BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H22

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004953107.1|  PREDICTED: uncharacterized protein At4g06744...  56.2    2e-06   
ref|XP_009588943.1|  PREDICTED: uncharacterized protein At4g06744...  55.8    4e-06   Nicotiana tomentosiformis
gb|EYU44430.1|  hypothetical protein MIMGU_mgv1a005057mg              54.3    1e-05   Erythranthe guttata [common monkey flower]
emb|CDP02523.1|  unnamed protein product                              53.9    1e-05   Coffea canephora [robusta coffee]
ref|XP_008664358.1|  PREDICTED: uncharacterized protein At4g06744...  53.5    2e-05   
ref|NP_001141180.1|  uncharacterized protein LOC100273267 precursor   53.5    2e-05   Zea mays [maize]
gb|EAY86685.1|  hypothetical protein OsI_08067                        53.1    2e-05   Oryza sativa Indica Group [Indian rice]
emb|CDP02527.1|  unnamed protein product                              53.1    3e-05   Coffea canephora [robusta coffee]
ref|XP_008677766.1|  PREDICTED: uncharacterized protein LOC100856...  52.8    4e-05   
gb|ACF84038.1|  unknown                                               52.4    4e-05   Zea mays [maize]
gb|AFW62989.1|  leucine-rich repeat (LRR) family protein              52.4    4e-05   
gb|AEI72268.1|  leucine-rich repeat family protein                    52.4    4e-05   Citrus trifoliata [hardy orange]
gb|AFW62990.1|  leucine-rich repeat (LRR) family protein              52.4    5e-05   
ref|NP_001241706.1|  uncharacterized protein LOC100856884             52.4    5e-05   
ref|NP_001148637.1|  LOC100282253                                     52.4    5e-05   
gb|ACF79045.1|  unknown                                               52.4    5e-05   Zea mays [maize]
ref|XP_006422961.1|  hypothetical protein CICLE_v10028242mg           52.4    5e-05   Citrus clementina [clementine]
gb|KDO59787.1|  hypothetical protein CISIN_1g011101mg                 52.4    5e-05   Citrus sinensis [apfelsine]
ref|XP_008456145.1|  PREDICTED: uncharacterized protein At4g06744...  52.0    7e-05   Cucumis melo [Oriental melon]
ref|XP_006360245.1|  PREDICTED: uncharacterized protein At4g06744...  51.2    1e-04   
ref|XP_009793223.1|  PREDICTED: uncharacterized protein At4g06744...  51.2    1e-04   Nicotiana sylvestris
ref|XP_006653579.1|  PREDICTED: uncharacterized protein At4g06744...  50.8    1e-04   Oryza brachyantha
ref|XP_004960235.1|  PREDICTED: uncharacterized protein At4g06744...  50.4    2e-04   
gb|EAY86686.1|  hypothetical protein OsI_08068                        50.4    2e-04   Oryza sativa Indica Group [Indian rice]
gb|EMS59107.1|  hypothetical protein TRIUR3_04108                     50.1    3e-04   Triticum urartu
gb|EMT08852.1|  hypothetical protein F775_11606                       50.1    3e-04   
ref|XP_010932202.1|  PREDICTED: uncharacterized protein At4g06744...  49.7    4e-04   Elaeis guineensis
ref|NP_001053250.1|  Os04g0505200                                     49.3    4e-04   
emb|CAE02949.1|  OSJNBa0014K14.21                                     49.3    5e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61292.1|  hypothetical protein OsJ_15379                        49.3    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008798694.1|  PREDICTED: uncharacterized protein At4g06744...  49.3    5e-04   
dbj|BAJ91151.1|  predicted protein                                    48.9    7e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001150111.1|  protein binding protein precursor                48.5    0.001   



>ref|XP_004953107.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=404

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  454
            + ++   I+ FK +IT DP+N+T +W G++LC  +  Y GF+C  P GGDKK +      
Sbjct  57   LYRAYLVIQRFKSTITSDPKNVTATWTGHDLC-GETTYIGFYCGSPTGGDKK-LTVTGVI  114

Query  455  gynfngnglslnsFVESFNDLVVIHV  532
               ++ +  +L  FV+   DL + H 
Sbjct  115  LNGYSLHAPTLQGFVDQLPDLALFHA  140



>ref|XP_009588943.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=515

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 9/86 (10%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  454
            +RK IK I+ FKK+IT DP  +T++W GN++C   +KY GF CY      K  V  I FN
Sbjct  151  LRKVIKVIQNFKKTITSDPFGVTKTWVGNDIC---RKYVGFTCY------KNHVVAIDFN  201

Query  455  gynfngnglslnsFVESFNDLVVIHV  532
            G+ FNG+ LSL  F+E    LV+IH+
Sbjct  202  GFRFNGSQLSLRKFIEEIKTLVIIHL  227



>gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Erythranthe guttata]
Length=498

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +2

Query  263  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  442
            L P +  ++K I  F+++IT DP  +T++W+G  +C +K  Y+GF C       K RV  
Sbjct  123  LTPELLVAVKVIEKFRQTITKDPLGVTKTWKG-RICADKSAYRGFTCDTTISDGKVRVAL  181

Query  443  iyfngynfngnglslnsFVESFNDLVVIHV  532
            + FNG+NF+GN L+L +F++   DL+V HV
Sbjct  182  VNFNGFNFSGNPLALTNFIDGLTDLIVFHV  211



>emb|CDP02523.1| unnamed protein product [Coffea canephora]
Length=488

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  454
            ++ +I+ I+ FK+ I YDP  IT++W G  +C +  KY+GF C      +K RV G+ FN
Sbjct  114  LKMAIQVIQRFKRRIKYDPFGITKTWTGKRICFDNSKYKGFVCDRSTKDNKFRVVGVNFN  173

Query  455  gynfngn---glslnsFVESFNDLVVIHV  532
            GYNFNG     L    F+E   DLV+ HV
Sbjct  174  GYNFNGGPGCPLVATDFIEDLKDLVIFHV  202



>ref|XP_008664358.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Zea 
mays]
Length=287

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVP  412
            + ++  AI++FK +IT DP+NIT +W GN++C  +K Y GF+C  P
Sbjct  55   LYRAYHAIQSFKSTITSDPKNITGTWAGNDIC-GEKSYVGFYCATP  99



>ref|NP_001141180.1| uncharacterized protein LOC100273267 precursor [Zea mays]
 gb|ACF85643.1| unknown [Zea mays]
Length=437

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVP  412
            + ++  AI++FK +IT DP+NIT +W GN++C  +K Y GF+C  P
Sbjct  58   LYRAYHAIQSFKSTITSDPKNITGTWAGNDIC-GEKSYVGFYCATP  102



>gb|EAY86685.1| hypothetical protein OsI_08067 [Oryza sativa Indica Group]
Length=428

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 40/79 (51%), Gaps = 3/79 (4%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  475
            I+ FK +IT DP+NIT +W GNE+C  K  Y GFFC  P  G  K +         +  +
Sbjct  54   IQRFKSTITSDPKNITSTWSGNEIC-GKTAYLGFFCDTP--GQAKILTVTAVILNGYELH  110

Query  476  glslnsFVESFNDLVVIHV  532
              +L  F++   DL   H 
Sbjct  111  APTLKGFIDQLPDLAFFHA  129



>emb|CDP02527.1| unnamed protein product [Coffea canephora]
Length=436

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = +2

Query  263  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  442
            L   ++ +I+ I+ FK+ I  DP  +T++W GN +C +K KY+GF C      +K RV G
Sbjct  115  LSEELKMAIQVIQRFKRRIKSDPFCVTKTWTGNRICYDKSKYKGFVCDRSTKDNKFRVVG  174

Query  443  iyfngynfngn---glslnsFVESFNDLVVIHV  532
            + FNG+NF+G     L    FVE   DLV+ HV
Sbjct  175  VNFNGFNFDGGPGCPLVATDFVEDLKDLVIFHV  207



>ref|XP_008677766.1| PREDICTED: uncharacterized protein LOC100856884 isoform X1 [Zea 
mays]
Length=467

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK  430
            I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK
Sbjct  111  IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK  154



>gb|ACF84038.1| unknown [Zea mays]
 gb|AFW62991.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=435

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK  430
            I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK
Sbjct  79   IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK  122



>gb|AFW62989.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=391

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK  430
            I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK
Sbjct  79   IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK  122



>gb|AEI72268.1| leucine-rich repeat family protein [Citrus trifoliata]
Length=448

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  454
            I+ + K I+ FKK ITYDPQ I ++W G ++C    KY+GF C V     KK V G+ FN
Sbjct  81   IQLAFKVIQRFKKRITYDPQGIAKTWVGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  137

Query  455  gynfngnglslnsFVESFNDLVVIHV  532
            GY FNG   SL+ F+E   DL + H 
Sbjct  138  GYRFNGPDFSLSDFLEKLEDLAIFHA  163



>gb|AFW62990.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=404

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK  430
            I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK
Sbjct  79   IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK  122



>ref|NP_001241706.1| uncharacterized protein LOC100856884 [Zea mays]
 gb|ACF85236.1| unknown [Zea mays]
Length=458

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK  430
            I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK
Sbjct  79   IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK  122



>ref|NP_001148637.1| LOC100282253 [Zea mays]
 gb|ACG32331.1| protein binding protein [Zea mays]
Length=445

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRV  436
            + ++   I+ FK ++T DP+N+T +W G++LC  +  Y GF+C  P GGDK  V
Sbjct  62   LYRAYLVIQRFKSTVTSDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKLTV  114



>gb|ACF79045.1| unknown [Zea mays]
 gb|ACF86020.1| unknown [Zea mays]
 gb|AFW62992.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=458

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK  430
            I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK
Sbjct  79   IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK  122



>ref|XP_006422961.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
 gb|ESR36201.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
Length=504

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  454
            I+ + K I+ FKK ITYDPQ I ++W G ++C    KY+GF C V     KK V G+ FN
Sbjct  137  IQLAFKVIQRFKKRITYDPQGIAKTWVGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  193

Query  455  gynfngnglslnsFVESFNDLVVIHV  532
            GY FNG   SL+ F+E   DL + H 
Sbjct  194  GYRFNGPDFSLSDFLEKLEDLAIFHA  219



>gb|KDO59787.1| hypothetical protein CISIN_1g011101mg [Citrus sinensis]
Length=493

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  454
            I+ + K I+ FKK ITYDPQ I  +W G ++C    KY+GF C V     KK V G+ FN
Sbjct  126  IQLAFKVIQRFKKRITYDPQGIANTWMGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  182

Query  455  gynfngnglslnsFVESFNDLVVIHV  532
            GY FNG   SL+ F+E   DL + H 
Sbjct  183  GYRFNGPDFSLSDFLEKLEDLAIFHA  208



>ref|XP_008456145.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=424

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 5/90 (6%)
 Frame = +2

Query  263  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  442
            LD  +  +   I+TFK  IT DP N+TQ+W G+++C    KYQGF+C  P   +K  V  
Sbjct  57   LDQRLAVAYPIIQTFKALITSDPLNVTQTWVGSDIC----KYQGFYCDNPP-DNKSAVAI  111

Query  443  iyfngynfngnglslnsFVESFNDLVVIHV  532
               +   F     +L+ F++S  DL + H 
Sbjct  112  AGIDFNGFQLTASTLDGFIDSLPDLAIFHA  141



>ref|XP_006360245.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Solanum 
tuberosum]
Length=387

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  272  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFC  403
            ++  +I  I+ F+K+IT DP  IT++WEGN++C +  KY GF C
Sbjct  17   LLASAISVIKRFRKTITSDPSGITKTWEGNDICKDPTKYIGFIC  60



>ref|XP_009793223.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=511

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 10/86 (12%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  454
            +R+ IK I+ FKK+IT DP  +T++W GN++C     Y+G+ CY      K  V  I FN
Sbjct  151  LREVIKVIQKFKKTITSDPFGVTRTWVGNDVCC----YKGYTCY------KNHVVAIDFN  200

Query  455  gynfngnglslnsFVESFNDLVVIHV  532
            G++ NGN L+LN+F+E    LVVIH+
Sbjct  201  GFHLNGNQLALNNFIEKIKTLVVIHL  226



>ref|XP_006653579.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=456

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 3/46 (7%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVP  412
            + ++ K I+ F++++T DPQNI QSW G +LC     Y+GFFC  P
Sbjct  88   LYRAYKVIQKFRRTVTCDPQNIIQSWSGTDLC---GSYKGFFCERP  130



>ref|XP_004960235.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=512

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 4/82 (5%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFCYVPRGGDKKRVggiyfngynf  466
            I+ FKK+IT DP  +T +WEG +LC    N  KY+GF+C  P   +   +     +   F
Sbjct  156  IQAFKKTITCDPLGVTATWEGPDLCSSFFNGTKYRGFYCEYPPNANAT-LTVASIDFNGF  214

Query  467  ngnglslnsFVESFNDLVVIHV  532
                 SL  FV+ F DL + H 
Sbjct  215  GLCAPSLVGFVDQFPDLALFHA  236



>gb|EAY86686.1| hypothetical protein OsI_08068 [Oryza sativa Indica Group]
Length=426

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRG  418
            I+ FK +IT DP+N+T SW G+++C  +K Y GF+C  P G
Sbjct  50   IQRFKSTITSDPKNVTASWTGHDIC-GEKSYLGFYCATPTG  89



>gb|EMS59107.1| hypothetical protein TRIUR3_04108 [Triticum urartu]
Length=442

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (51%), Gaps = 6/93 (6%)
 Frame = +2

Query  272  VIRKSIKAIR---TFKKSITYDPQNITQSWEGNELCINKK---KYQGFFCYVPRGGDKKR  433
            V+R  + A R    FK++IT DP N+T +W G  +C + K    Y+GF+C  P     K 
Sbjct  57   VVRDHVPASRVSVAFKRTITSDPLNVTATWVGANICDSAKGGGAYKGFYCDTPPDDANKT  116

Query  434  VggiyfngynfngnglslnsFVESFNDLVVIHV  532
            +     +   F+    +L  F+++F DL + H 
Sbjct  117  LTVASIDFNGFHLCAPTLAGFIDAFPDLALFHA  149



>gb|EMT08852.1| hypothetical protein F775_11606 [Aegilops tauschii]
Length=518

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 44/82 (54%), Gaps = 3/82 (4%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKK---KYQGFFCYVPRGGDKKRVggiyfngynf  466
            I+ FK++IT DP N+T +W G ++C + K    Y+GF+C  P     K +     +   F
Sbjct  147  IQAFKRTITSDPLNVTATWVGTKICDSSKGGSAYKGFYCDTPPDDANKTLTVASIDFNGF  206

Query  467  ngnglslnsFVESFNDLVVIHV  532
            +    +L  F+++F DL + H 
Sbjct  207  HLCAPTLAGFIDAFPDLALFHA  228



>ref|XP_010932202.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=465

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 3/47 (6%)
 Frame = +2

Query  272  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVP  412
            ++ ++ K I+ FK +IT DPQ IT SW+G  +C     Y GFFC +P
Sbjct  88   LLYRAYKVIQKFKSTITCDPQGITNSWQGYNIC---STYNGFFCGIP  131



>ref|NP_001053250.1| Os04g0505200 [Oryza sativa Japonica Group]
 dbj|BAF15164.1| Os04g0505200 [Oryza sativa Japonica Group]
Length=306

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVP  412
            + K+ K I+ F++++T DPQNI  SW G +LC     Y+GFFC  P
Sbjct  84   LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERP  126



>emb|CAE02949.1| OSJNBa0014K14.21 [Oryza sativa Japonica Group]
 emb|CAE05560.1| OSJNBb0116K07.13 [Oryza sativa Japonica Group]
 gb|EAY94774.1| hypothetical protein OsI_16554 [Oryza sativa Indica Group]
 dbj|BAG90092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVP  412
            + K+ K I+ F++++T DPQNI  SW G +LC     Y+GFFC  P
Sbjct  84   LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERP  126



>gb|EEE61292.1| hypothetical protein OsJ_15379 [Oryza sativa Japonica Group]
Length=432

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVP  412
            + K+ K I+ F++++T DPQNI  SW G +LC     Y+GFFC  P
Sbjct  84   LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERP  126



>ref|XP_008798694.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=469

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 5/85 (6%)
 Frame = +2

Query  278  RKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfng  457
            R++   I+ FKK+IT DP+ +T++W G ++C    KY+GFFC  P    KK       + 
Sbjct  87   RRAYYVIQRFKKTITSDPRGVTRTWRGAKVC----KYKGFFCETP-PNRKKMPTIASVDF  141

Query  458  ynfngnglslnsFVESFNDLVVIHV  532
              F     S+  FV+   DL + H 
Sbjct  142  NTFRLAAPSVKKFVDQLPDLALFHA  166



>dbj|BAJ91151.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +2

Query  296  IRTFKKSITYDPQNITQSWEGNELCINKK---KYQGFFCYVPRGGDKKRVggiyfngynf  466
            I+ FK++IT DP N+T +W G ++C + K    Y+GF+C  P     K +     +   F
Sbjct  164  IQAFKRTITSDPLNVTATWVGTKICDSAKGGGAYKGFYCDTPPDDANKTLTVASIDFNGF  223

Query  467  ngnglslnsFVESFNDLVVIH  529
            +    +L  F+++F DL + H
Sbjct  224  HLCAPTLAGFIDAFPDLALFH  244



>ref|NP_001150111.1| protein binding protein precursor [Zea mays]
 gb|ACG37876.1| protein binding protein [Zea mays]
Length=424

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +2

Query  275  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYV-PRGGDKKRV  436
            + +S   I+ FK +IT DP+N+T SW GN++C  +  Y GF+C V P  G+K  V
Sbjct  46   LYRSYLVIQRFKSTITSDPKNVTASWIGNDIC-GEATYVGFYCGVLPGRGNKLTV  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000