPFLP  99

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
            S+F+RFD+V KLAL+CDR+S S+
Sbjct  100  SMFNRFDSVMKLALRCDRKSFSL  122



>gb|EPS69377.1| hypothetical protein M569_05387, partial [Genlisea aurea]
Length=490

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D T+ IPD+CLA IFQ LSSGDR+RCSL+CRRWL +EGQSR RL+LNA  +++    +IF
Sbjct  10   DRTAVIPDDCLALIFQFLSSGDRRRCSLICRRWLAVEGQSRQRLALNASGEVSLHLPAIF  69

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVSI
Sbjct  70   TRFDSVTKLALRCDRKSVSI  89



>ref|XP_006292484.1| hypothetical protein CARUB_v10018713mg [Capsella rubella]
 gb|EOA25382.1| hypothetical protein CARUB_v10018713mg [Capsella rubella]
Length=521

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G YD+T ++PD+CLA +F  LS+GDRKRCSLVC+RWL ++GQ+RHRLS++A A++     
Sbjct  36   GDYDFTGDLPDDCLAHVFNFLSAGDRKRCSLVCKRWLFVDGQNRHRLSVHAKAEILPFLP  95

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
             +F RFD+VTKLAL+CDRRS+S+
Sbjct  96   CMFDRFDSVTKLALRCDRRSLSM  118



>ref|XP_010550353.1| PREDICTED: F-box protein SKIP2-like [Tarenaya hassleriana]
Length=528

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            GA D+T ++PDECLA +F  L +GDRKRCSLVC+RWL+++G++RHRLSL+A  ++     
Sbjct  38   GARDFTGDLPDECLAHVFHFLGAGDRKRCSLVCKRWLRVDGENRHRLSLDARPEMLPFLP  97

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
            ++F+RFD+VTKL L+CDR+SVS+
Sbjct  98   AMFTRFDSVTKLVLRCDRKSVSL  120



>ref|XP_010688567.1| PREDICTED: putative F-box/LRR-repeat protein 8 [Beta vulgaris 
subsp. vulgaris]
Length=507

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
            +D+T ++PDECL+ IFQ L   DR  CSLVCRRWL +EGQSRHRL+LNA + L    +S+
Sbjct  31   HDFTYDLPDECLSIIFQSLQPSDRNSCSLVCRRWLTVEGQSRHRLTLNAQSHLFFSISSL  90

Query  482  FSRFDAVTKLALKCDRRSVSIG  547
            F+RFD+VTKL+LKCDRRS SIG
Sbjct  91   FNRFDSVTKLSLKCDRRSPSIG  112



>ref|XP_004289192.1| PREDICTED: F-box protein SKIP2 [Fragaria vesca subsp. vesca]
Length=532

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS+S       +      R +    P+  +   +D      D     DYT ++PDECL
Sbjct  1    MGQSSSIPETPPQREASPSRRFSFKQLPVMSTPDQNDDESDRSDTVDGRDYTLDLPDECL  60

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
              IF CL SGDRKR SLVC+RWL+++G+ RHRLSL+A A +      IF+RFD+VTKLAL
Sbjct  61   GIIFHCLGSGDRKRSSLVCQRWLRVDGEHRHRLSLSAQAGILPFIPCIFARFDSVTKLAL  120

Query  518  KCDRRSVSI  544
            +CDR+S+SI
Sbjct  121  RCDRKSISI  129



>ref|XP_008338344.1| PREDICTED: F-box protein SKIP2-like [Malus domestica]
Length=534

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++PDECLA IF  L +GDRKR SLVC RWL+++G+SRHRLSLNA A L     + F
Sbjct  52   DYTSDLPDECLASIFHFLCAGDRKRSSLVCHRWLRVDGZSRHRLSLNAQAGLXPFLPAXF  111

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+S+S+
Sbjct  112  ARFDSVTKLALRCDRKSISL  131



>ref|XP_006279774.1| hypothetical protein CARUB_v10027824mg [Capsella rubella]
 gb|EOA12672.1| hypothetical protein CARUB_v10027824mg [Capsella rubella]
Length=534

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++P+ECLA +FQ L +GDRKRCSLVC+RWL ++GQ RHRLSL+A  ++    TS+F
Sbjct  45   DFTGDLPNECLAHVFQFLGAGDRKRCSLVCKRWLFVDGQYRHRLSLDAKDEIFSFLTSMF  104

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+SVS+
Sbjct  105  NRFDSVTKLALRCDRKSVSL  124



>ref|XP_010943193.1| PREDICTED: F-box protein At1g47056-like [Elaeis guineensis]
Length=525

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 11/130 (8%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS+ST    + +     +R +AA+ P             +I    A D+T+++PDECL
Sbjct  1    MGQSSSTPCHRRPKLPFAAARPSAAMIP-----------AAAIFTGPARDHTADLPDECL  49

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A IFQ L SGDRKRCSLVCRRWL +EGQSRHRL+L+A A L + A ++F R+DAV+KLAL
Sbjct  50   ALIFQSLGSGDRKRCSLVCRRWLAVEGQSRHRLALDARAALLEAAAALFGRYDAVSKLAL  109

Query  518  KCDRRSVSIG  547
            KCDRRS SIG
Sbjct  110  KCDRRSDSIG  119



>ref|XP_010503677.1| PREDICTED: F-box/LRR-repeat protein 16-like [Camelina sativa]
Length=522

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G YD T+++PD+CLA IFQ LS+GDRKR SLVC+RWL ++GQ+RHRLSL+A A++     
Sbjct  38   GDYDLTADLPDDCLAHIFQFLSAGDRKRSSLVCKRWLFVDGQNRHRLSLDAKAEILPFLP  97

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
             +F RFD+VTKLAL+CDRRS S+
Sbjct  98   CMFDRFDSVTKLALRCDRRSFSL  120



>ref|XP_010515374.1| PREDICTED: F-box/LRR-repeat protein 16-like isoform X2 [Camelina 
sativa]
Length=522

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G +D+T+++PD+CLA IFQ LS+GDRKR SLVC+RWL ++GQ+RHRLSL+A A++     
Sbjct  38   GDHDFTADLPDDCLAHIFQFLSAGDRKRSSLVCKRWLFVDGQNRHRLSLDAKAEILPFLP  97

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
             +F RFD+VTKLAL+CDRRS S+
Sbjct  98   CMFDRFDSVTKLALRCDRRSFSL  120



>ref|XP_010515375.1| PREDICTED: F-box/LRR-repeat protein 16-like isoform X3 [Camelina 
sativa]
Length=523

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G +D+T+++PD+CLA IFQ LS+GDRKR SLVC+RWL ++GQ+RHRLSL+A A++     
Sbjct  38   GDHDFTADLPDDCLAHIFQFLSAGDRKRSSLVCKRWLFVDGQNRHRLSLDAKAEILPFLP  97

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
             +F RFD+VTKLAL+CDRRS S+
Sbjct  98   CMFDRFDSVTKLALRCDRRSFSL  120



>ref|XP_010515373.1| PREDICTED: F-box/LRR-repeat protein 16-like isoform X1 [Camelina 
sativa]
Length=522

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G +D+T+++PD+CLA IFQ LS+GDRKR SLVC+RWL ++GQ+RHRLSL+A A++     
Sbjct  38   GDHDFTADLPDDCLAHIFQFLSAGDRKRSSLVCKRWLFVDGQNRHRLSLDAKAEILPFLP  97

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
             +F RFD+VTKLAL+CDRRS S+
Sbjct  98   CMFDRFDSVTKLALRCDRRSFSL  120



>gb|KFK34272.1| hypothetical protein AALP_AA5G123400 [Arabis alpina]
Length=518

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
            YD+T ++P +CLA IFQ L++GDRKRCSLVC+RWL I+GQ+RHRLSL+A A++      +
Sbjct  45   YDFTGDLPSDCLAHIFQFLNAGDRKRCSLVCKRWLLIDGQNRHRLSLDAKAEILSFMPCM  104

Query  482  FSRFDAVTKLALKCDRRSVSI  544
            F+RFD+VTK+AL+CDR+S S+
Sbjct  105  FNRFDSVTKIALRCDRKSFSL  125



>ref|XP_009103439.1| PREDICTED: F-box protein SKIP2 [Brassica rapa]
Length=534

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT ++PDECLA +FQ L +GDRKRCSLVC+R L ++GQ+RHRLSL+A A++    TS+F
Sbjct  42   DYTLDLPDECLAHVFQYLGAGDRKRCSLVCKRCLFVDGQNRHRLSLDARAEIFSFLTSMF  101

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD+VTKLAL+CDR+SVS+
Sbjct  102  DRFDSVTKLALRCDRKSVSL  121



>ref|XP_008238850.1| PREDICTED: F-box protein SKIP2 [Prunus mume]
Length=537

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 83/134 (62%), Gaps = 5/134 (4%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKS---RSTAAISPMKESEssddvtdgsidddGAY--DYTSNI  322
            MGQS+S         HR  S   R +    P+  S       +    ++ A+  DYT+++
Sbjct  1    MGQSSSFPEAPAEHGHREISTSRRFSFKPMPILSSSPVQPDEEHDFYEEVAHGRDYTADL  60

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PDECLA IF  L SGDRK+ SLVC RW +++GQSRHRLSL A A L     S+F RFD+V
Sbjct  61   PDECLASIFHFLGSGDRKQSSLVCHRWFRVDGQSRHRLSLKAQAGLLPFLPSLFVRFDSV  120

Query  503  TKLALKCDRRSVSI  544
            TKLAL+CDR+S+S+
Sbjct  121  TKLALRCDRKSISL  134



>ref|XP_008391502.1| PREDICTED: F-box protein SKIP2-like [Malus domestica]
 ref|XP_008351389.1| PREDICTED: F-box protein SKIP2-like [Malus domestica]
Length=540

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++PDE LA IF  L +GDRKR SLVC RWL+++GQSRHRLSLNA A L     ++F
Sbjct  52   DYTSDLPDELLASIFHFLGAGDRKRSSLVCHRWLRVDGQSRHRLSLNAQAGLLTFLPALF  111

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+S+S+
Sbjct  112  ARFDSVTKLALRCDRKSISL  131



>ref|XP_008391497.1| PREDICTED: F-box protein SKIP2-like [Malus domestica]
Length=540

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++PDE LA IF  L +GDRKR SLVC RWL+++GQSRHRLSLNA A L     ++F
Sbjct  52   DYTSDLPDELLASIFHFLGAGDRKRSSLVCHRWLRVDGQSRHRLSLNAQAGLLTFLPALF  111

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+S+S+
Sbjct  112  ARFDSVTKLALRCDRKSISL  131



>ref|XP_007205025.1| hypothetical protein PRUPE_ppa003978mg [Prunus persica]
 gb|EMJ06224.1| hypothetical protein PRUPE_ppa003978mg [Prunus persica]
Length=537

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 83/138 (60%), Gaps = 13/138 (9%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRS---------TAAISPMKESEssddvtdgsidddGAYDY  310
            MGQS+S         HR  S S           + SP++  E  D   + +       DY
Sbjct  1    MGQSSSFPEAPAEHGHREISTSRRFSFKPMPILSSSPVQPDEEPDFYEEVTH----GRDY  56

Query  311  TSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSR  490
            T+++PDECLA IF  L SGDRK+ SLVC RW +++GQSRHRLSL A A L     S+F R
Sbjct  57   TADLPDECLASIFHFLGSGDRKQSSLVCHRWFRVDGQSRHRLSLKAQAGLLPFLPSLFVR  116

Query  491  FDAVTKLALKCDRRSVSI  544
            FD+VTKLAL+CDR+S+S+
Sbjct  117  FDSVTKLALRCDRKSISL  134



>ref|XP_011005818.1| PREDICTED: F-box protein SKIP2-like [Populus euphratica]
Length=519

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT  +PD+CLACIFQ L++ DRKR SLVC+RWL+++GQSR RLSLNA +++     SIF
Sbjct  35   DYTEGVPDDCLACIFQLLNAADRKRSSLVCKRWLRVDGQSRRRLSLNAQSEITSYLPSIF  94

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+V KL+L+CDR+S+S+
Sbjct  95   TRFDSVAKLSLRCDRKSLSL  114



>ref|XP_009112366.1| PREDICTED: F-box protein SKIP2-like [Brassica rapa]
Length=526

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT ++P ECLA +FQ L +GDRKRCSLVC+RWL ++GQ+RHRLSL+A  +++    S+F
Sbjct  45   DYTEDLPGECLAHVFQYLGAGDRKRCSLVCKRWLFVDGQNRHRLSLDARDEISSFLPSMF  104

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD+VTKLAL+CDR+S+S+
Sbjct  105  DRFDSVTKLALRCDRKSLSL  124



>ref|XP_002310119.2| SKP1 INTERACTING PARTNER 2 family protein [Populus trichocarpa]
 gb|EEE90569.2| SKP1 INTERACTING PARTNER 2 family protein [Populus trichocarpa]
Length=519

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T  IPD+CLACIFQ L++ DRKR SLVC+RWL+++GQSR RLSLNA +++     SIF
Sbjct  35   DFTEGIPDDCLACIFQLLNAADRKRSSLVCKRWLRVDGQSRRRLSLNAQSEITSYVPSIF  94

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+V KL+L+CDR+S+S+
Sbjct  95   TRFDSVAKLSLRCDRKSLSL  114



>ref|XP_008796478.1| PREDICTED: F-box protein At1g47056-like [Phoenix dactylifera]
Length=493

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A D+T ++PDECLA IF  L SGDRKRCSLVCRRWL +EGQSRHRL+L+A A L D A +
Sbjct  13   ARDHTLDLPDECLALIFHSLGSGDRKRCSLVCRRWLAVEGQSRHRLALDARAALLDPAPA  72

Query  479  IFSRFDAVTKLALKCDRRSVSIG  547
            +F+RFDAVTKLALKCDRRS SIG
Sbjct  73   LFARFDAVTKLALKCDRRSESIG  95



>ref|XP_009418519.1| PREDICTED: F-box protein At1g47056-like [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A D+TS++PDECLA +FQ L +GDRKRCSLVCRRWL +EGQSRHRL+L+A A L + A +
Sbjct  58   ARDHTSDLPDECLALVFQFLGAGDRKRCSLVCRRWLAVEGQSRHRLALDARAALLEAAPA  117

Query  479  IFSRFDAVTKLALKCDRRSVSIG  547
            IF RFDAV+KLALKCDRR+ SIG
Sbjct  118  IFVRFDAVSKLALKCDRRADSIG  140



>ref|XP_007047382.1| SKP1/ASK1-interacting protein 2, putative [Theobroma cacao]
 gb|EOX91539.1| SKP1/ASK1-interacting protein 2, putative [Theobroma cacao]
Length=545

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T+ IPDECLA +FQ L  GDR RCSLVC+RWL+++G+SRHRLSLN  +++     S+F
Sbjct  42   DFTAEIPDECLAYVFQFLGPGDRNRCSLVCKRWLRVDGESRHRLSLNVQSEIVASLPSLF  101

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+C R+S+S+
Sbjct  102  TRFDSVTKLALRCSRKSISL  121



>emb|CDY18646.1| BnaA09g07490D [Brassica napus]
Length=524

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT ++P ECLA +FQ L +GDRKRCSLVC+RWL ++GQ+RHRLSL+A  ++     S+F
Sbjct  45   DYTEDLPGECLAHVFQYLGAGDRKRCSLVCKRWLFVDGQNRHRLSLDARDEILSFLPSMF  104

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD+VTKLAL+CDR+S+S+
Sbjct  105  DRFDSVTKLALRCDRKSLSL  124



>ref|XP_009101674.1| PREDICTED: F-box/LRR-repeat protein 16 [Brassica rapa]
Length=511

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T+++PD+CLA IFQ L++GDRKRCSLV +RWL ++GQ+RHRLSL A A++     SIF
Sbjct  29   DFTADLPDDCLAHIFQFLTAGDRKRCSLVSKRWLLVDGQNRHRLSLAAKAEILPFLPSIF  88

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRFD+VTKLAL+CDR S S+
Sbjct  89   SRFDSVTKLALRCDRNSFSL  108



>emb|CDX81326.1| BnaC09g07370D [Brassica napus]
Length=524

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT ++P ECLA +FQ L +GDRKRCSLVC+RWL ++GQ+RHRLSL+A  ++     S+F
Sbjct  45   DYTEDLPGECLAHVFQYLGAGDRKRCSLVCKRWLFVDGQNRHRLSLDARDEIFSFLPSMF  104

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD+VTKLAL+CDR+S+S+
Sbjct  105  DRFDSVTKLALRCDRKSLSL  124



>ref|XP_009367488.1| PREDICTED: F-box protein SKIP2 [Pyrus x bretschneideri]
Length=534

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++PDE LA IF  L +GDRKR SLVCRRWL+++GQSR+RLS NA A L     ++F
Sbjct  52   DYTSDLPDELLASIFHFLGAGDRKRSSLVCRRWLRVDGQSRNRLSFNAQAGLLPFLPALF  111

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+S+S+
Sbjct  112  ARFDSVTKLALRCDRKSISL  131



>ref|XP_009394539.1| PREDICTED: F-box protein At1g47056 [Musa acuminata subsp. malaccensis]
Length=542

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA +FQ L SGDRKRCSLVCRRWL +EGQSRHRL+L+A A L + A +IF
Sbjct  59   DHTLDLPDECLALVFQSLGSGDRKRCSLVCRRWLVVEGQSRHRLALDARAALLEAAQAIF  118

Query  485  SRFDAVTKLALKCDRRSVSIG  547
            SRFDAV+KLALKCDRR+ SIG
Sbjct  119  SRFDAVSKLALKCDRRADSIG  139



>gb|KHG04121.1| F-box SKIP2 -like protein [Gossypium arboreum]
 gb|KHG14150.1| F-box SKIP2 -like protein [Gossypium arboreum]
 gb|KHG16724.1| F-box SKIP2 -like protein [Gossypium arboreum]
Length=544

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT+ +PDECLA +FQ L  GDR RCSLVC+RW +++G SRHRLSLNA +++     S+F
Sbjct  77   DYTAELPDECLAFVFQFLGPGDRNRCSLVCKRWFRVDGWSRHRLSLNAQSEIVSSLPSLF  136

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+C R+S+S+
Sbjct  137  TRFDSVTKLALRCSRKSISL  156



>emb|CDX83114.1| BnaA01g21140D [Brassica napus]
Length=497

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T+++PD+CLA IFQ L++GDRKRCSLV +RWL ++GQ+RHRLSL A A++     SIF
Sbjct  29   DFTADLPDDCLAHIFQFLTAGDRKRCSLVSKRWLLVDGQNRHRLSLAAKAEILPFLPSIF  88

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR S S+
Sbjct  89   TRFDSVTKLALRCDRNSFSL  108



>ref|XP_008362568.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein SKIP2-like [Malus 
domestica]
Length=688

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 83/135 (61%), Gaps = 10/135 (7%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRS------TAAISPMKESEssddvtdgsidddGAYDYTSN  319
            MGQS+S        S R  S S      T AI+     E S+   + +       DYTS+
Sbjct  1    MGQSSSLPEAPAEHSPREISTSRRFSFKTVAIASSSTDEDSELYGEVTQ----GRDYTSD  56

Query  320  IPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDA  499
            +PDECLA IF  L +GDRKR SLVC RWL+++GQSRHRLS NA A L     ++F+RFD+
Sbjct  57   LPDECLASIFHFLCAGDRKRSSLVCHRWLRVDGQSRHRLSJNAQAGLLPFLPALFARFDS  116

Query  500  VTKLALKCDRRSVSI  544
            VTKLAL+ DR+ +S+
Sbjct  117  VTKLALRXDRKXISL  131



>ref|XP_009385196.1| PREDICTED: F-box protein SKIP2-like [Musa acuminata subsp. malaccensis]
Length=531

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT+ +PDECLA +FQ L SGDRK CSLVCRRWL +E  SR  LSL+A A L+DVA +IF
Sbjct  24   DYTAGLPDECLALVFQSLGSGDRKSCSLVCRRWLAVESCSRRSLSLDARAALSDVAPAIF  83

Query  485  SRFDAVTKLALKCDRRSVSIG  547
             RFD V++LAL+C RR  SIG
Sbjct  84   GRFDGVSRLALQCGRRHDSIG  104



>ref|XP_008367984.1| PREDICTED: F-box protein SKIP2-like [Malus domestica]
Length=534

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++PDECLA IF  L +GDRKR SLVC RWL+++G+SRHRLSLNA A L     ++F
Sbjct  52   DYTSDLPDECLASIFHFLCAGDRKRSSLVCHRWLRVDGZSRHRLSLNAQAGLLPFLPALF  111

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+ DR+ +S+
Sbjct  112  ARFDSVTKLALRXDRKXISL  131



>ref|XP_006573648.1| PREDICTED: F-box protein SKIP2-like isoform X1 [Glycine max]
Length=572

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 17/129 (13%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS ST+A      +R      A + P  +S+              + DYT  + D+CL
Sbjct  51   MGQSPSTSAAPPPDLNR---LQIAQLHPNTDSD--------------STDYTLRLSDDCL  93

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A IF  L++ DRKRCSLVC RW  ++GQ RHRLSLNA  +L D   S+F+RFD+VTKLAL
Sbjct  94   AAIFHFLNTADRKRCSLVCLRWRLVDGQRRHRLSLNAQPELLDFVPSLFNRFDSVTKLAL  153

Query  518  KCDRRSVSI  544
            +CDR+  SI
Sbjct  154  RCDRKCASI  162



>emb|CDX68575.1| BnaC01g26530D [Brassica napus]
Length=511

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D T+++PD+CLA IFQ L++GDRKRCSLV +RWL ++GQ+RHRLSL A A++     SIF
Sbjct  29   DITADLPDDCLAHIFQFLTAGDRKRCSLVSKRWLLVDGQNRHRLSLAAKAEILPFLPSIF  88

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR S S+
Sbjct  89   TRFDSVTKLALRCDRNSFSL  108



>ref|XP_002524918.1| skip-2, putative [Ricinus communis]
 gb|EEF37415.1| skip-2, putative [Ricinus communis]
Length=529

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT NIPDECLA IFQ LS+ DRK CS VCRRW  ++G SRHRLSL A  ++      +F
Sbjct  37   DYTDNIPDECLAYIFQFLSASDRKHCSYVCRRWYLVDGCSRHRLSLKAQTEIITYIPLLF  96

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+VTKLAL+CDR+S+S+
Sbjct  97   TRFDSVTKLALRCDRKSISL  116



>gb|KJB71120.1| hypothetical protein B456_011G106600 [Gossypium raimondii]
Length=545

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYT+ IPDECLA +FQ L  GDR RCSLVC+RWL ++G SRHRLSL+A +++     SIF
Sbjct  42   DYTAEIPDECLAYVFQFLGPGDRNRCSLVCKRWLCVDGWSRHRLSLDAQSEIEVSLPSIF  101

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RFD+VTKL L+C RRS+S+
Sbjct  102  MRFDSVTKLTLRCSRRSISL  121



>ref|XP_009396269.1| PREDICTED: F-box protein At1g47056-like [Musa acuminata subsp. 
malaccensis]
Length=540

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A + T ++PDECLA +FQ L SGDRKRCSLVCRRWL +EGQSRHRL+L+A A L + A +
Sbjct  53   ARNNTEDLPDECLALVFQSLGSGDRKRCSLVCRRWLAVEGQSRHRLALDARAALLEAAPA  112

Query  479  IFSRFDAVTKLALKCDRRSVSIG  547
            IF+RFDAV+KLALKCDRR+ S+G
Sbjct  113  IFARFDAVSKLALKCDRRADSLG  135



>gb|KEH31485.1| F-box protein SKIP2 [Medicago truncatula]
Length=536

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
              +Y+  IPDECLA I   L +GDRK CS+VC+RW ++EG+SR RLSLNA A L D+  S
Sbjct  39   GVNYSEEIPDECLAGILHFLDAGDRKSCSVVCKRWFRVEGESRQRLSLNAEAKLVDIVPS  98

Query  479  IFSRFDAVTKLALKCDRRSVSI  544
            +F+R+D+VTKLAL+C+++S SI
Sbjct  99   LFNRYDSVTKLALRCNKKSTSI  120



>ref|XP_010558884.1| PREDICTED: F-box protein SKIP2-like [Tarenaya hassleriana]
Length=527

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  308  YTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFS  487
            +T ++PDECLA +F  L  GDRKRCSLVC+RWL ++GQSR RLSL A A++     ++FS
Sbjct  42   FTGDLPDECLAHVFHFLGPGDRKRCSLVCKRWLCVDGQSRQRLSLEAKAEILPFLPAMFS  101

Query  488  RFDAVTKLALKCDRRSVSI  544
            RFD+VTKL L+CDR+SVS+
Sbjct  102  RFDSVTKLVLRCDRKSVSL  120



>ref|XP_004151915.1| PREDICTED: F-box protein SKIP2-like [Cucumis sativus]
 gb|KGN63314.1| hypothetical protein Csa_2G427880 [Cucumis sativus]
Length=528

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
             D+T ++PDECLA IF+ L+SGDRK CSLVC+RW Q+EGQSRHRLSLNA  ++     S+
Sbjct  49   VDFTFSLPDECLASIFRFLNSGDRKSCSLVCKRWFQVEGQSRHRLSLNAQDEILPFLPSL  108

Query  482  FSRFDAVTKLALKCDRR  532
            F+RFD+V KL+L+C+R+
Sbjct  109  FTRFDSVKKLSLRCNRK  125



>ref|XP_004156789.1| PREDICTED: F-box protein SKIP2-like [Cucumis sativus]
Length=528

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
             D+T ++PDECLA IF+ L+SGDRK CSLVC+RW Q+EGQSRHRLSLNA  ++     S+
Sbjct  49   VDFTFSLPDECLASIFRFLNSGDRKSCSLVCKRWFQVEGQSRHRLSLNAQDEILPFLPSL  108

Query  482  FSRFDAVTKLALKCDRR  532
            F+RFD+V KL+L+C+R+
Sbjct  109  FTRFDSVKKLSLRCNRK  125



>ref|XP_010030813.1| PREDICTED: F-box protein At1g47056-like [Eucalyptus grandis]
Length=143

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  329  ECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTK  508
            ECL C+FQ L SGD  RCSLVCRRWL IEGQS  RL+L+A  +L D   ++F+ FD+VTK
Sbjct  44   ECLVCVFQYLGSGDWGRCSLVCRRWLAIEGQSYQRLTLHAHLELLDTVPTLFAWFDSVTK  103

Query  509  LALKCDRRSVSIG  547
            L LKCDR+S+SIG
Sbjct  104  LTLKCDRKSLSIG  116



>ref|XP_008462840.1| PREDICTED: F-box protein SKIP2 [Cucumis melo]
Length=534

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
             D+T ++PDECLA IF+ L+SGDRK CSLVC+RW Q+EGQSRHRLSLNA  ++     S+
Sbjct  49   VDFTFSLPDECLASIFRFLNSGDRKICSLVCKRWFQVEGQSRHRLSLNAQDEILPFLPSL  108

Query  482  FSRFDAVTKLALKCDRR  532
            F+RFD+V KL+L+C+R+
Sbjct  109  FTRFDSVKKLSLRCNRK  125



>ref|XP_009417194.1| PREDICTED: F-box protein At1g47056-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PD+CL  +F  L +GDR RCSLVCRRWL +E +SR RLSL+A A L + A  + 
Sbjct  13   DHTLDLPDDCLIVVFNFLGTGDRNRCSLVCRRWLVVEARSRRRLSLDARAPLLEAAPGLL  72

Query  485  SRFDAVTKLALKCDRRSVSIG  547
            +RFDAV+ LAL+CDRRS SIG
Sbjct  73   ARFDAVSSLALRCDRRSESIG  93



>ref|XP_010932212.1| PREDICTED: F-box protein At1g47056-like [Elaeis guineensis]
Length=523

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDECLA IF  L SGDRKRCSLVCRRWL +EGQSRHRL+L+A A L   A ++F
Sbjct  45   DHTLDLPDECLALIFHSLGSGDRKRCSLVCRRWLAVEGQSRHRLALDARAALLAAAPALF  104

Query  485  SRFDAVTKLALKCDRRSVSIG  547
            +RFDAVTKLALKCDRRS SIG
Sbjct  105  ARFDAVTKLALKCDRRSESIG  125



>ref|XP_010045605.1| PREDICTED: F-box protein At1g47056-like [Eucalyptus grandis]
Length=132

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +2

Query  311  TSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSR  490
             S++P+ECLAC+FQ L S D+ RCSLVC  WL IEGQS  RL+L+A ++L D   ++F++
Sbjct  46   ISDLPNECLACVFQYLGSSDQGRCSLVCCHWLAIEGQSCQRLALHAHSELLDAVPALFAQ  105

Query  491  FDAVTKLALKCDRRSVSI  544
            F++V K+ LKCDR+S SI
Sbjct  106  FNSVMKVVLKCDRKSWSI  123



>ref|XP_011008777.1| PREDICTED: F-box protein SKIP2-like [Populus euphratica]
Length=524

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T +IPD+CLA IFQ L +GDRKR SLVC+RWL+++ QSR RLSL A +++     SIF
Sbjct  39   DHTEDIPDDCLAYIFQLLKAGDRKRSSLVCKRWLRVDAQSRRRLSLIAQSEIISYVPSIF  98

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RF +V KL+L+C R+SVS+
Sbjct  99   TRFHSVAKLSLRCGRKSVSL  118



>ref|XP_002307282.2| SKP1 INTERACTING PARTNER 2 family protein [Populus trichocarpa]
 gb|EEE94278.2| SKP1 INTERACTING PARTNER 2 family protein [Populus trichocarpa]
Length=524

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T +IPD+CLA IFQ L +GDRK  SLVC+RWL+++ QSR RLSL A +++     +IF
Sbjct  39   DHTEDIPDDCLAYIFQLLKAGDRKSSSLVCKRWLRVDAQSRRRLSLIAQSEIISYVPTIF  98

Query  485  SRFDAVTKLALKCDRRSVSI  544
            +RFD+V KL+L+C R+SVS+
Sbjct  99   TRFDSVAKLSLRCGRKSVSL  118



>ref|XP_001780007.1| predicted protein [Physcomitrella patens]
 gb|EDQ55216.1| predicted protein, partial [Physcomitrella patens]
Length=415

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T   PDEC+A +F+ L + DR RC+LVC+RW ++EGQ R RLSL+A+A+L      + 
Sbjct  1    DWTLYAPDECVASVFRKLPTADRNRCALVCKRWHRVEGQGRQRLSLHAVAELGLALPGLL  60

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RF  +TKLALKCDRR+VSI
Sbjct  61   DRFPHITKLALKCDRRTVSI  80



>ref|XP_009418092.1| PREDICTED: F-box protein SKIP2-like [Musa acuminata subsp. malaccensis]
Length=521

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT+++PD+CLA +FQ L  GDRKRCSLVCRRWL +EG+SR RL+L+A A L DVA +
Sbjct  23   ATDYTADLPDDCLALVFQSLGPGDRKRCSLVCRRWLAVEGRSRLRLALDARAALLDVAPA  82

Query  479  IFSRFDAVTKLALKCDRRSVSIG  547
            IF+RFDAV++L L+C  R+ SIG
Sbjct  83   IFARFDAVSRLTLRCSSRTDSIG  105



>ref|XP_008663374.1| PREDICTED: F-box protein At1g47056-like [Zea mays]
 gb|ACN28759.1| unknown [Zea mays]
 gb|ACR35643.1| unknown [Zea mays]
 gb|AFW58795.1| hypothetical protein ZEAMMB73_514600 [Zea mays]
Length=546

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL+C RW++++  +RHRLSL+A A L + AT+
Sbjct  57   ARDYTQDLPDEILALVFASLSPTDRNACSLICSRWMEVDATTRHRLSLDARAALGNAATA  116

Query  479  IFSRFDAVTKLALKCDRRS  535
            +FSRF AVTKLAL+C R S
Sbjct  117  LFSRFTAVTKLALRCARDS  135



>ref|XP_002462047.1| hypothetical protein SORBIDRAFT_02g013790 [Sorghum bicolor]
 gb|EER98568.1| hypothetical protein SORBIDRAFT_02g013790 [Sorghum bicolor]
Length=525

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALAD-LADVATS-  478
            D+T+++P+E LA +F  L SGDRKRCSLVCRRWL +E  SR RL+L+A A  LAD A   
Sbjct  39   DHTADLPEELLALVFGLLGSGDRKRCSLVCRRWLAVEAASRLRLALDARAPLLADSALPR  98

Query  479  IFSRFDAVTKLALKCDRRSVSIG  547
            + +RF AV+KLALKCDRR+ S+G
Sbjct  99   LLARFPAVSKLALKCDRRAESVG  121



>gb|AFW58798.1| hypothetical protein ZEAMMB73_653264 [Zea mays]
Length=435

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + AT+
Sbjct  57   ARDYTQDLPDEILALVFASLSPTDRNACSLTCSRWMEVDATTRHRLSLDARAALGNAATA  116

Query  479  IFSRFDAVTKLALKCDRRS  535
            +FSRF AVTKLAL+C R S
Sbjct  117  LFSRFTAVTKLALRCARDS  135



>dbj|BAD16491.1| putative Avr9/Cf-9 rapidly elicited protein [Oryza sativa Japonica 
Group]
 dbj|BAD17560.1| putative Avr9/Cf-9 rapidly elicited protein [Oryza sativa Japonica 
Group]
Length=530

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A D+T+++PD+ LA +F  L S DRKRCSLVCRRWL ++  SR RL+L+A A L      
Sbjct  46   AEDHTADLPDDLLAVVFGLLGSADRKRCSLVCRRWLSVDAASRLRLALDARAPLHAALPG  105

Query  479  IFSRFDAVTKLALKCDRRSVSI  544
            I +RF AV+KLALKCDRR+ S+
Sbjct  106  ILARFPAVSKLALKCDRRAESV  127



>ref|NP_001150414.1| LOC100284044 [Zea mays]
 gb|ACG39013.1| cyclin-like F-box [Zea mays]
Length=546

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + AT+
Sbjct  57   ARDYTQDLPDEILALVFASLSPTDRNACSLTCSRWMEVDATTRHRLSLDARAALGNAATA  116

Query  479  IFSRFDAVTKLALKCDRRS  535
            +FSRF AVTKLAL+C R S
Sbjct  117  LFSRFTAVTKLALRCARDS  135



>gb|ACN36605.1| unknown [Zea mays]
Length=546

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + AT+
Sbjct  57   ARDYTQDLPDEILALVFASLSPTDRNACSLTCSRWMEVDATTRHRLSLDARAALGNAATA  116

Query  479  IFSRFDAVTKLALKCDRRS  535
            +FSRF AVTKLAL+C R S
Sbjct  117  LFSRFTAVTKLALRCARDS  135



>gb|ACR36800.1| unknown [Zea mays]
 gb|AFW58797.1| cyclin-like F-box [Zea mays]
Length=546

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + AT+
Sbjct  57   ARDYTQDLPDEILALVFASLSPTDRNACSLTCSRWMEVDATTRHRLSLDARAALGNAATA  116

Query  479  IFSRFDAVTKLALKCDRRS  535
            +FSRF AVTKLAL+C R S
Sbjct  117  LFSRFTAVTKLALRCARDS  135



>ref|XP_002876014.1| vier F-box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52273.1| vier F-box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 11/83 (13%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G YD+T+N+PD+CLA +FQ LS+GDRKRCSL           +RHRLSL+A A++     
Sbjct  36   GGYDFTANLPDDCLAHVFQFLSAGDRKRCSL-----------NRHRLSLDAKAEILPFLP  84

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
             IF+RFD+VTKLAL+CDRRS S+
Sbjct  85   CIFNRFDSVTKLALRCDRRSFSL  107



>ref|XP_001764483.1| predicted protein [Physcomitrella patens]
 gb|EDQ70750.1| predicted protein [Physcomitrella patens]
Length=473

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T   PDEC+A +F+ L + DR RC+LVC+RW ++EGQ R RL+L+A A+L      + 
Sbjct  45   DWTEYAPDECVASVFRKLCTADRNRCALVCKRWYRVEGQGRQRLTLHASAELGCALPGLL  104

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RF  +TKL LKCDRR+VSI
Sbjct  105  ERFPHITKLVLKCDRRTVSI  124



>ref|XP_008652389.1| PREDICTED: F-box protein At1g47056-like [Zea mays]
 tpg|DAA60606.1| TPA: hypothetical protein ZEAMMB73_138032 [Zea mays]
Length=560

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALA-DLADVATS-  478
            D+T+++P+E LA +F  L SGDRKRCSLVCRRWL +E  SR RL+++A A  LA+ A   
Sbjct  74   DHTADLPEELLALVFGLLGSGDRKRCSLVCRRWLVVEAASRFRLAIDARASPLAESALPR  133

Query  479  IFSRFDAVTKLALKCDRRSVSIG  547
            + +RF AV+KLALKCDRR+ S+G
Sbjct  134  LLARFPAVSKLALKCDRRAESVG  156



>ref|XP_007156764.1| hypothetical protein PHAVU_002G015600g [Phaseolus vulgaris]
 gb|ESW28758.1| hypothetical protein PHAVU_002G015600g [Phaseolus vulgaris]
Length=564

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 72/129 (56%), Gaps = 15/129 (12%)
 Frame = +2

Query  158  MGQSASTAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPDECL  337
            MGQS STAA      +R +     + S   + E                D T  + D+CL
Sbjct  46   MGQSPSTAAAPTPDLNRHQISQLHSSSDPPDFEP---------------DLTIRLFDDCL  90

Query  338  ACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLAL  517
            A IF  LS+ DRK CS VCRRW +++G+ RHRLSL A  +L ++  S+F RFDAVTKL L
Sbjct  91   AVIFHFLSNADRKECSHVCRRWRRVDGERRHRLSLVARPELQELVPSLFDRFDAVTKLTL  150

Query  518  KCDRRSVSI  544
            + DR+  S+
Sbjct  151  RIDRKYASL  159



>ref|XP_003576858.1| PREDICTED: F-box protein At1g47056 [Brachypodium distachyon]
Length=533

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            DYTS++P+E LA +F  L SGDRKRCSLVCRRWL  E  SR RL+L+A A L   A  I 
Sbjct  51   DYTSDLPEELLAVVFGFLGSGDRKRCSLVCRRWLAAEAASRLRLALDARAPLLAAAPGIL  110

Query  485  SRFDAVTKLALKCDRRSVSIG  547
            +RF AV+KLALKCDRR+ S+G
Sbjct  111  ARFSAVSKLALKCDRRAESVG  131



>ref|XP_008667802.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=541

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + A +
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATTRHRLSLDARAALGNAAPA  115

Query  479  IFSRFDAVTKLALKCDRRS  535
            +F+RF AVTKLAL+  R S
Sbjct  116  LFARFTAVTKLALRWARGS  134



>ref|XP_008667801.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=542

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + A +
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATTRHRLSLDARAALGNAAPA  115

Query  479  IFSRFDAVTKLALKCDRRS  535
            +F+RF AVTKLAL+  R S
Sbjct  116  LFARFTAVTKLALRWARGS  134



>ref|NP_001146025.1| hypothetical protein [Zea mays]
 gb|ACL53053.1| unknown [Zea mays]
 tpg|DAA37047.1| TPA: hypothetical protein ZEAMMB73_673862 [Zea mays]
Length=545

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + A +
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATTRHRLSLDARAALGNAAPA  115

Query  479  IFSRFDAVTKLALKCDRRS  535
            +F+RF AVTKLAL+  R S
Sbjct  116  LFARFTAVTKLALRWARGS  134



>ref|XP_008667804.1| PREDICTED: hypothetical protein isoform X5 [Zea mays]
Length=537

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + A +
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATTRHRLSLDARAALGNAAPA  115

Query  479  IFSRFDAVTKLALKCDRRS  535
            +F+RF AVTKLAL+  R S
Sbjct  116  LFARFTAVTKLALRWARGS  134



>ref|XP_008667803.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
Length=539

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + A +
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATTRHRLSLDARAALGNAAPA  115

Query  479  IFSRFDAVTKLALKCDRRS  535
            +F+RF AVTKLAL+  R S
Sbjct  116  LFARFTAVTKLALRWARGS  134



>ref|XP_008667800.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=612

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL+A A L + A +
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATTRHRLSLDARAALGNAAPA  115

Query  479  IFSRFDAVTKLALKCDRRS  535
            +F+RF AVTKLAL+  R S
Sbjct  116  LFARFTAVTKLALRWARGS  134



>ref|XP_004956293.1| PREDICTED: F-box protein At1g47056-like [Setaria italica]
Length=529

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALAD-LADVATS-  478
            D T+++P++ LA IF  L S +RKRCSLVCRRWL  E  SR RL+L+A A  LAD A   
Sbjct  43   DRTADLPEDLLALIFGLLGSRERKRCSLVCRRWLAAEAASRLRLALDARAPLLADSALPR  102

Query  479  IFSRFDAVTKLALKCDRRSVSIG  547
            + +RF AV+KLALKCDRR+ S+G
Sbjct  103  LLARFPAVSKLALKCDRRAESVG  125



>ref|XP_010240100.1| PREDICTED: F-box protein At1g47056-like [Brachypodium distachyon]
Length=540

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 67/129 (52%), Gaps = 3/129 (2%)
 Frame = +2

Query  158  MGQSAS---TAAGAQNQSHRGKSRSTAAISPMKESEssddvtdgsidddGAYDYTSNIPD  328
            MGQS S   + +       R  S S A   P     +        +    A D+T ++PD
Sbjct  1    MGQSPSFPLSKSSPPPLCRRSLSSSMAPPMPALPVPAGSGSIAPFVAPPPARDHTQDLPD  60

Query  329  ECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTK  508
            E L  +F  L+  +R  CSL C RW +++  +RHRLSL A A L D A  +F+RF AVTK
Sbjct  61   EILTLVFASLTPAERNACSLACARWKEVDAATRHRLSLEARALLGDAAPHLFARFTAVTK  120

Query  509  LALKCDRRS  535
            LAL+C R S
Sbjct  121  LALRCARGS  129



>ref|XP_003527722.1| PREDICTED: F-box protein SKIP2-like [Glycine max]
Length=404

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +2

Query  317  NIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFD  496
            +IPD CLACIFQ     D+K+ SLVCRRWL++EG + HRL L      + V  SIFSRFD
Sbjct  11   DIPDNCLACIFQLFPPADQKKLSLVCRRWLKVEGHTHHRLCLT--LPYSSVLASIFSRFD  68

Query  497  AVTKLALKC  523
            +VT L L+C
Sbjct  69   SVTDLTLQC  77



>gb|EMT22616.1| hypothetical protein F775_19643 [Aegilops tauschii]
Length=480

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  YTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFS  487
            YTS++P+E LA +F  L SGDRKRCSLVCRRWL  E  SR RL+L+A A L   A +I +
Sbjct  21   YTSDLPEELLAVVFGLLGSGDRKRCSLVCRRWLATEASSRLRLALDARAPLLAAAPAILA  80

Query  488  RFDAVTKLALKCDRRSVSIG  547
            RF AV+KLALKCDRR+ S+G
Sbjct  81   RFSAVSKLALKCDRRAESVG  100



>dbj|BAJ91417.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  YTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFS  487
            YTS++P+E LA +F  L SGDRKRCSLVCRRWL  E  SR RL+L+A A L   A +I +
Sbjct  49   YTSDLPEELLAVVFGLLGSGDRKRCSLVCRRWLATEASSRLRLALDARAPLLAAAPAILA  108

Query  488  RFDAVTKLALKCDRRSVSIG  547
            RF AV+KLALKCDRR+ S+G
Sbjct  109  RFSAVSKLALKCDRRAESVG  128



>dbj|BAJ98310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  YTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFS  487
            YTS++P+E LA +F  L SGDRKRCSLVCRRWL  E  SR RL+L+A A L   A +I +
Sbjct  49   YTSDLPEELLAVVFGLLGSGDRKRCSLVCRRWLATEASSRLRLALDARAPLLAAAPAILA  108

Query  488  RFDAVTKLALKCDRRSVSIG  547
            RF AV+KLALKCDRR+ S+G
Sbjct  109  RFSAVSKLALKCDRRAESVG  128



>ref|XP_010036053.1| PREDICTED: F-box protein SKIP2-like [Eucalyptus grandis]
Length=555

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  302  YDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSI  481
            +D T  +PDECLA +F  L S DR  CSLVCRRW  ++ +SR RL+L A +++A     +
Sbjct  37   FDLTLGLPDECLASVFALLGSDDRGSCSLVCRRWHLVDARSRQRLALVARSEIAPSLPPL  96

Query  482  FSRFDAVTKLALKCDRRSVSIG  547
              RF +V+ L+LKC R+ VSIG
Sbjct  97   LRRFGSVSVLSLKCSRKLVSIG  118



>emb|CAD41177.1| OSJNBb0002J11.1 [Oryza sativa Japonica Group]
 emb|CAE05563.1| OSJNBb0116K07.16 [Oryza sativa Japonica Group]
Length=522

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDE L+ +F  L+  DR  CSL C RW +++  +RHRLSL+A A L   A  IF
Sbjct  35   DHTQDLPDEILSLVFASLTPTDRNACSLTCARWKEVDASTRHRLSLDARAALGYAAQGIF  94

Query  485  SRFDAVTKLALKCDRRS  535
            +RF AV+KLAL+C R S
Sbjct  95   ARFTAVSKLALRCARGS  111



>emb|CAH67265.1| OSIGBa0145C12.2 [Oryza sativa Indica Group]
Length=522

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDE L+ +F  L+  DR  CSL C RW +++  +RHRLSL+A A L   A  IF
Sbjct  35   DHTQDLPDEILSLVFASLTPTDRNACSLTCARWKEVDASTRHRLSLDARAALGYAAQGIF  94

Query  485  SRFDAVTKLALKCDRRS  535
            +RF AV+KLAL+C R S
Sbjct  95   ARFTAVSKLALRCARGS  111



>gb|EAY94777.1| hypothetical protein OsI_16557 [Oryza sativa Indica Group]
Length=497

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDE L+ +F  L+  DR  CSL C RW +++  +RHRLSL+A A L   A  IF
Sbjct  10   DHTQDLPDEILSLVFASLTPTDRNACSLTCARWKEVDASTRHRLSLDARAALGYAAQGIF  69

Query  485  SRFDAVTKLALKCDRRS  535
            +RF AV+KLAL+C R S
Sbjct  70   ARFTAVSKLALRCARGS  86



>gb|ABK24412.1| unknown [Picea sitchensis]
Length=498

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D    +PDECLA IFQ L++ DR  CSLVC RW +IE +SR RL L A  +L+ +  ++F
Sbjct  32   DLIVYLPDECLASIFQKLTNEDRNACSLVCSRWHRIESKSRQRLVLMARTELSSLLPALF  91

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RF+ VT L+LKC R+  SI
Sbjct  92   MRFEHVTVLSLKCSRKFPSI  111



>ref|XP_004976156.1| PREDICTED: F-box protein SKIP2-like [Setaria italica]
Length=544

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DYT ++PDE LA +F  L   +R  CSL C RW +++  +RHRLSL+A A L   A +
Sbjct  55   ARDYTQDLPDEILALVFASLLPAERSACSLACARWKEVDAATRHRLSLDARAGLGHAAPA  114

Query  479  IFSRFDAVTKLALKCDRRS  535
            +F RF AVTKLAL+  R S
Sbjct  115  LFGRFTAVTKLALRSARGS  133



>ref|XP_002969264.1| hypothetical protein SELMODRAFT_22039, partial [Selaginella moellendorffii]
 ref|XP_002986847.1| hypothetical protein SELMODRAFT_22038, partial [Selaginella moellendorffii]
 gb|EFJ12177.1| hypothetical protein SELMODRAFT_22038, partial [Selaginella moellendorffii]
 gb|EFJ29352.1| hypothetical protein SELMODRAFT_22039, partial [Selaginella moellendorffii]
Length=402

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D T  +PDECL  I   LS GDR + SLVCRRW ++EG+SR +LSL A AD+      I 
Sbjct  4    DLTLLVPDECLEWILHKLSPGDRTQSSLVCRRWHRLEGRSRTQLSLAAHADVMPFLPRIC  63

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRF  +TK+ LKCDRR  SI
Sbjct  64   SRFVQLTKITLKCDRRDPSI  83



>dbj|BAJ86565.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=523

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PDE L  +F  L+  +R  CSL C RW +++  +RHRLSL+A A L     +IF
Sbjct  33   DHTQDLPDEILTLVFASLTPAERNACSLTCARWKEVDAATRHRLSLDARAMLGYNTPAIF  92

Query  485  SRFDAVTKLALKCDRRS  535
            SRF AVTKLAL+C R S
Sbjct  93   SRFTAVTKLALRCARGS  109



>ref|XP_009413336.1| PREDICTED: F-box protein At1g47056-like [Musa acuminata subsp. 
malaccensis]
Length=463

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D+T ++PD+CLA +   L   DR RC+LVCRRWL +E +SR RL L+A A L + A ++ 
Sbjct  9    DHTLDLPDDCLALVVGSLGPRDRNRCALVCRRWLAVEARSRCRLVLDARAPLLEAAPALL  68

Query  485  SRFDAVTKLALKCDRRSVSIG  547
            +RFDAV+ L+L+CDR S SIG
Sbjct  69   ARFDAVSSLSLRCDRFSDSIG  89



>ref|XP_007014604.1| VIER F-box protein 1 [Theobroma cacao]
 gb|EOY32223.1| VIER F-box protein 1 [Theobroma cacao]
Length=586

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D T  +PDECLA +F  L   DR  CSLVC+RW  ++ +SR RL+L A +D++    S+F
Sbjct  77   DLTLTLPDECLAWVFGKLGCHDRSNCSLVCKRWRHVDSKSRQRLALVAGSDISPWLPSLF  136

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRF +++ L+LKC R+  SI
Sbjct  137  SRFSSISVLSLKCSRKLASI  156



>ref|XP_002514498.1| skip-2, putative [Ricinus communis]
 gb|EEF47898.1| skip-2, putative [Ricinus communis]
Length=511

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D T ++PDECLA IF  LS  DR  CSLVC+RW  I+  SRHRL L +  +++     + 
Sbjct  48   DLTLSLPDECLATIFCKLSCHDRNSCSLVCKRWKLIDSNSRHRLVLLSPFEMSSSLPCLL  107

Query  485  SRFDAVTKLALKCDRRSVSI  544
            SRF ++T L+LKC R+ +SI
Sbjct  108  SRFSSLTILSLKCSRKLLSI  127



>ref|XP_011019921.1| PREDICTED: F-box protein SKIP2-like isoform X1 [Populus euphratica]
Length=573

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G  D T ++PDECL  +F  L   DR  CSLVC+RW  ++ +SR+RL L A ++L+    
Sbjct  31   GDDDLTLSLPDECLGSVFGKLGCLDRNSCSLVCKRWKCVDSKSRNRLVLLARSELSPCLP  90

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
            S+ SRF+ V+ L+LKC R+  SI
Sbjct  91   SLLSRFNTVSVLSLKCSRKLFSI  113



>ref|XP_011019922.1| PREDICTED: F-box protein SKIP2-like isoform X2 [Populus euphratica]
Length=559

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G  D T ++PDECL  +F  L   DR  CSLVC+RW  ++ +SR+RL L A ++L+    
Sbjct  17   GDDDLTLSLPDECLGSVFGKLGCLDRNSCSLVCKRWKCVDSKSRNRLVLLARSELSPCLP  76

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
            S+ SRF+ V+ L+LKC R+  SI
Sbjct  77   SLLSRFNTVSVLSLKCSRKLFSI  99



>ref|XP_002309038.2| hypothetical protein POPTR_0006s08160g [Populus trichocarpa]
 gb|EEE92561.2| hypothetical protein POPTR_0006s08160g [Populus trichocarpa]
Length=572

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVAT  475
            G  D T ++PDECL  +F  L   DR  CSLVC+RW  ++ +SR+RL L A ++L+    
Sbjct  31   GDDDLTLSLPDECLGSVFGKLGCLDRNSCSLVCKRWKCVDSKSRNRLVLLARSELSPCLP  90

Query  476  SIFSRFDAVTKLALKCDRRSVSI  544
            S+ SRF+ V+ L+LKC R+  SI
Sbjct  91   SLLSRFNTVSVLSLKCSRKLFSI  113



>gb|KHN04478.1| F-box protein SKIP2 [Glycine soja]
Length=677

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  320  IPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDA  499
            IPDECL CIFQ  S G+RK  SLVC RWL+IEGQ+  RL+L A   L+   T  FSRF +
Sbjct  10   IPDECLGCIFQLFSPGERKMFSLVCSRWLKIEGQTYQRLALTADGLLSIPCT--FSRFSS  67

Query  500  VTKLALKCDRRSVSIG  547
            +T+L L  +  S SIG
Sbjct  68   LTELTL-INSLSKSIG  82


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +2

Query  317  NIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFD  496
            +IPD CLA IFQ     D K  SLVCRR L+++GQ+ HRL L      +    SIF+RFD
Sbjct  336  DIPDNCLASIFQLFPPVDHKNFSLVCRRCLKVQGQTHHRLCLT--LPYSKFLASIFTRFD  393

Query  497  AVTKLALKC  523
            +VT+L L+C
Sbjct  394  SVTELTLQC  402



>emb|CAN81430.1| hypothetical protein VITISV_010695 [Vitis vinifera]
Length=544

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PDECLA +F  L   DR  CSLVCRRW  ++ +SR RL L A +D++    ++  RF +V
Sbjct  71   PDECLAGVFGKLGCHDRNTCSLVCRRWRAVDSKSRQRLVLLARSDVSPFLPALLCRFSSV  130

Query  503  TKLALKCDRRSVSI  544
            + L+LKC R+ VSI
Sbjct  131  SVLSLKCSRKIVSI  144



>ref|XP_010665121.1| PREDICTED: F-box protein SKIP2-like [Vitis vinifera]
Length=538

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  323  PDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAV  502
            PDECLA +F  L   DR  CSLVCRRW  ++ +SR RL L A +D++    ++  RF +V
Sbjct  45   PDECLAGVFGKLGCHDRNTCSLVCRRWRAVDSKSRQRLVLLARSDVSPFLPALLCRFSSV  104

Query  503  TKLALKCDRRSVSI  544
            + L+LKC R+ VSI
Sbjct  105  SVLSLKCSRKIVSI  118



>ref|XP_011019923.1| PREDICTED: F-box protein SKIP2-like isoform X3 [Populus euphratica]
Length=559

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +2

Query  308  YTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFS  487
             T ++PDECL  +F  L   DR  CSLVC+RW  ++ +SR+RL L A ++L+    S+ S
Sbjct  21   LTLSLPDECLGSVFGKLGCLDRNSCSLVCKRWKCVDSKSRNRLVLLARSELSPCLPSLLS  80

Query  488  RFDAVTKLALKCDRRSVSI  544
            RF+ V+ L+LKC R+  SI
Sbjct  81   RFNTVSVLSLKCSRKLFSI  99



>gb|KCW47577.1| hypothetical protein EUGRSUZ_K01326 [Eucalyptus grandis]
Length=574

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATS  478
            A DY S+    CLA +F  L S DR  CSLVCRRW  ++ +SR RL+L A +++A     
Sbjct  58   ANDYGSS---PCLASVFALLGSDDRGSCSLVCRRWHLVDARSRQRLALVARSEIAPSLPP  114

Query  479  IFSRFDAVTKLALKCDRRSVSIG  547
            +  RF +V+ L+LKC R+ VSIG
Sbjct  115  LLRRFGSVSVLSLKCSRKLVSIG  137



>gb|KCW59474.1| hypothetical protein EUGRSUZ_H02221 [Eucalyptus grandis]
Length=180

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  546  PILTDLRSHFKASLVTASNRENMEVatsarsasalserrwRLCPSICNHRRQTREHRFRS  367
            P LTD RSH  AS VTAS REN E +  +RSA A SE R RL PS   HRR T EHRFRS
Sbjct  102  PRLTDFRSHRSASFVTASKRENTEGSDKSRSACAFSESRCRLSPSTRRHRRHTTEHRFRS  161

Query  366  PELRH*NIHAKHSSG  322
            P  R  N  A+HSSG
Sbjct  162  PVPRKWNTWARHSSG  176



>ref|XP_002987863.1| hypothetical protein SELMODRAFT_43420, partial [Selaginella moellendorffii]
 gb|EFJ11166.1| hypothetical protein SELMODRAFT_43420, partial [Selaginella moellendorffii]
Length=399

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  DYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIF  484
            D T+ + D+CL  + + L   DR+ CSLVC+RW + E QSR  L L+A A+L+     + 
Sbjct  1    DLTTRLTDDCLELVLEKLPLKDRRSCSLVCQRWFRAEAQSRQLLLLSANANLSPNLPDLL  60

Query  485  SRFDAVTKLALKCDRRSVSI  544
             RF  +TKLAL+CDR S SI
Sbjct  61   HRFKHITKLALRCDRSSASI  80



>tpg|DAA37046.1| TPA: hypothetical protein ZEAMMB73_673862 [Zea mays]
Length=490

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADL  460
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLSL  L  L
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATTRHRLSLLKLRGL  109



>gb|ACF86198.1| unknown [Zea mays]
 tpg|DAA37045.1| TPA: hypothetical protein ZEAMMB73_673862 [Zea mays]
Length=490

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLS---LNALADLAD  466
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLS   L  L  L+D
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATTRHRLSRLKLRGLRQLSD  114



>tpg|DAA37044.1| TPA: hypothetical protein ZEAMMB73_673862 [Zea mays]
Length=486

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLS---LNALADLAD  466
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +RHRLS   L  L  L+D
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATTRHRLSRLKLRGLRQLSD  114



>ref|XP_002978355.1| hypothetical protein SELMODRAFT_53002, partial [Selaginella moellendorffii]
 gb|EFJ20341.1| hypothetical protein SELMODRAFT_53002, partial [Selaginella moellendorffii]
Length=407

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query  320  IPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADL-ADVATSIFSRFD  496
            +P+ECL  IF  L +  R   SLVCRRWL  E  SR  LSL+A   L      S   RF 
Sbjct  1    LPEECLGLIFDRLDTRGRNVASLVCRRWLVAEANSRKILSLSAPLSLPVSCLESSLMRFT  60

Query  497  AVTKLALKCDRRSVSI  544
             ++KL LKC+R   SI
Sbjct  61   VLSKLGLKCERGVPSI  76



>ref|XP_002970190.1| hypothetical protein SELMODRAFT_63069, partial [Selaginella moellendorffii]
 gb|EFJ28320.1| hypothetical protein SELMODRAFT_63069, partial [Selaginella moellendorffii]
Length=407

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query  320  IPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADL-ADVATSIFSRFD  496
            +P+ECL  +F  L +  R   SLVCRRWL  E  SR  LSL+A   L      S   RF 
Sbjct  1    LPEECLGLVFDRLDTRGRNVASLVCRRWLLAEANSRKILSLSAPLSLPVSCLESSLMRFP  60

Query  497  AVTKLALKCDRRSVSI  544
             ++KL LKC+R   SI
Sbjct  61   VLSKLGLKCERGVPSI  76



>ref|XP_010064602.1| PREDICTED: F-box protein SKIP2-like [Eucalyptus grandis]
Length=137

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 27/76 (36%)
 Frame = +2

Query  317  NIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFD  496
            N+PDECLAC+F                 WL          +L+   +L D  + +F RF+
Sbjct  72   NLPDECLACVF-----------------WL----------ALHTHLELLDAVSVLFMRFN  104

Query  497  AVTKLALKCDRRSVSI  544
            ++TKLALKCDR+S+SI
Sbjct  105  SITKLALKCDRKSLSI  120



>gb|EAY89731.1| hypothetical protein OsI_11270 [Oryza sativa Indica Group]
Length=110

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  CSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKC  523
            CSL   +W +++  +RHRLSL+  A L  +A  IF+RF A+TKL L+C
Sbjct  28   CSLTYAQWKEVDASTRHRLSLDTRAALGYIAQRIFARFMAITKLTLRC  75



>gb|EAZ26683.1| hypothetical protein OsJ_10587 [Oryza sativa Japonica Group]
Length=110

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  CSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKC  523
            CSL   +W +++  +RHRLSL+  A L  +A  IF+RF A+TKL L+C
Sbjct  28   CSLTYAQWKEVDASTRHRLSLDTRAALGYIAQRIFARFMAITKLTLRC  75



>ref|XP_002990432.1| hypothetical protein SELMODRAFT_43423, partial [Selaginella moellendorffii]
 gb|EFJ08525.1| hypothetical protein SELMODRAFT_43423, partial [Selaginella moellendorffii]
Length=393

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  IFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKC  523
            + + L   DR+ CSLVC+RW + E QSR  L L+A A+L+     +  RF  +TKLAL+C
Sbjct  1    VLEKLPLNDRRSCSLVCQRWFRAEAQSRQLLLLSANANLSPNLPDLLHRFKHITKLALRC  60

Query  524  DRRSVSI  544
            DR S SI
Sbjct  61   DRSSASI  67



>gb|ABF95568.1| hypothetical protein LOC_Os03g19660 [Oryza sativa Japonica Group]
Length=199

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  CSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALKC  523
            CSL   +W +++  +RHRLSL+  A L  +A  IF+RF A+TKL L+C
Sbjct  28   CSLTYAQWKEVDASTRHRLSLDTRAALGYIAQRIFARFMAITKLTLRC  75



>gb|ACF87078.1| unknown [Zea mays]
 tpg|DAA37043.1| TPA: hypothetical protein ZEAMMB73_673862 [Zea mays]
Length=492

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 5/61 (8%)
 Frame = +2

Query  299  AYDYTSNIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRH-----RLSLNALADLA  463
            A DYT ++PDE LA +F  LS  DR  CSL C RW++++  +       RL L  L  L+
Sbjct  56   ARDYTQDLPDEILALVFASLSPTDRNACSLACSRWMEVDATALPSGRLSRLKLRGLRQLS  115

Query  464  D  466
            D
Sbjct  116  D  116



>gb|EAZ16267.1| hypothetical protein OsJ_31726 [Oryza sativa Japonica Group]
Length=128

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  380  CSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALK  520
            CSL   +W +++  +RHRLSL+A A L   A  IF+RF A+TKL L+
Sbjct  28   CSLTYAQWKEVDASTRHRLSLDARAALGYTAQRIFARFMAITKLTLR  74



>gb|KCW61881.1| hypothetical protein EUGRSUZ_H04564 [Eucalyptus grandis]
Length=166

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 38/76 (50%), Gaps = 34/76 (45%)
 Frame = +2

Query  317  NIPDECLACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFD  496
            ++P+ECLAC+FQ L  G+R RCSL                                  FD
Sbjct  53   DLPNECLACVFQDLGFGNRGRCSL----------------------------------FD  78

Query  497  AVTKLALKCDRRSVSI  544
            +VTKLALKCDR+S+SI
Sbjct  79   SVTKLALKCDRKSLSI  94



>gb|EEE60833.1| hypothetical protein OsJ_14449 [Oryza sativa Japonica Group]
Length=171

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 38/72 (53%), Gaps = 6/72 (8%)
 Frame = +2

Query  323  PDEC-----LACIFQCLSSGDRKRCSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFS  487
            P EC     L  +F  L+  +    SL   +W + +   RHRLSLNA A L   A  IF+
Sbjct  12   PPECDNTQDLPRMFVLLTPTE-CNTSLTYTQWKEADASMRHRLSLNARAVLGYTAQRIFA  70

Query  488  RFDAVTKLALKC  523
            RF AVTKL L C
Sbjct  71   RFTAVTKLTLSC  82



>gb|AAS07103.1| tubulin beta subunit [Oryza sativa Japonica Group]
 gb|ABF98020.1| F-box family protein, putative [Oryza sativa Japonica Group]
 gb|EAY91269.1| hypothetical protein OsI_12885 [Oryza sativa Indica Group]
Length=164

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  380  CSLVCRRWLQIEGQSRHRLSLNALADLADVATSIFSRFDAVTKLALK  520
            CSL   +W +++  +RHRLSL+A A L   A  IF+RF A+TKL L+
Sbjct  28   CSLTYAQWKEVDASTRHRLSLDARAALGYTAQRIFARFMAITKLTLR  74



>ref|XP_006661027.1| PREDICTED: F-box protein At1g47056-like [Oryza brachyantha]
Length=463

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  296  GAYDYTSNIPDECLACIFQCLSSGDRKRCSLV  391
            GA DYTS++P+E LA +F  L SGDRKRCSL+
Sbjct  34   GAEDYTSDLPEELLALVFGLLGSGDRKRCSLL  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335