BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H20

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAB71810.1|  anthocyanidin synthase                                 318   3e-105   Ipomoea nil [qian niu]
dbj|BAB71806.1|  anthocyanidin synthase                                 318   3e-105   Ipomoea nil [qian niu]
gb|ABW69682.1|  anthocyanidin synthase                                  313   3e-103   Ipomoea purpurea
gb|ABW69684.1|  anthocyanidin synthase                                  313   4e-103   Ipomoea purpurea
gb|ACS71531.1|  anthocyanidin synthase                                  310   5e-102   Ipomoea horsfalliae [Kuhio-vine]
gb|ABW69683.1|  anthocyanidin synthase                                  310   6e-102   Ipomoea purpurea
gb|AAB84049.1|  anthocyanidin synthase                                  308   2e-101   Ipomoea purpurea
dbj|BAA75305.1|  anthocyanidin synthase                                 300   2e-98    Ipomoea batatas [batate]
gb|ADE08370.1|  anthocyanidin synthase                                  296   9e-97    Ipomoea batatas [batate]
dbj|BAA75306.1|  anthocyanidin synthase                                 295   1e-96    Ipomoea batatas [batate]
gb|ACT31916.1|  anthocyanidin synthase                                  294   5e-96    Ipomoea batatas [batate]
gb|ABM63373.1|  anthocyanidin synthase                                  291   9e-95    Ipomoea batatas [batate]
gb|AAP82029.1|  anthocyanidin synthase                                  289   5e-94    Ipomoea hederacea [ivy-leaf morning-glory]
dbj|BAK78919.1|  anthocyanidin synthase                                 289   7e-94    Ipomoea hederifolia [scarletcreeper]
gb|AAP82030.1|  anthocyanidin synthase                                  286   5e-93    Ipomoea purpurea
dbj|BAL43066.1|  anthocyanidin synthase                                 286   1e-92    Ipomoea coccinea [red morning-glory]
dbj|BAL42997.1|  anthocyanidin synthase                                 283   1e-91    Ipomoea quamoclit [bejuco de cipres]
gb|AAP82018.1|  anthocyanidin synthase                                  279   3e-90    Ipomoea alba [moonflower]
gb|AAP82031.1|  anthocyanidin synthase                                  275   1e-88    Ipomoea trifida
gb|ACF59722.1|  anthocyanidin synthase                                  270   9e-87    Ipomoea trifida
gb|ACF59728.1|  anthocyanidin synthase                                  270   1e-86    Ipomoea trifida
gb|ACF59712.1|  anthocyanidin synthase                                  270   1e-86    Ipomoea trifida
gb|ACF59719.1|  anthocyanidin synthase                                  268   5e-86    Ipomoea trifida
gb|ACF59716.1|  anthocyanidin synthase                                  268   6e-86    Ipomoea trifida
gb|ACF59710.1|  anthocyanidin synthase                                  268   7e-86    Ipomoea trifida
gb|ACF59708.1|  anthocyanidin synthase                                  268   8e-86    Ipomoea trifida
gb|ACF59711.1|  anthocyanidin synthase                                  268   8e-86    Ipomoea trifida
gb|ACF59725.1|  anthocyanidin synthase                                  267   9e-86    Ipomoea trifida
gb|ACF59707.1|  anthocyanidin synthase                                  267   9e-86    Ipomoea trifida
gb|ACF59709.1|  anthocyanidin synthase                                  267   9e-86    Ipomoea trifida
gb|ACF59726.1|  anthocyanidin synthase                                  267   9e-86    Ipomoea trifida
gb|ACF59701.1|  anthocyanidin synthase                                  267   1e-85    Ipomoea trifida
gb|ACF59715.1|  anthocyanidin synthase                                  267   1e-85    Ipomoea trifida
gb|ACF59713.1|  anthocyanidin synthase                                  267   1e-85    Ipomoea trifida
gb|ACF59704.1|  anthocyanidin synthase                                  267   1e-85    Ipomoea trifida
gb|ACF59718.1|  anthocyanidin synthase                                  267   1e-85    Ipomoea trifida
gb|ACF59705.1|  anthocyanidin synthase                                  267   1e-85    Ipomoea trifida
gb|ACF59703.1|  anthocyanidin synthase                                  267   1e-85    Ipomoea trifida
gb|ACF59700.1|  anthocyanidin synthase                                  266   2e-85    Ipomoea trifida
gb|ACF59721.1|  anthocyanidin synthase                                  266   3e-85    Ipomoea trifida
gb|ACF59706.1|  anthocyanidin synthase                                  266   3e-85    Ipomoea trifida
gb|ACF59720.1|  anthocyanidin synthase                                  266   3e-85    Ipomoea trifida
gb|ACF59714.1|  anthocyanidin synthase                                  265   9e-85    Ipomoea trifida
gb|ACF59729.1|  anthocyanidin synthase                                  264   2e-84    Ipomoea trifida
gb|ACF59702.1|  anthocyanidin synthase                                  263   5e-84    Ipomoea trifida
ref|XP_004298720.1|  PREDICTED: leucoanthocyanidin dioxygenase          246   7e-77    Fragaria vesca subsp. vesca
gb|AFK32781.1|  anthocyanidin synthase                                  245   2e-76    Fragaria x ananassa
gb|AFP99287.1|  anthocyanidin synthase                                  245   2e-76    Fragaria x ananassa
gb|AGO64650.1|  anthocyanin synthase                                    234   4e-75    Solanum stenotomum
gb|AAU12368.1|  anthocyanidin synthase                                  239   2e-74    Fragaria x ananassa
ref|XP_009604108.1|  PREDICTED: leucoanthocyanidin dioxygenase          240   3e-74    Nicotiana tomentosiformis
gb|AFM52334.1|  anthocyanidin synthase 1                                239   7e-74    Nicotiana tabacum [American tobacco]
ref|XP_006358845.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     240   7e-74    Solanum tuberosum [potatoes]
gb|ACK76231.1|  anthocyanidin synthase                                  237   1e-73    Dimocarpus longan [longan]
gb|AAU12369.1|  anthocyanidin synthase                                  237   2e-73    Fragaria x ananassa
gb|AAP13054.1|  anthocyanidin synthase                                  236   2e-73    Gypsophila elegans [annual baby's-breath]
gb|AGO02175.1|  anthocyanidin synthase                                  236   3e-73    Nekemias grossedentata
ref|NP_001274859.1|  anthocyanidin synthase                             238   3e-73    Solanum tuberosum [potatoes]
ref|XP_009776119.1|  PREDICTED: leucoanthocyanidin dioxygenase          237   4e-73    Nicotiana sylvestris
ref|XP_010325438.1|  PREDICTED: LOW QUALITY PROTEIN: leucoanthocy...    238   4e-73    
gb|AFM52335.1|  anthocyanidin synthase 2                                237   4e-73    Nicotiana tabacum [American tobacco]
gb|AEJ90548.1|  anthocyanin synthase                                    238   5e-73    Solanum tuberosum [potatoes]
emb|CBI34777.3|  unnamed protein product                                231   6e-73    Vitis vinifera
gb|ADZ54785.1|  leucocyanidin oxygenase                                 235   6e-73    Prunus avium [gean]
gb|AEO79983.1|  anthocyanidin synthase                                  235   6e-73    Prunus avium [gean]
ref|XP_002509674.1|  leucoanthocyanidin dioxygenase, putative           228   1e-72    
dbj|BAJ08044.1|  anthocyanidin synthase                                 234   2e-72    Cyclamen graecum
gb|AEJ90546.1|  anthocyanin synthase                                    236   2e-72    Solanum cardiophyllum [heartleaf nightshade]
sp|P51092.1|LDOX_PETHY  RecName: Full=Leucoanthocyanidin dioxygen...    236   2e-72    Petunia x hybrida [garden petunia]
ref|XP_008238747.1|  PREDICTED: leucoanthocyanidin dioxygenase          233   3e-72    Prunus mume [ume]
gb|AJO67979.1|  anthocyanidin synthase                                  233   4e-72    Prunus avium [gean]
gb|AHZ30597.1|  anthocyanin synthatase                                  233   5e-72    Prunus domestica
gb|AFC37246.1|  anthocyanidin synthase                                  233   5e-72    Camellia chekiangoleosa
gb|AEN19292.1|  anthocyanidin synthase                                  232   6e-72    Prunus salicina var. cordata
gb|KHG09458.1|  Leucoanthocyanidin dioxygenase                          232   6e-72    Gossypium arboreum [tree cotton]
ref|XP_002304452.1|  Leucoanthocyanidin dioxygenase family protein      232   6e-72    Populus trichocarpa [western balsam poplar]
gb|AHZ97874.1|  anthocyanidin synthase                                  232   6e-72    Punica granatum [granado]
gb|AAB39995.1|  anthocyanidin synthase                                  232   7e-72    Dianthus caryophyllus [carnation]
gb|ABA01483.1|  gibberellin 3-hydroxylase 1                             232   7e-72    Gossypium hirsutum [American cotton]
gb|ACH56522.1|  leucoanthoxyanidin dioxygenase                          232   7e-72    Gossypium hirsutum [American cotton]
gb|ACN38270.1|  leucoanthocyanidin dioxygenase                          232   8e-72    Vitis amurensis
ref|XP_011071307.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     232   9e-72    Sesamum indicum [beniseed]
gb|KJB25723.1|  hypothetical protein B456_004G205900                    232   1e-71    Gossypium raimondii
gb|AEN71543.1|  anthocyanidin synthase                                  231   1e-71    Paeonia suffruticosa [moutan peony]
ref|NP_001268147.1|  leucoanthocyanidin dioxygenase                     231   1e-71    Vitis vinifera
gb|ABV82967.1|  anthocyanidin synthase                                  231   1e-71    Vitis vinifera
ref|XP_007210520.1|  hypothetical protein PRUPE_ppa007738mg             231   2e-71    Prunus persica
gb|AIY22762.1|  anthocyanidin synthase                                  233   2e-71    Iochroma cyaneum
gb|AJA79070.1|  anthocyanidin synthase                                  231   2e-71    Prunus persica
ref|XP_006440487.1|  hypothetical protein CICLE_v10020815mg             231   2e-71    Citrus clementina [clementine]
gb|EYU28954.1|  hypothetical protein MIMGU_mgv1a019361mg                231   2e-71    Erythranthe guttata [common monkey flower]
dbj|BAM42676.1|  leucoanthocyanidin dioxygenase                         231   3e-71    Vaccinium ashei
gb|AIU98515.1|  anthocyanidin synthase                                  230   4e-71    Paeonia suffruticosa [moutan peony]
gb|ACJ02088.1|  anthocyanin synthase                                    232   4e-71    Solanum melongena [aubergine]
ref|XP_008374025.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     229   8e-71    
gb|AJO67980.1|  anthocyanidin synthase                                  229   8e-71    Prunus cerasus [pie cherry]
gb|AGL50919.1|  anthocyanidin synthase                                  229   8e-71    Pyrus communis
gb|ABB70119.1|  anthocyanidin synthase                                  229   9e-71    Pyrus communis
gb|ADP09379.1|  anthocyanidin synthase                                  229   1e-70    Pyrus pyrifolia [sha li]
ref|XP_009362830.1|  PREDICTED: leucoanthocyanidin dioxygenase          229   1e-70    Pyrus x bretschneideri [bai li]
ref|XP_007040068.1|  Leucoanthocyanidin dioxygenase isoform 2           229   1e-70    
gb|AEN55613.2|  anthocyanin synthase                                    229   2e-70    Morus alba
gb|ADD51355.1|  anthocyanidin synthase                                  228   2e-70    Theobroma cacao [chocolate]
gb|AJD00703.1|  anthocyanidin synthase                                  229   2e-70    Pyrus x bretschneideri [bai li]
gb|KDO63651.1|  hypothetical protein CISIN_1g018369mg                   228   2e-70    Citrus sinensis [apfelsine]
gb|KDP25532.1|  hypothetical protein JCGZ_20688                         228   2e-70    Jatropha curcas
gb|AEJ90547.1|  anthocyanin synthase                                    231   2e-70    Solanum cardiophyllum [heartleaf nightshade]
sp|P51091.1|LDOX_MALDO  RecName: Full=Leucoanthocyanidin dioxygen...    228   3e-70    Malus domestica [apple tree]
gb|AAZ79374.1|  anthocyanidin synthase                                  228   4e-70    Malus domestica [apple tree]
ref|XP_008374024.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     229   4e-70    
ref|XP_008356542.1|  PREDICTED: leucoanthocyanidin dioxygenase          229   4e-70    
ref|XP_008374023.1|  PREDICTED: leucoanthocyanidin dioxygenase          228   5e-70    
gb|AGK27790.1|  anthocyanin synthase                                    227   6e-70    Morus alba var. atropurpurea
ref|NP_001280767.1|  leucoanthocyanidin dioxygenase-like                226   1e-69    Malus domestica [apple tree]
ref|XP_010255605.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     226   2e-69    Nelumbo nucifera [Indian lotus]
gb|ADD51356.1|  anthocyanidin synthase                                  226   2e-69    Theobroma cacao [chocolate]
gb|AHG95986.1|  anthocyanin synthase                                    226   2e-69    Epimedium sagittatum
ref|XP_007040067.1|  Leucoanthocyanidin dioxygenase isoform 1           227   2e-69    
gb|KHG30024.1|  Leucoanthocyanidin dioxygenase                          226   2e-69    Gossypium arboreum [tree cotton]
gb|AHJ80980.1|  anthocyanidin synthase                                  226   2e-69    Erythranthe lewisii
ref|NP_001275784.1|  anthocyanidin synthase                             226   2e-69    Citrus sinensis [apfelsine]
gb|AIL29327.1|  anthocyanidin synthase                                  225   3e-69    Paeonia suffruticosa [moutan peony]
ref|XP_010108066.1|  Leucoanthocyanidin dioxygenase                     226   3e-69    Morus notabilis
dbj|BAJ08939.1|  anthocyanidin synthase                                 226   3e-69    Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAJ08937.1|  anthocyanidin synthase                                 226   3e-69    Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_010538776.1|  PREDICTED: leucoanthocyanidin dioxygenase-li...    225   3e-69    Tarenaya hassleriana [spider flower]
ref|XP_011033842.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     225   4e-69    Populus euphratica
gb|ABP57081.1|  anthocyanidin synthase                                  225   5e-69    Plectranthus scutellarioides
ref|XP_010538778.1|  PREDICTED: leucoanthocyanidin dioxygenase-li...    224   7e-69    Tarenaya hassleriana [spider flower]
gb|ABP57079.1|  ANS1                                                    224   7e-69    Plectranthus scutellarioides
dbj|BAJ08927.1|  anthocyanidin synthase                                 224   8e-69    Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAJ08930.1|  anthocyanidin synthase                                 224   9e-69    Eustoma exaltatum subsp. russellianum [bluebells]
gb|AIL29326.1|  anthocyanidin synthase                                  224   9e-69    Paeonia rockii
gb|AFI71900.1|  anthocyanidin synthase                                  224   9e-69    Paeonia lactiflora [common garden peony]
dbj|BAJ08936.1|  anthocyanidin synthase                                 224   9e-69    Eustoma exaltatum subsp. russellianum [bluebells]
gb|AFA53722.1|  anthocyanidin synthase                                  224   9e-69    Vaccinium corymbosum [American blueberry]
gb|ABK96002.1|  unknown                                                 224   1e-68    Populus trichocarpa [western balsam poplar]
ref|XP_002298081.1|  Leucoanthocyanidin dioxygenase family protein      224   1e-68    Populus trichocarpa [western balsam poplar]
ref|XP_006413609.1|  hypothetical protein EUTSA_v10025559mg             224   1e-68    Eutrema salsugineum [saltwater cress]
ref|XP_010053365.1|  PREDICTED: leucoanthocyanidin dioxygenase          223   2e-68    Eucalyptus grandis [rose gum]
ref|XP_011029132.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     223   2e-68    Populus euphratica
dbj|BAJ08940.1|  anthocyanidin synthase                                 223   3e-68    Eustoma exaltatum subsp. russellianum [bluebells]
gb|AHH30830.1|  anthocyanin synthase                                    223   4e-68    Fagopyrum dibotrys [jin qiao]
dbj|BAE72879.1|  anthocyanidin synthase                                 222   5e-68    Glandularia x hybrida [garden verbena]
gb|ABY89681.1|  anthocyanidin synthase 1 protein                        222   7e-68    Brassica rapa subsp. oleifera [biennial turnip rape]
dbj|BAJ08932.1|  anthocyanidin synthase                                 222   7e-68    Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAJ08928.1|  anthocyanidin synthase                                 222   8e-68    Eustoma exaltatum subsp. russellianum [bluebells]
gb|AAB82287.1|  anthocyanidin synthase                                  222   8e-68    Matthiola incana
dbj|BAJ08929.2|  anthocyanidin synthase                                 221   1e-67    Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAD34462.1|  leucoanthocyanidin dioxygenase                         221   1e-67    Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_009136276.1|  PREDICTED: leucoanthocyanidin dioxygenase          221   1e-67    Brassica rapa
gb|AAV88087.1|  anthocyanidin synthase                                  221   1e-67    Camellia sinensis [black tea]
gb|ACH58397.1|  anthocyanidin synthase                                  221   1e-67    Brassica juncea [brown mustard]
ref|XP_003611189.1|  Leucoanthocyanidin dioxygenase                     221   1e-67    Medicago truncatula
ref|XP_009137289.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     221   2e-67    Brassica rapa
gb|AAO73440.1|  anthocyanidin synthase                                  221   2e-67    Brassica oleracea var. capitata
gb|ADK37750.1|  anthocyanidin synthase                                  221   2e-67    Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_010676602.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     221   2e-67    Beta vulgaris subsp. vulgaris [field beet]
sp|O04274.1|LDOX_PERFR  RecName: Full=Leucoanthocyanidin dioxygen...    220   3e-67    Perilla frutescens [beefsteak-mint]
gb|KJB51990.1|  hypothetical protein B456_008G242100                    219   3e-67    Gossypium raimondii
gb|ACM62747.1|  leucoanthocyanidin dioxygenase                          220   4e-67    Garcinia mangostana [mangosteen]
ref|XP_010255604.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     220   4e-67    Nelumbo nucifera [Indian lotus]
dbj|BAJ08925.1|  anthocyanidin synthase                                 220   6e-67    Eustoma exaltatum subsp. russellianum [bluebells]
emb|CEL26656.1|  anthocyanidin synthase                                 219   6e-67    Ribes nigrum [European black currant]
emb|CDX94133.1|  BnaC07g37670D                                          219   1e-66    
gb|AHW81902.1|  anthocyanin synthase                                    218   2e-66    Morus alba var. atropurpurea
gb|AIM48928.1|  anthocyanidin synthase                                  218   2e-66    Raphanus sativus
gb|AAY15745.1|  anthocyanidin synthase                                  218   2e-66    Gerbera hybrid cultivar
gb|AAY15743.2|  anthocyanidin synthase                                  218   2e-66    Gerbera hybrid cultivar
gb|ADT63066.1|  anthocyanidin synthase                                  218   2e-66    Fagopyrum esculentum
emb|CDX98776.1|  BnaA03g45610D                                          219   2e-66    
dbj|BAP92907.1|  leucoanthocyanidin dioxygenase homolog                 210   3e-66    Rubus palmatus
emb|CAA73094.1|  anthocyanidin synthase                                 218   3e-66    Forsythia x intermedia [cultivated forsythia]
dbj|BAE54521.1|  anthocyanidin synthase                                 218   4e-66    Phytolacca americana [common pokeberry]
dbj|BAP92886.1|  leucoanthocyanidin dioxygenase homolog                 210   4e-66    Rubus grayanus
dbj|BAP92908.1|  leucoanthocyanidin dioxygenase homolog                 209   5e-66    Rubus palmatus
dbj|BAP92905.1|  leucoanthocyanidin dioxygenase homolog                 209   6e-66    Rubus palmatus
gb|AAY15744.1|  anthocyanidin synthase                                  216   9e-66    Gerbera hybrid cultivar
ref|XP_006283819.1|  hypothetical protein CARUB_v10004921mg             218   1e-65    Capsella rubella
dbj|BAP92901.1|  leucoanthocyanidin dioxygenase homolog                 209   1e-65    Rubus palmatus
dbj|BAJ21536.1|  anthocyanidin synthase                                 216   1e-65    Dahlia pinnata
gb|AEF14411.1|  anthocyanidin synthase                                  216   2e-65    Onobrychis viciifolia
dbj|BAP92902.1|  leucoanthocyanidin dioxygenase homolog                 207   3e-65    Rubus palmatus
dbj|BAP92934.1|  leucoanthocyanidin dioxygenase homolog                 207   3e-65    Rubus palmatus
dbj|BAP92945.1|  leucoanthocyanidin dioxygenase homolog                 207   4e-65    Rubus grayanus
dbj|BAP92877.1|  leucoanthocyanidin dioxygenase homolog                 207   4e-65    Rubus palmatus
gb|AIZ70322.1|  anthocyanidin synthase                                  214   4e-65    Dahlia pinnata
gb|AGI16383.1|  anthocyanidin synthase                                  214   5e-65    Ribes nigrum [European black currant]
gb|ABU88895.1|  anthocyanidin synthase                                  212   7e-65    Prunus cerasifera [myrobalan plum]
dbj|BAP92920.1|  leucoanthocyanidin dioxygenase homolog                 207   8e-65    Rubus palmatus
dbj|BAP92884.1|  leucoanthocyanidin dioxygenase homolog                 206   9e-65    Rubus palmatus
dbj|BAE54520.1|  anthocyanidin synthase                                 213   1e-64    Spinacia oleracea
ref|XP_002867745.1|  hypothetical protein ARALYDRAFT_492580             213   1e-64    
gb|AHZ31754.1|  anthocyanidin synthase                                  215   1e-64    Viola x wittrockiana
dbj|BAN63164.1|  anthocyanidin synthase                                 214   1e-64    Diospyros kaki [Japanese persimmon]
dbj|BAP92878.1|  leucoanthocyanidin dioxygenase homolog                 206   2e-64    Rubus palmatus
ref|XP_010448813.1|  PREDICTED: leucoanthocyanidin dioxygenase          213   2e-64    Camelina sativa [gold-of-pleasure]
dbj|BAP93851.1|  leucoanthocyanidin dioxygenase homolog                 205   3e-64    Rubus grayanus
gb|AGV53047.1|  leucoanthocyanidin dioxygenase                          213   3e-64    Actinidia chinensis
gb|KFK39258.1|  hypothetical protein AALP_AA3G220900                    213   3e-64    Arabis alpina [alpine rockcress]
gb|ACA04011.1|  anthocyanidin synthase                                  210   3e-64    Diplacus aurantiacus
gb|ACB56922.1|  anthocyanidin synthase                                  212   4e-64    Pilosella officinarum [mouse-ear hawkweed]
ref|XP_004511625.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     212   5e-64    Cicer arietinum [garbanzo]
dbj|BAP92974.1|  leucoanthocyanidin dioxygenase homolog                 204   5e-64    Rubus palmatus
dbj|BAC75819.1|  mutant protein of leucoanthocyanidin dioxygenase       211   7e-64    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240884.1|  leucoanthocyanidin dioxygenase-like                211   8e-64    Glycine max [soybeans]
dbj|BAC75818.1|  mutant protein of leucoanthocyanidin dioxygenase       211   9e-64    Arabidopsis thaliana [mouse-ear cress]
gb|AHU88620.1|  anthocyanidin synthase                                  211   9e-64    Magnolia sprengeri
ref|XP_010433976.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     211   1e-63    Camelina sativa [gold-of-pleasure]
emb|CAD91994.1|  leucocyanidin dioxygenase                              211   1e-63    Arabidopsis thaliana [mouse-ear cress]
ref|NP_194019.1|  leucoanthocyanidin dioxygenase                        211   1e-63    Arabidopsis thaliana [mouse-ear cress]
pdb|2BRT|A  Chain A, Anthocyanidin Synthase From Arabidopsis Thal...    211   1e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439268.1|  PREDICTED: leucoanthocyanidin dioxygenase-li...    210   2e-63    Camelina sativa [gold-of-pleasure]
dbj|BAP93924.1|  leucoanthocyanidin dioxygenase homolog                 203   2e-63    Rubus sp. MM-2014
ref|NP_001239794.1|  anthocyanidin synthase                             210   3e-63    Glycine max [soybeans]
gb|KHN25745.1|  Leucoanthocyanidin dioxygenase                          210   3e-63    Glycine soja [wild soybean]
gb|AAD56581.1|AF184274_1  leucoanthocyanidin dioxygenase 2              211   3e-63    Daucus carota [carrots]
gb|AEI99590.1|  anthocyanidin synthase                                  210   3e-63    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ17658.1|  anthocyanidin synthase                                 209   4e-63    Gynura bicolor
gb|AAR26526.1|  anthocyanidin synthase 2                                209   4e-63    Glycine max [soybeans]
dbj|BAP93869.1|  leucoanthocyanidin dioxygenase homolog                 202   5e-63    Rubus sp. MM-2014
dbj|BAP93882.1|  leucoanthocyanidin dioxygenase homolog                 202   6e-63    Rubus sp. MM-2014
dbj|BAD91805.1|  anthocyanidin synthase                                 209   7e-63    Gentiana triflora
sp|P51093.1|LDOX_VITVI  RecName: Full=Leucoanthocyanidin dioxygen...    209   8e-63    Vitis vinifera
gb|AIL56404.1|  anthocyanidin synthase                                  209   9e-63    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAD56580.1|AF184273_1  leucoanthocyanidin dioxygenase 1              210   1e-62    Daucus carota [carrots]
dbj|BAP93881.1|  leucoanthocyanidin dioxygenase homolog                 201   1e-62    Rubus sp. MM-2014
gb|ACH73183.1|  leucoanthocyanidin dioxygenase                          208   1e-62    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACH73180.1|  leucoanthocyanidin dioxygenase                          208   1e-62    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_007158443.1|  hypothetical protein PHAVU_002G152700g             208   1e-62    Phaseolus vulgaris [French bean]
gb|ACH73178.1|  leucoanthocyanidin dioxygenase                          208   1e-62    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACH73179.1|  leucoanthocyanidin dioxygenase                          208   2e-62    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAB66560.1|  anthocyanidin synthase                                  208   2e-62    Callistephus chinensis [Chinese aster]
gb|ACF75873.2|  anthocyanidin synthase                                  208   2e-62    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADN03369.1|  anthocyanidin synthase                                  203   2e-62    Pyrus communis
gb|AAR01567.1|  anthocyanidin synthase                                  207   3e-62    Sinningia cardinalis
dbj|BAP93874.1|  leucoanthocyanidin dioxygenase homolog                 200   3e-62    Rubus sp. MM-2014
pdb|1GP4|A  Chain A, Anthocyanidin Synthase From Arabidopsis Thal...    207   4e-62    Arabidopsis thaliana [mouse-ear cress]
gb|ADB45308.1|  anthocyanidin synthase                                  206   4e-62    Brassica juncea subsp. napiformis [jie cai ge da]
gb|ACH73182.1|  leucoanthocyanidin dioxygenase                          207   4e-62    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADY02656.1|  leucoanthocyanidin dioxygenase                          207   5e-62    Parrya nudicaulis
gb|ADY02659.1|  leucoanthocyanidin dioxygenase                          207   5e-62    Parrya nudicaulis
gb|ADY02658.1|  leucoanthocyanidin dioxygenase                          207   6e-62    Parrya nudicaulis
gb|ADY02655.1|  leucoanthocyanidin dioxygenase                          207   6e-62    Parrya nudicaulis
gb|ABY51685.1|  anthocyanidin synthase                                  206   6e-62    Glycine max [soybeans]
dbj|BAE44202.1|  anthocyanidin synthase                                 206   8e-62    Gentiana triflora
gb|AGC73738.1|  anthocyanidin synthase                                  205   2e-61    Strelitzia reginae [bird-of-paradise]
gb|AGC92011.1|  anthocyanidin synthase                                  205   2e-61    Lilium cernuum
dbj|BAJ10383.1|  anthocyanidin synthase                                 204   6e-61    Lactuca sativa [cultivated lettuce]
dbj|BAF49295.1|  leucoanthocyanidin dioxygenase                         204   6e-61    Clitoria ternatea
ref|XP_009399499.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     203   1e-60    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAS48200.1|  anthocyanidin synthase                                  202   2e-60    Saussurea medusa
gb|ACF75869.2|  anthocyanidin synthase                                  202   2e-60    Pericallis cruenta
gb|ADO16019.1|  anthocyanidin synthase                                  201   2e-60    Ipomoea alba [moonflower]
gb|ADO16027.1|  anthocyanidin synthase                                  201   2e-60    Ipomoea nil [qian niu]
gb|ACH73181.1|  leucoanthocyanidin dioxygenase                          202   3e-60    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADO16026.1|  anthocyanidin synthase                                  200   3e-60    Ipomoea lobata [cresta de gallo]
dbj|BAM28976.1|  anthocyanidin synthase                                 202   4e-60    Lilium hybrid division I
dbj|BAB21477.1|  anthocyanidin synthase                                 202   6e-60    Torenia fournieri [bluewings]
gb|AGG18105.1|  anthocyanidin synthase                                  199   6e-60    Prunus persica
gb|ADO16036.1|  anthocyanidin synthase                                  199   1e-59    Ipomoea umbraticola
gb|ADO16029.1|  anthocyanidin synthase                                  197   3e-59    Ipomoea ochracea
gb|ADO16021.1|  anthocyanidin synthase                                  197   4e-59    Ipomoea aquatica [Chinese water-spinach]
gb|ADO16022.1|  anthocyanidin synthase                                  197   4e-59    Ipomoea argillicola
gb|AFY06692.1|  anthocyanidin synthase                                  196   5e-59    Prunus armeniaca
gb|ADO16037.1|  anthocyanidin synthase                                  196   1e-58    Ipomoea wrightii
gb|ADO16020.1|  anthocyanidin synthase                                  196   1e-58    Ipomoea amnicola
gb|ADO16023.1|  anthocyanidin synthase                                  195   3e-58    Ipomoea cordatotriloba
dbj|BAF62629.1|  anthocyanidin synthase                                 196   1e-57    Iris x hollandica [Dutch iris]
ref|XP_010934075.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     195   1e-57    Elaeis guineensis
gb|ADO16025.1|  anthocyanidin synthase                                  193   2e-57    Ipomoea eriocarpa
ref|XP_010909855.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     195   2e-57    Elaeis guineensis
dbj|BAF81268.2|  anthocyanidin synthase                                 193   2e-56    Iris x hollandica [Dutch iris]
dbj|BAH98156.1|  anthocyanidin synthase                                 192   2e-56    Tulipa gesneriana
gb|ADO16028.1|  anthocyanidin synthase                                  190   3e-56    Ipomoea obscura
gb|ADO16035.1|  anthocyanidin synthase                                  190   3e-56    Ipomoea saintronanensis
gb|ADO16030.1|  anthocyanidin synthase                                  190   3e-56    Ipomoea pes-tigridis
gb|AGJ50591.1|  ANS1                                                    191   9e-56    Tulipa fosteriana
gb|AAP20867.1|  putative anthocyanin synthase                           189   2e-55    Anthurium andraeanum [flamingo-lily]
gb|ADO16032.1|  anthocyanidin synthase                                  187   3e-55    
gb|ABK76317.1|  anthocyanin synthase                                    189   4e-55    
ref|XP_008783582.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     188   1e-54    
ref|XP_008776918.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     186   6e-54    
gb|AAR86940.1|  anthocyanidin synthase                                  182   1e-53    
gb|AGD99672.1|  anthocyanidin synthase                                  183   7e-53    
dbj|BAC98347.1|  anthocyanidin synthase                                 179   2e-52    
gb|ABK23633.1|  unknown                                                 172   6e-51    
gb|AAS99853.2|  anthocyanidin synthase                                  176   2e-50    
gb|ABR24157.1|  anthocyanidin synthase                                  176   3e-50    
gb|ABM66367.1|  anthocyanidin synthase                                  176   3e-50    
gb|AAO63024.1|  anthocyanidin synthase                                  176   5e-50    
gb|ABK23166.1|  unknown                                                 172   1e-48    
gb|ABK23429.1|  unknown                                                 172   1e-48    
gb|ABK26270.1|  unknown                                                 172   2e-48    
gb|ABK24773.1|  unknown                                                 167   6e-47    
gb|AHW42460.1|  GA2ox10                                                 167   8e-47    
ref|XP_010439269.1|  PREDICTED: leucoanthocyanidin dioxygenase-li...    165   2e-46    
gb|AHA36978.1|  anthocyanidin synthase                                  166   3e-46    
gb|AGY46124.1|  anthocyanidin synthase                                  163   4e-45    
gb|AIM58718.1|  anthocyanidin synthase                                  162   6e-45    
gb|ADO16024.1|  anthocyanidin synthase                                  159   3e-44    
gb|AIS35915.1|  anthocyanin synthase                                    158   3e-43    
gb|AFW69689.1|  anthocyaninless2                                        157   1e-42    
ref|NP_001106074.1|  leucoanthocyanidin dioxygenase                     157   2e-42    
gb|AHC07955.1|  ANS                                                     156   3e-42    
ref|XP_002451336.1|  hypothetical protein SORBIDRAFT_04g000260          156   4e-42    
emb|CAA69252.1|  anthocyanidin synthase                                 154   9e-42    
gb|EAY74085.1|  hypothetical protein OsI_01973                          154   1e-41    
gb|EEE54594.1|  hypothetical protein OsJ_01809                          154   1e-41    
ref|NP_001043065.1|  Os01g0372500                                       154   1e-41    
gb|ABM53758.1|  anthocyanidin synthase                                  149   8e-41    
gb|AET99288.1|  anthocyanidin synthase                                  150   2e-40    
gb|ACC66092.1|  anthocyanidin synthase                                  150   3e-40    
ref|XP_006828895.1|  hypothetical protein AMTR_s00001p00189490          148   1e-39    
gb|KCW77645.1|  hypothetical protein EUGRSUZ_D01945                     147   2e-39    
ref|NP_001058119.1|  Os06g0626700                                       141   7e-37    
gb|EAZ01747.1|  hypothetical protein OsI_23779                          141   7e-37    
gb|AJA79075.1|  anthocyanidin synthase                                  140   8e-37    
gb|AIM39335.1|  anthocyanidin synthase                                  133   5e-36    
gb|EPS72430.1|  anthocyanidin synthase                                  135   2e-35    
ref|XP_004951171.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     137   4e-35    
dbj|BAF96590.1|  anthocyanin synthase                                   133   6e-35    
dbj|BAF35999.1|  anthocyanin synthase                                   133   6e-35    
gb|AGT39062.1|  anthocyanidin synthase                                  128   1e-34    
dbj|BAE98276.1|  anthocyanidin synthase                                 134   4e-34    
dbj|BAF96944.1|  anthocyanidin synthase                                 131   1e-33    
gb|AIB06742.1|  anthocyanidin synthase                                  130   2e-33    
gb|AEQ61976.1|  leucoanthocyanidin dioxygenase                          129   2e-33    
dbj|BAF81508.1|  anthocyanidin synthase                                 124   3e-33    
gb|EMS49289.1|  Leucoanthocyanidin dioxygenase                          131   4e-33    
dbj|BAE98274.1|  anthocyanidin synthase                                 131   7e-33    
dbj|BAE98275.1|  anthocyanidin synthase                                 131   8e-33    
gb|AEN55612.1|  ans1                                                    128   1e-32    
gb|AEN55614.1|  ans3                                                    127   1e-32    
emb|CDP09837.1|  unnamed protein product                                127   6e-32    
dbj|BAE98273.1|  anthocyanidin synthase                                 128   1e-31    
gb|AEF30422.1|  anthocyanidin synthase                                  123   1e-31    
dbj|BAE98277.1|  anthocyanidin synthase                                 128   1e-31    
gb|AAK52455.1|  anthocyanidin synthase                                  123   3e-31    
gb|AFW82940.1|  hypothetical protein ZEAMMB73_955667                    119   2e-29    
gb|AFS28894.1|  anthocyanidin synthase                                  118   6e-29    
gb|KHN34986.1|  Leucoanthocyanidin dioxygenase                          115   1e-27    
ref|XP_006829908.1|  hypothetical protein AMTR_s00073p00090510          114   1e-27    
ref|XP_006645901.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     113   1e-26    
gb|ADY02720.1|  leucoanthocyanidin dioxygenase                          108   4e-26    
gb|ADY02705.1|  leucoanthocyanidin dioxygenase                          108   4e-26    
gb|ADY02714.1|  leucoanthocyanidin dioxygenase                          108   4e-26    
gb|ADY02706.1|  leucoanthocyanidin dioxygenase                          108   4e-26    
gb|ADY02708.1|  leucoanthocyanidin dioxygenase                          108   4e-26    
gb|ADY02707.1|  leucoanthocyanidin dioxygenase                          107   1e-25    
gb|AHW42459.1|  GA2ox9                                                  110   2e-25    
ref|XP_010256287.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    109   3e-25    
gb|ACY00393.1|  flavonol synthase                                       109   3e-25    
ref|XP_004500586.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    108   5e-25    
ref|XP_008658674.1|  PREDICTED: LOC100284095 isoform X1                 108   1e-24    
ref|XP_006830655.1|  hypothetical protein AMTR_s00349p00012070          107   1e-24    
ref|XP_010063357.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    107   2e-24    
gb|ABK21960.1|  unknown                                                 107   2e-24    
gb|ABA86596.1|  putative anthocyanin synthase                           104   3e-24    
ref|XP_006829899.1|  hypothetical protein AMTR_s00073p00054080          106   3e-24    
emb|CEL26655.1|  anthocyanidin synthase                                 105   4e-24    
emb|CEL26658.1|  anthocyanidin synthase                                 105   4e-24    
ref|NP_001150465.1|  LOC100284095                                       106   5e-24    
gb|ABK26641.1|  unknown                                                 105   7e-24    
gb|AAS21058.1|  flavonol synthase                                       105   8e-24    
ref|XP_010063358.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    105   1e-23    
ref|XP_010274342.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    103   2e-23    
ref|XP_010091357.1|  Flavonol synthase/flavanone 3-hydroxylase          103   3e-23    
ref|XP_011095018.1|  PREDICTED: leucoanthocyanidin dioxygenase          103   3e-23    
gb|AFW85703.1|  hypothetical protein ZEAMMB73_081005                    106   4e-23    
gb|ACJ85077.1|  unknown                                               99.8    7e-23    
ref|XP_010056462.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    102   9e-23    
ref|XP_009765337.1|  PREDICTED: protein SRG1-like                       102   1e-22    
ref|XP_010040043.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    102   1e-22    
ref|XP_010104266.1|  Leucoanthocyanidin dioxygenase                     102   1e-22    
ref|XP_006844214.1|  hypothetical protein AMTR_s00006p00266420        99.0    1e-22    
ref|XP_010327726.1|  PREDICTED: leucoanthocyanidin dioxygenase is...    102   1e-22    
ref|XP_004249074.1|  PREDICTED: leucoanthocyanidin dioxygenase is...    102   1e-22    
gb|KCW45529.1|  hypothetical protein EUGRSUZ_L00738                     102   1e-22    
ref|XP_007018995.1|  Flavonol synthase                                  101   2e-22    
gb|KHN46939.1|  Leucoanthocyanidin dioxygenase                          101   2e-22    
ref|XP_002518394.1|  Leucoanthocyanidin dioxygenase, putative           101   2e-22    
ref|XP_003552253.1|  PREDICTED: leucoanthocyanidin dioxygenase-li...    101   3e-22    
ref|XP_011001283.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    100   6e-22    
gb|ACN40215.1|  unknown                                                 100   6e-22    
emb|CDP14012.1|  unnamed protein product                                100   7e-22    
ref|XP_007026685.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    100   7e-22    
emb|CAN72728.1|  hypothetical protein VITISV_029566                   99.8    8e-22    
dbj|BAE75810.1|  flavonol synthase                                    99.8    8e-22    
ref|XP_002285841.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  99.8    8e-22    
ref|XP_003529158.1|  PREDICTED: leucoanthocyanidin dioxygenase          100   8e-22    
ref|XP_011006564.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   99.8    9e-22    
ref|XP_010925929.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    100   9e-22    
ref|XP_002309144.1|  hypothetical protein POPTR_0006s10200g           99.8    1e-21    
ref|XP_010039168.1|  PREDICTED: protein SRG1                          99.8    1e-21    
gb|KCW49451.1|  hypothetical protein EUGRSUZ_K02978                   99.4    1e-21    
gb|KEH23177.1|  leucoanthocyanidin dioxygenase-like protein           99.4    1e-21    
gb|KJB17061.1|  hypothetical protein B456_002G263100                  99.0    2e-21    
emb|CEL26657.1|  anthocyanidin synthase                               98.2    2e-21    
ref|XP_002323582.1|  hypothetical protein POPTR_0016s12440g           99.0    2e-21    
gb|AGO02176.1|  flavonol synthase                                     99.0    2e-21    
ref|XP_009612252.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   98.6    3e-21    
ref|XP_011019104.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   98.6    3e-21    
gb|AFA55179.1|  flavonol synthase                                     98.2    3e-21    
ref|XP_009621091.1|  PREDICTED: protein SRG1-like                     98.6    3e-21    
ref|NP_001241248.1|  uncharacterized protein LOC100810937             98.2    3e-21    
ref|XP_003524845.1|  PREDICTED: protein SRG1-like                     98.2    3e-21    
gb|ACZ17543.1|  oxidoreductase                                        98.2    4e-21    
gb|ABA54917.1|  flavonol synthase                                     97.8    4e-21    
gb|KJB36922.1|  hypothetical protein B456_006G182900                  97.8    4e-21    
ref|XP_003564279.1|  PREDICTED: leucoanthocyanidin dioxygenase        97.8    5e-21    
gb|ABM88786.1|  flavonol synthase                                     97.4    5e-21    
ref|XP_007029241.1|  Flavonol synthase                                97.4    5e-21    
ref|XP_007140275.1|  hypothetical protein PHAVU_008G098500g           97.8    6e-21    
gb|EAY99793.1|  hypothetical protein OsI_21782                        97.4    6e-21    
gb|AGY80773.1|  flavonol synthase                                     97.4    7e-21    
ref|XP_003604674.1|  Leucoanthocyanidin dioxygenase                   97.4    7e-21    
ref|XP_008806374.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  97.1    7e-21    
gb|AES86871.2|  leucoanthocyanidin dioxygenase-like protein           97.4    7e-21    
ref|XP_010689599.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  97.1    8e-21    
ref|XP_002533635.1|  Leucoanthocyanidin dioxygenase, putative         97.1    8e-21    
ref|NP_001056889.1|  Os06g0162500                                     97.1    8e-21    
ref|XP_006429403.1|  hypothetical protein CICLE_v10012026mg           97.1    9e-21    
gb|KHN25971.1|  Protein SRG1                                          97.8    1e-20    
ref|XP_010312367.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   95.1    1e-20    
ref|XP_011000676.1|  PREDICTED: leucoanthocyanidin dioxygenase        96.7    1e-20    
ref|XP_009771147.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   96.7    1e-20    
ref|XP_004302589.1|  PREDICTED: protein SRG1-like                     96.3    1e-20    
ref|XP_003600918.1|  Leucoanthocyanidin dioxygenase                   96.3    2e-20    
gb|AGR67390.1|  flavonol synthase                                     93.2    2e-20    
ref|XP_011077657.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   96.3    2e-20    
ref|XP_003638585.1|  Leucoanthocyanidin dioxygenase                   97.4    2e-20    
ref|XP_009612253.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   96.3    2e-20    
ref|XP_006349451.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   96.3    2e-20    
ref|XP_009146096.1|  PREDICTED: leucoanthocyanidin dioxygenase        95.9    2e-20    
ref|XP_002522207.1|  flavonol synthase, putative                      95.9    2e-20    
ref|XP_004964770.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   95.9    2e-20    
ref|XP_010278429.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  95.9    2e-20    
ref|XP_002312162.1|  oxidoreductase family protein                    95.9    2e-20    
gb|ABK21461.1|  unknown                                               95.9    2e-20    
ref|XP_002325697.1|  Flavonol synthase 1 family protein               95.5    3e-20    
emb|CDY32234.1|  BnaA01g17500D                                        95.1    4e-20    
ref|XP_007205445.1|  hypothetical protein PRUPE_ppa007856mg           95.1    4e-20    
ref|WP_039310922.1|  hypothetical protein                             94.7    5e-20    
gb|AFK37891.1|  unknown                                               94.7    5e-20    
ref|XP_004514213.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   94.7    6e-20    
ref|XP_006844783.1|  hypothetical protein AMTR_s00016p00259900        94.7    6e-20    
gb|ABY63659.1|  flavonol synthase                                     94.4    7e-20    
ref|XP_009783758.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  94.4    7e-20    
gb|AIY60790.1|  flavonol synthase                                     94.4    7e-20    
ref|XP_006426442.1|  hypothetical protein CICLE_v10026028mg           94.0    8e-20    
gb|EYU20001.1|  hypothetical protein MIMGU_mgv1a008881mg              93.6    1e-19    
emb|CDY34450.1|  BnaC01g21830D                                        94.0    1e-19    
gb|EYU20002.1|  hypothetical protein MIMGU_mgv1a008881mg              93.6    1e-19    
gb|AGE13752.1|  flavonol synthase                                     93.6    1e-19    
gb|KJB75134.1|  hypothetical protein B456_012G026200                  93.6    1e-19    
ref|XP_003601080.1|  Flavonol synthase/flavanone 3-hydroxylase        93.6    1e-19    
gb|KHG18898.1|  Flavonol synthase/flavanone 3-hydroxylase             93.2    2e-19    
gb|KHG12687.1|  S-norcoclaurine synthase 1                            93.2    2e-19    
ref|XP_008797281.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  93.2    2e-19    
ref|XP_009384795.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  93.2    2e-19    
ref|XP_009139128.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  93.2    2e-19    
gb|KDP24441.1|  hypothetical protein JCGZ_25005                       93.2    2e-19    
ref|XP_010535715.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   94.0    2e-19    
ref|XP_006429805.1|  hypothetical protein CICLE_v10012063mg           92.8    2e-19    
gb|KDO50199.1|  hypothetical protein CISIN_1g018466mg                 92.8    2e-19    
ref|XP_004954034.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  93.2    2e-19    
ref|XP_010039038.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  93.2    2e-19    
gb|ADZ28516.1|  flavonol synthase                                     92.8    2e-19    
ref|XP_011035927.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   93.2    2e-19    
ref|XP_010440176.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   92.8    2e-19    
ref|XP_006349452.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   93.2    2e-19    
ref|XP_007215627.1|  hypothetical protein PRUPE_ppa008007mg           92.8    3e-19    
ref|XP_010528915.1|  PREDICTED: protein SRG1                          92.8    3e-19    
ref|XP_006429806.1|  hypothetical protein CICLE_v10012063mg           92.8    3e-19    
gb|AHN19765.1|  flavonol synthase                                     92.4    3e-19    
ref|XP_004500496.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  92.8    3e-19    
ref|XP_008805332.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  92.8    3e-19    
ref|XP_010434846.1|  PREDICTED: leucoanthocyanidin dioxygenase        92.4    3e-19    
gb|KDO50198.1|  hypothetical protein CISIN_1g018466mg                 92.4    3e-19    
ref|XP_008648573.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   92.0    3e-19    
ref|XP_010534603.1|  PREDICTED: leucoanthocyanidin dioxygenase        92.4    3e-19    
ref|XP_010904684.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...  91.7    3e-19    
ref|XP_006492902.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  92.4    3e-19    
ref|XP_008680752.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   89.0    4e-19    
gb|KFK34838.1|  hypothetical protein AALP_AA5G199600                  92.4    4e-19    
ref|XP_004506753.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   92.4    4e-19    
ref|XP_011084903.1|  PREDICTED: protein SRG1-like                     92.4    4e-19    
ref|XP_002440516.1|  hypothetical protein SORBIDRAFT_09g002350        92.4    4e-19    
gb|ACL98052.1|  flavonol synthase                                     92.0    4e-19    
gb|AIM58714.1|  flavonol synthase                                     92.0    4e-19    
gb|ACJ84243.1|  unknown                                               92.0    5e-19    
gb|AFK40747.1|  unknown                                               92.0    5e-19    
ref|XP_010101426.1|  Leucoanthocyanidin dioxygenase                   92.0    5e-19    
ref|XP_004306298.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...  92.0    5e-19    
ref|XP_003616646.1|  1-aminocyclopropane-1-carboxylate oxidase        92.0    5e-19    
gb|EYU41904.1|  hypothetical protein MIMGU_mgv1a008689mg              92.0    5e-19    
ref|XP_002315155.1|  oxidoreductase family protein                    92.0    6e-19    
ref|XP_009116291.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  92.0    6e-19    
ref|XP_011069420.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   91.3    6e-19    



>dbj|BAB71810.1| anthocyanidin synthase [Ipomoea nil]
Length=371

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG
Sbjct  1    MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  60

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  61   INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  120

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  121  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  154



>dbj|BAB71806.1| anthocyanidin synthase [Ipomoea nil]
 dbj|BAB71807.1| anthocyanidin synthase [Ipomoea nil]
 dbj|BAB71809.1| anthocyanidin synthase [Ipomoea nil]
 dbj|BAB71811.1| anthocyanidin synthase [Ipomoea nil]
Length=371

 Score =   318 bits (814),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG
Sbjct  1    MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  60

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  61   INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  120

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  121  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  154



>gb|ABW69682.1| anthocyanidin synthase [Ipomoea purpurea]
Length=371

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/154 (98%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            M+STITATVPSRVERLA SGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG
Sbjct  1    MLSTITATVPSRVERLAGSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  60

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  61   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYA  120

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  121  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  154



>gb|ABW69684.1| anthocyanidin synthase [Ipomoea purpurea]
Length=371

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/154 (98%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            M+STITATVPSRVERLA SGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG
Sbjct  1    MLSTITATVPSRVERLAGSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  60

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  61   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYA  120

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  121  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  154



>gb|ACS71531.1| anthocyanidin synthase [Ipomoea horsfalliae]
Length=368

 Score =   310 bits (793),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/154 (97%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+TITATVPSRVERLA SGIERIPKEYIRPEEER SIGDIFEEEK+AGGPQVPTVDLKG
Sbjct  1    MVTTITATVPSRVERLAGSGIERIPKEYIRPEEERTSIGDIFEEEKMAGGPQVPTVDLKG  60

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  61   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYA  120

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  121  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  154



>gb|ABW69683.1| anthocyanidin synthase [Ipomoea purpurea]
Length=371

 Score =   310 bits (793),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/154 (97%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            M+ TITATVPSRVERLA SGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG
Sbjct  1    MLCTITATVPSRVERLAGSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  60

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI EELTGRV+AAGEGFFGQPIEEKEKYA
Sbjct  61   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPEELTGRVRAAGEGFFGQPIEEKEKYA  120

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  121  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  154



>gb|AAB84049.1| anthocyanidin synthase [Ipomoea purpurea]
Length=371

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/154 (97%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            M+STITATVPSRVERLA SGI+RIPKEYIRPEEERRSI DIFEEEKIAGGPQVPTVDLKG
Sbjct  1    MLSTITATVPSRVERLAGSGIQRIPKEYIRPEEERRSIRDIFEEEKIAGGPQVPTVDLKG  60

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  61   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYA  120

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  121  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  154



>dbj|BAA75305.1| anthocyanidin synthase [Ipomoea batatas]
Length=364

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+TI+ATVPSRVERLA SGIERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLK 
Sbjct  1    MVTTISATVPSRVERLAGSGIERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLKR  60

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  61   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYA  120

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  121  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVF  154



>gb|ADE08370.1| anthocyanidin synthase [Ipomoea batatas]
Length=362

 Score =   296 bits (758),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+TIT  VPSRVERLA SGIERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKG
Sbjct  1    MVTTIT--VPSRVERLAGSGIERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLKG  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  59   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>dbj|BAA75306.1| anthocyanidin synthase [Ipomoea batatas]
Length=362

 Score =   295 bits (756),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+TIT  VPSRVERLA SGIERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKG
Sbjct  1    MVTTIT--VPSRVERLAGSGIERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLKG  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  59   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>gb|ACT31916.1| anthocyanidin synthase [Ipomoea batatas]
Length=362

 Score =   294 bits (753),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+TIT  VPSRVERLA SGIERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDL+G
Sbjct  1    MVTTIT--VPSRVERLAGSGIERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLEG  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYA
Sbjct  59   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>gb|ABM63373.1| anthocyanidin synthase [Ipomoea batatas]
Length=362

 Score =   291 bits (745),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 146/154 (95%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+TIT  VPSRVERLA SGIERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKG
Sbjct  1    MVTTIT--VPSRVERLAGSGIERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLKG  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSEDLEVREKCREELRKAAVDWGVMHLVNHGI +ELTGRVKAAGEGFFGQ IEEKEKYA
Sbjct  59   INSEDLEVREKCREELRKAAVDWGVMHLVNHGIPKELTGRVKAAGEGFFGQSIEEKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>gb|AAP82029.1| anthocyanidin synthase [Ipomoea hederacea]
Length=351

 Score =   289 bits (739),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   ERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCR  272
            ERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCR
Sbjct  1    ERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCR  60

Query  273  EELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS  452
            EELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS
Sbjct  61   EELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS  120

Query  453  KLANNASGQLEWEDYFFHCIF  515
            KLANNASGQLEWEDYFFHCIF
Sbjct  121  KLANNASGQLEWEDYFFHCIF  141



>dbj|BAK78919.1| anthocyanidin synthase [Ipomoea hederifolia]
Length=368

 Score =   289 bits (739),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIG-DIFEEEKIAGGPQVPTVDLK  230
            MV+TITATVPSRVERLA SGIE IPKEYIRPEEER+SIG DIF+EEK  GGPQVPTVDLK
Sbjct  1    MVTTITATVPSRVERLAGSGIEHIPKEYIRPEEERKSIGGDIFKEEKTDGGPQVPTVDLK  60

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
            GINSEDLE REKCREELRKAAVDWGVMHLVNHGI EELT RVKAAGEGFF QPIEEKEKY
Sbjct  61   GINSEDLEEREKCREELRKAAVDWGVMHLVNHGIPEELTRRVKAAGEGFFAQPIEEKEKY  120

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQA GNVQGYGSKLANNASGQLEW+DYFFHCIF
Sbjct  121  ANDQATGNVQGYGSKLANNASGQLEWQDYFFHCIF  155



>gb|AAP82030.1| anthocyanidin synthase [Ipomoea purpurea]
Length=351

 Score =   286 bits (732),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   ERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCR  272
            ERLA SGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCR
Sbjct  1    ERLAGSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCR  60

Query  273  EELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS  452
            EELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS
Sbjct  61   EELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS  120

Query  453  KLANNASGQLEWEDYFFHCIF  515
            KLANNASGQLEWEDYFFHCIF
Sbjct  121  KLANNASGQLEWEDYFFHCIF  141



>dbj|BAL43066.1| anthocyanidin synthase [Ipomoea coccinea]
Length=363

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIG-DIFEEEKIAGGPQVPTVDLK  230
            MVSTITATVPSRVERLA SGIE IPKEYIRPEEER+SIG DIF+EEK  GGPQVPTVDLK
Sbjct  1    MVSTITATVPSRVERLAGSGIEHIPKEYIRPEEERKSIGGDIFKEEKTDGGPQVPTVDLK  60

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
            GINSEDLE REK REELRKAAVDWGVMHLVNHGI EELT RVKAAGEGFF QPIEEKEKY
Sbjct  61   GINSEDLEEREKSREELRKAAVDWGVMHLVNHGIPEELTRRVKAAGEGFFAQPIEEKEKY  120

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQA GNVQGYGSKLANNASGQLEW+DYFFHCIF
Sbjct  121  ANDQATGNVQGYGSKLANNASGQLEWQDYFFHCIF  155



>dbj|BAL42997.1| anthocyanidin synthase [Ipomoea quamoclit]
Length=367

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIG-DIFEEEKIAGGPQVPTVDLK  230
            MV+TITATVPSRVERLA SGIE IPKEYIRPEEER+SIG +IFEEEK  GGPQVPTVDLK
Sbjct  1    MVTTITATVPSRVERLAGSGIEHIPKEYIRPEEERKSIGGNIFEEEKTDGGPQVPTVDLK  60

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
            GI+SEDLE REKCREELRKAAVDWGVMHLVNHGI EELT RVKAAGEGFF QPIEEKEKY
Sbjct  61   GIDSEDLEEREKCREELRKAAVDWGVMHLVNHGIPEELTRRVKAAGEGFFAQPIEEKEKY  120

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQAAGNVQGYGSKLANNASGQLEW+DYFFH IF
Sbjct  121  ANDQAAGNVQGYGSKLANNASGQLEWQDYFFHRIF  155



>gb|AAP82018.1| anthocyanidin synthase [Ipomoea alba]
Length=348

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   ERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCR  272
            E LA SGIERIPKEYIRPEEERRSIGDIFEEEK+ GGPQVPTVDLKGINS+DLEVREKCR
Sbjct  1    ETLAGSGIERIPKEYIRPEEERRSIGDIFEEEKMGGGPQVPTVDLKGINSDDLEVREKCR  60

Query  273  EELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS  452
            EELRKAAVDWGVMHLVNHGI EELTGRVKAAGEGFF QPIEEKEKYANDQAAGNVQGYGS
Sbjct  61   EELRKAAVDWGVMHLVNHGIPEELTGRVKAAGEGFFAQPIEEKEKYANDQAAGNVQGYGS  120

Query  453  KLANNASGQLEWEDYFFHCIF  515
            KLANNASGQLEWEDYFFHCIF
Sbjct  121  KLANNASGQLEWEDYFFHCIF  141



>gb|AAP82031.1| anthocyanidin synthase [Ipomoea trifida]
Length=350

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   ERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCR  272
            ERLA SGIERIPK YIRPE+ER SIGDIF EEK+AGGPQVPTVDLKGINSEDLEVREKCR
Sbjct  1    ERLAGSGIERIPKRYIRPEKERPSIGDIFAEEKMAGGPQVPTVDLKGINSEDLEVREKCR  60

Query  273  EELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS  452
            EELRKAAVDWGVMHLVNHGI EELT RVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS
Sbjct  61   EELRKAAVDWGVMHLVNHGIPEELTARVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGS  120

Query  453  KLANNASGQLEWEDYFFHCIF  515
            KLANNASGQLEWEDYFFHC+F
Sbjct  121  KLANNASGQLEWEDYFFHCVF  141



>gb|ACF59722.1| anthocyanidin synthase, partial [Ipomoea trifida]
 gb|ACF59723.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   270 bits (690),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIFEEEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFEEEKMGGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59728.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIFEEEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFEEEKMGGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59712.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIFEEEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFEEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59719.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   268 bits (685),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59716.1| anthocyanidin synthase, partial [Ipomoea trifida]
 gb|ACF59717.1| anthocyanidin synthase, partial [Ipomoea trifida]
 gb|ACF59724.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   268 bits (684),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59710.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   268 bits (684),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59708.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   268 bits (684),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59711.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   268 bits (684),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59725.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59707.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59709.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59726.1| anthocyanidin synthase, partial [Ipomoea trifida]
 gb|ACF59727.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SI DIFEEEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIDDIFEEEKMGGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59701.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59715.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59713.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59704.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59718.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59705.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59703.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59700.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINS+DLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSDDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59721.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELT RVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTARVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59706.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQA GNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQATGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59720.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELT RVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTARVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59714.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   265 bits (677),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGPQVPTVDLKGINSEDLE REKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMGGGPQVPTVDLKGINSEDLEEREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59729.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+ GGP+VPTVDLKGINSEDLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMGGGPKVPTVDLKGINSEDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EEL GRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELIGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>gb|ACF59702.1| anthocyanidin synthase, partial [Ipomoea trifida]
Length=344

 Score =   263 bits (672),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  114  IERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAA  293
            IERIPKEYIRPEEER SIGDIF EEK+  GPQVPTVDLKGINS+DLEVREKCREELRKAA
Sbjct  1    IERIPKEYIRPEEERPSIGDIFAEEKMDRGPQVPTVDLKGINSDDLEVREKCREELRKAA  60

Query  294  VDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  473
            VDWGVMHLVNHGI EELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS
Sbjct  61   VDWGVMHLVNHGIPEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNAS  120

Query  474  GQLEWEDYFFHCIF  515
            GQLEWEDYFFHC+F
Sbjct  121  GQLEWEDYFFHCVF  134



>ref|XP_004298720.1| PREDICTED: leucoanthocyanidin dioxygenase [Fragaria vesca subsp. 
vesca]
Length=383

 Score =   246 bits (627),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  72   ATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDL  251
            A+V SRVE LASSGI  IPKEY+RPEEE  +IGDIFE+EK   GPQVPT+DLK I+SED+
Sbjct  5    ASVGSRVESLASSGISTIPKEYVRPEEELVNIGDIFEDEKSTEGPQVPTIDLKEIDSEDI  64

Query  252  EVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAG  431
            +VREKCREEL+KAA+DWGVMHLVNHGIS+EL  RVK AG+ FF  PIE+KEKYANDQA+G
Sbjct  65   KVREKCREELKKAAIDWGVMHLVNHGISDELMERVKKAGKAFFDLPIEQKEKYANDQASG  124

Query  432  NVQGYGSKLANNASGQLEWEDYFFHCIF  515
             +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  125  KIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|AFK32781.1| anthocyanidin synthase [Fragaria x ananassa]
Length=383

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  72   ATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDL  251
            A++ SRVE LASSGI  IPKEY+RPEEE  +IGDIFE+EK   GPQVPT+DLK I+SED+
Sbjct  5    ASIGSRVESLASSGISTIPKEYVRPEEELVNIGDIFEDEKSTEGPQVPTIDLKEIDSEDI  64

Query  252  EVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAG  431
            +VREKCREEL+KAA+DWGVMHL+NHGIS+EL  RVK AG+ FF  PIE+KEKYANDQA+G
Sbjct  65   KVREKCREELKKAAIDWGVMHLINHGISDELMERVKKAGKAFFDLPIEQKEKYANDQASG  124

Query  432  NVQGYGSKLANNASGQLEWEDYFFHCIF  515
             +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  125  KIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|AFP99287.1| anthocyanidin synthase [Fragaria x ananassa]
Length=383

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  72   ATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDL  251
            A++ SRVE LASSGI  IPKEY+RPEEE  +IGDIFE+EK   GPQVPT+DLK I+SED+
Sbjct  5    ASIGSRVESLASSGISTIPKEYVRPEEELVNIGDIFEDEKSTEGPQVPTIDLKEIDSEDI  64

Query  252  EVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAG  431
            +VREKCREEL+KAA+DWGVMHLVNHGIS+EL  RVK AG+ FF  P+E+KEKYANDQA+G
Sbjct  65   KVREKCREELKKAAIDWGVMHLVNHGISDELMERVKKAGKAFFDLPVEQKEKYANDQASG  124

Query  432  NVQGYGSKLANNASGQLEWEDYFFHCIF  515
             +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  125  KIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|AGO64650.1| anthocyanin synthase, partial [Solanum stenotomum]
Length=168

 Score =   234 bits (597),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +   +PSRVE LA SGI+ IPKEY+RP+EE   IG+IFE+EK   GPQVPT++LK 
Sbjct  1    MVSEVVP-IPSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEDEKKDEGPQVPTINLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED E+REKC +EL+KAAV+WGVMHLVNHGIS+EL  RVK AG  FF  P+EEKEKYA
Sbjct  60   IDSEDKEIREKCHQELKKAAVEWGVMHLVNHGISDELIERVKVAGSTFFDLPVEEKEKYA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  120  NDQASGNVQGYGSKLANSACGQLEWEDYFFHCVF  153



>gb|AAU12368.1| anthocyanidin synthase [Fragaria x ananassa]
Length=383

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  72   ATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDL  251
            A++ SRVE LASSGI  IPKEY+RPEEE  +IGDIFE+EK   GPQVPT+DLK I+S+D+
Sbjct  5    ASIGSRVESLASSGISTIPKEYVRPEEELVNIGDIFEDEKSTEGPQVPTIDLKEIDSDDI  64

Query  252  EVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAG  431
            +VREKCRE+L++AAV+WGVMHL+NHGIS+EL  RVK AG+ FF  PIE+KEKYANDQA+G
Sbjct  65   KVREKCREDLKEAAVEWGVMHLINHGISDELMERVKKAGKAFFDLPIEQKEKYANDQASG  124

Query  432  NVQGYGSKLANNASGQLEWEDYFFHCIF  515
             +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  125  KIQGYGSKLANNASGQLEWEDYFFHCVY  152



>ref|XP_009604108.1| PREDICTED: leucoanthocyanidin dioxygenase [Nicotiana tomentosiformis]
Length=419

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  51   IMVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLK  230
            +++S +  T PSRVE LA SGI+ IPKEY+RP+EE   IG+IFEEEK   GPQVPT+DL 
Sbjct  2    VVISAVVPT-PSRVESLAKSGIQAIPKEYVRPQEELNGIGNIFEEEKKDEGPQVPTIDLT  60

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
             I+SED E+REKC +EL+KAA++WGVMHLVNHGIS+EL  RVK AG+ FF QP+EEKEKY
Sbjct  61   EIDSEDKEIREKCHQELKKAAIEWGVMHLVNHGISDELIDRVKVAGDTFFDQPVEEKEKY  120

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQ +GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  121  ANDQPSGNVQGYGSKLANSACGQLEWEDYFFHCVF  155



>gb|AFM52334.1| anthocyanidin synthase 1 [Nicotiana tabacum]
 dbj|BAM37963.1| anthocyanidin synthase [Nicotiana tabacum]
Length=419

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  51   IMVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLK  230
            +++S +  T PSRVE LA SGI+ IPKEY+RP+EE   IG+IFEEEK   GPQVPT+DL 
Sbjct  2    VVISAVVPT-PSRVESLAKSGIQAIPKEYVRPQEELNGIGNIFEEEKKDEGPQVPTIDLT  60

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
             I+SED E+REKC +EL+KAA++WGVMHLVNHGIS+EL  RVK +G+ FF QP+EEKEKY
Sbjct  61   EIDSEDKEIREKCHQELKKAAIEWGVMHLVNHGISDELIDRVKVSGDTFFDQPVEEKEKY  120

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQ +GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  121  ANDQPSGNVQGYGSKLANSACGQLEWEDYFFHCVF  155



>ref|XP_006358845.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Solanum tuberosum]
Length=455

 Score =   240 bits (613),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +   +PSRVE LA SGI+ IPKEY+RP+EE   IG+IFE+EK   GPQVPT++LK 
Sbjct  1    MVSEVVP-IPSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEDEKKDEGPQVPTINLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSED E+REKC +EL+KAAV+WGVMHLVNHGIS+EL  RVK AG  FF  P+EEKEKYA
Sbjct  60   INSEDKEIREKCHQELKKAAVEWGVMHLVNHGISDELIDRVKVAGSTFFDLPVEEKEKYA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  120  NDQASGNVQGYGSKLANSACGQLEWEDYFFHCVF  153



>gb|ACK76231.1| anthocyanidin synthase [Dimocarpus longan]
Length=357

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE L+SSGI+ IPKEY+RPEEE  SIG++FEEEK   GPQVPT+DLK I+SE
Sbjct  1    MVTSVAPRVESLSSSGIQSIPKEYVRPEEELTSIGNVFEEEKKRDGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D  VREKCRE+L++AA+DWGVMHLVNHGIS+EL  +V+ AG+ FF  P+EEKEKYANDQA
Sbjct  61   DQVVREKCREQLKQAAIDWGVMHLVNHGISDELMDKVREAGQAFFNLPVEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +GNVQGYGSKLANNASGQLEWEDYFFH I+
Sbjct  121  SGNVQGYGSKLANNASGQLEWEDYFFHLIY  150



>gb|AAU12369.1| anthocyanidin synthase [Fragaria x ananassa]
Length=383

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +3

Query  72   ATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDL  251
            A++ SRVE LASSGI  IPKEY+RP+EE  +IGDIFE+EK   GPQVPT+DLK I+S D+
Sbjct  5    ASIGSRVESLASSGISTIPKEYVRPKEELVNIGDIFEDEKSTEGPQVPTIDLKEIDSNDI  64

Query  252  EVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAG  431
            +VREKCRE+L++AAV+WGVMHL+NHGIS+EL  RVK AG+ FF  PIE+KEKYANDQA+G
Sbjct  65   KVREKCREDLKEAAVEWGVMHLINHGISDELMERVKKAGKAFFDLPIEQKEKYANDQASG  124

Query  432  NVQGYGSKLANNASGQLEWEDYFFHCIF  515
             +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  125  KIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|AAP13054.1| anthocyanidin synthase [Gypsophila elegans]
Length=360

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  69   TATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSED  248
            T   PSRVE LASSGIE IPKEY+RPEEE  SIGD+FEEEK  GGPQVPT+DLK I SED
Sbjct  5    TKVAPSRVETLASSGIECIPKEYVRPEEELTSIGDVFEEEKKDGGPQVPTMDLKDIASED  64

Query  249  LEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAA  428
             EVR+K  +EL+KAA++WGVMH+VNHGISEEL  RVK AGE FF  PIEEKEKYANDQ +
Sbjct  65   PEVRDKAIQELKKAAMEWGVMHIVNHGISEELITRVKVAGETFFEFPIEEKEKYANDQDS  124

Query  429  GNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            GNVQGYGSKLANNASGQLEWEDYFFH  F
Sbjct  125  GNVQGYGSKLANNASGQLEWEDYFFHLAF  153



>gb|AGO02175.1| anthocyanidin synthase [Ampelopsis grossedentata]
Length=356

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T +V  RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I SE
Sbjct  2    VTTSVAPRVESLASSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIESE  61

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D  VRE+CREEL+KAA +WGVMHLVNHGIS++L  RVK AGE FF  PIEEKEKYANDQA
Sbjct  62   DEVVRERCREELKKAATEWGVMHLVNHGISDDLLNRVKVAGEAFFNLPIEEKEKYANDQA  121

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G + GYGSKLANNASGQLEWEDYFFH IF
Sbjct  122  SGKIAGYGSKLANNASGQLEWEDYFFHLIF  151



>ref|NP_001274859.1| anthocyanidin synthase [Solanum tuberosum]
 gb|ADP37440.1| anthocyanidin synthase [Solanum tuberosum]
Length=455

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +  T PSRVE LA SGI+ IPKEY+RP+EE   IG+IFE+EK   GPQVPT++LK 
Sbjct  1    MVSEVVPT-PSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEDEKKDEGPQVPTINLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED E+REKC +EL+KAAV+WGVMHLVNHGIS+EL  RVK AG  FF  P+EEKEKYA
Sbjct  60   IDSEDKEIREKCHQELKKAAVEWGVMHLVNHGISDELIERVKVAGSTFFDLPVEEKEKYA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  120  NDQASGNVQGYGSKLANSACGQLEWEDYFFHCVF  153



>ref|XP_009776119.1| PREDICTED: leucoanthocyanidin dioxygenase [Nicotiana sylvestris]
 dbj|BAM37962.1| anthocyanidin synthase [Nicotiana tabacum]
Length=419

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  51   IMVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLK  230
            +++S +  T PSRVE LA SGI+ IPKEY+RP+EE   IG+IFEEEK   GPQVPT+DLK
Sbjct  2    VVISAVVPT-PSRVESLAKSGIQAIPKEYVRPQEELNGIGNIFEEEKKDEGPQVPTIDLK  60

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
             I+SED E+REKC +EL+KAA++WGVM+LVNHGIS++L  RVK AG+ FF QP+EEKEKY
Sbjct  61   EIDSEDKEIREKCHKELKKAAMEWGVMYLVNHGISDQLIDRVKVAGKTFFDQPVEEKEKY  120

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQ +GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  121  ANDQPSGNVQGYGSKLANSACGQLEWEDYFFHCVF  155



>ref|XP_010325438.1| PREDICTED: LOW QUALITY PROTEIN: leucoanthocyanidin dioxygenase-like 
[Solanum lycopersicum]
Length=456

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +  ++PSRVE LA SGI+ IPKEY+RP+EE   IG+IFEEEK   GPQVPT++LK 
Sbjct  1    MVSEVV-SIPSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEEEKKDEGPQVPTINLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED E+R+KC +EL+KAAV+WGVMHLVNHGIS+EL  RVK AG  FF  P+EEKEKYA
Sbjct  60   IDSEDKEIRKKCHQELKKAAVEWGVMHLVNHGISDELIERVKVAGRTFFDLPVEEKEKYA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  120  NDQASGNVQGYGSKLANSACGQLEWEDYFFHCVF  153



>gb|AFM52335.1| anthocyanidin synthase 2 [Nicotiana tabacum]
Length=419

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  51   IMVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLK  230
            +++S +  T PSRVE LA SGI+ IPKEY+RP+EE   IG+IFEEEK   GPQVPT+DLK
Sbjct  2    VVISAVVPT-PSRVESLAKSGIQAIPKEYVRPQEELNGIGNIFEEEKKDEGPQVPTIDLK  60

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
             I+SED E+REKC +EL+KAA++WGVM+LVNHGIS++L  RVK AG+ FF QP+EEKEKY
Sbjct  61   EIDSEDKEIREKCHKELKKAAMEWGVMYLVNHGISDQLIDRVKVAGKTFFDQPVEEKEKY  120

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQ +GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  121  ANDQPSGNVQGYGSKLANSACGQLEWEDYFFHCVF  155



>gb|AEJ90548.1| anthocyanin synthase [Solanum tuberosum]
Length=455

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +  T PSRVE LA SGI+ IPKEY+RP+EE   IG+IFE+EK   GPQVPT++LK 
Sbjct  1    MVSEVVPT-PSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEDEKKDEGPQVPTINLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED E+REKC +EL+KAAV+WGVMHLVNHGIS+EL  RVK AG  FF  P+EEKEKYA
Sbjct  60   IDSEDKEIREKCHQELKKAAVEWGVMHLVNHGISDELIDRVKVAGGTFFDLPVEEKEKYA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  120  NDQASGNVQGYGSKLANSACGQLEWEDYFFHCVF  153



>emb|CBI34777.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   231 bits (589),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE L+SSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I SE
Sbjct  1    MVTSVAPRVESLSSSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIESE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D  VRE+CREEL+KAA++WGVMHLVNHGIS++L  RVK AGE FF  P+EEKEKYANDQA
Sbjct  61   DEVVRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G + GYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  SGKIAGYGSKLANNASGQLEWEDYFFHLIF  150



>gb|ADZ54785.1| leucocyanidin oxygenase [Prunus avium]
 gb|AJO67970.1| anthocyanidin synthase [Prunus avium]
Length=357

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LASSGI  IPKEYIRP+EE  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLASSGIATIPKEYIRPKEELINIGDIFEQEKSTDGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SE+ +VRE+CREEL KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KEKYA
Sbjct  59   IDSENEKVRERCREELNKAAVDWGVMHLVNHGISDELMDRVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFH IF
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHLIF  152



>gb|AEO79983.1| anthocyanidin synthase [Prunus avium]
 gb|AHL45017.1| anthocyanidin synthase [Prunus avium]
Length=357

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LASSGI  IPKEYIRP+EE  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLASSGIATIPKEYIRPKEELINIGDIFEQEKSTDGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SE+ +VRE+CREEL KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KEKYA
Sbjct  59   IDSENEKVRERCREELNKAAVDWGVMHLVNHGISDELMDRVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFH IF
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHLIF  152



>ref|XP_002509674.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF51061.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=168

 Score =   228 bits (581),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T  +P RVE L++SGIE IPKEYIRP+EE  S+G++FEEEK   GPQVPT+DLK ++SE
Sbjct  2    VTTLIP-RVESLSNSGIESIPKEYIRPKEELTSVGNVFEEEKKDEGPQVPTIDLKEVDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D E+REKCREEL KAA DWGVMHLVNHGI  EL  RVK AG+ FF  P+EEKE+YAN+QA
Sbjct  61   DKEIREKCREELLKAAKDWGVMHLVNHGIPGELIDRVKKAGQAFFDLPVEEKERYANNQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  SGKIQGYGSKLANNASGQLEWEDYFFHLIF  150



>dbj|BAJ08044.1| anthocyanidin synthase [Cyclamen graecum]
Length=356

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +TA  PSRVE LASSGI+ IP+EY+RP+EE  SIGDIFEEEK   GPQVPT+D+  + SE
Sbjct  2    VTAVAPSRVESLASSGIQSIPQEYVRPQEELTSIGDIFEEEKNESGPQVPTIDVMDLASE  61

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D E R +CR  L++AA DWGVMHLVNHGI + L  RVK AGEGFF  P+EEKEKYAND A
Sbjct  62   DPEARARCRAALKRAAEDWGVMHLVNHGIPDNLINRVKVAGEGFFNLPVEEKEKYANDHA  121

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +GN+QGYGSKLANNASGQLEWEDYFFH IF
Sbjct  122  SGNIQGYGSKLANNASGQLEWEDYFFHLIF  151



>gb|AEJ90546.1| anthocyanin synthase [Solanum cardiophyllum]
Length=454

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +   +PSRVE LA SGI+ IPKEY+RP+EE   IG+IFE+EK   GPQVPT++LK 
Sbjct  1    MVSAVV-PIPSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEDEKKDEGPQVPTINLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED E+REKC +EL+KAAV+WGVMHLVNHGIS+EL  RVK AG  FF  P+EEKEKYA
Sbjct  60   IDSEDKEIREKCHQELKKAAVEWGVMHLVNHGISDELIDRVKVAGGAFFDLPVEEKEKYA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQ +GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  120  NDQVSGNVQGYGSKLANSACGQLEWEDYFFHCVF  153



>sp|P51092.1|LDOX_PETHY RecName: Full=Leucoanthocyanidin dioxygenase; Short=LDOX; Short=Leucocyanidin 
oxygenase; AltName: Full=Leucoanthocyanidin 
hydroxylase [Petunia x hybrida]
Length=430

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+ +  T PSRVE LA SGI+ IPKEY+RP+EE   IG+IFEEEK   GPQVPT+DLK 
Sbjct  1    MVNAVV-TTPSRVESLAKSGIQAIPKEYVRPQEELNGIGNIFEEEKKDEGPQVPTIDLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED E+REKC + L+KAA++WGVMHLVNHGIS+EL  RVK AGE FF QP+EEKEKYA
Sbjct  60   IDSEDKEIREKCHQ-LKKAAMEWGVMHLVNHGISDELINRVKVAGETFFDQPVEEKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA GNVQGYGSKLAN+A GQLEWEDYFFHC F
Sbjct  119  NDQANGNVQGYGSKLANSACGQLEWEDYFFHCAF  152



>ref|XP_008238747.1| PREDICTED: leucoanthocyanidin dioxygenase [Prunus mume]
Length=364

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            SRVE LASSGI  IPKEYIRP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE+ +VRE
Sbjct  16   SRVETLASSGIATIPKEYIRPKEELVNIGDIFEQEKSTDGPQVPTIDLKEIDSENEKVRE  75

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            +CREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KEKYANDQA+G +QG
Sbjct  76   RCREELKKAAVDWGVMHLVNHGISDELMDRVRKAGKAFFDLPIEQKEKYANDQASGKIQG  135

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNASGQLEWEDYFFH ++
Sbjct  136  YGSKLANNASGQLEWEDYFFHLVY  159



>gb|AJO67979.1| anthocyanidin synthase, partial [Prunus avium]
Length=355

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 131/154 (85%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LASSGI  IPKEYIRP+EE  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLASSGIATIPKEYIRPKEELINIGDIFEQEKSTDGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SE+ +VRE+CREEL KAAVDWGV+HLVNHGIS+EL  RV+ AG+ FF  PIE+KEKYA
Sbjct  59   IDSENEKVRERCREELNKAAVDWGVVHLVNHGISDELMDRVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFH IF
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHLIF  152



>gb|AHZ30597.1| anthocyanin synthatase, partial [Prunus domestica]
Length=357

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LASSGI  IPKEYIRP+EE  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLASSGIATIPKEYIRPKEELVNIGDIFEQEKSTDGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SE+ +VRE+CREEL+K AVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KEKYA
Sbjct  59   IDSENEKVRERCREELKKXAVDWGVMHLVNHGISDELMDRVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHLVY  152



>gb|AFC37246.1| anthocyanidin synthase [Camellia chekiangoleosa]
Length=355

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+T+      RVE LASSG+E IPKEYIRP+EE  SIG++FEEEK   GPQVPTVDLK 
Sbjct  1    MVATVAGI---RVESLASSGLESIPKEYIRPQEELTSIGNVFEEEKKEEGPQVPTVDLKD  57

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            + +ED EVRE+C E L+KAA +WGVMHLVNHGI +EL  RVK AGEGFF QP+EEKEKYA
Sbjct  58   LVAEDKEVRERCHEALKKAATEWGVMHLVNHGIPDELMERVKVAGEGFFNQPVEEKEKYA  117

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ND  +GN+QGYGSKLANNASGQLEWEDYFFH +F
Sbjct  118  NDHDSGNIQGYGSKLANNASGQLEWEDYFFHLVF  151



>gb|AEN19292.1| anthocyanidin synthase [Prunus salicina var. cordata]
Length=357

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LASSGI  IPKEYIRP+EE  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLASSGIATIPKEYIRPKEELVNIGDIFEQEKSTDGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SE+ +VRE+CREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE YA
Sbjct  59   IDSENEKVRERCREELKKAAVDWGVMHLVNHGISDELMDRVRKAGKAFFDLPIEQKEMYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHLVY  152



>gb|KHG09458.1| Leucoanthocyanidin dioxygenase [Gossypium arboreum]
Length=354

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T+ +P RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DL  I SE
Sbjct  2    VTSVLP-RVESLASSGIQSIPKEYIRPQEELTSIGNVFEEEKKEEGPQVPTIDLTEIESE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EV+E+CR+EL+KAA++WGVMHLVNHGISEEL  RV+  G+ FF  P+EEKEKYANDQ+
Sbjct  61   DKEVQERCRQELKKAAMEWGVMHLVNHGISEELMDRVRKVGQKFFELPVEEKEKYANDQS  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +GNVQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  SGNVQGYGSKLANNASGQLEWEDYFFHLIF  150



>ref|XP_002304452.1| Leucoanthocyanidin dioxygenase family protein [Populus trichocarpa]
 gb|EEE79431.1| Leucoanthocyanidin dioxygenase family protein [Populus trichocarpa]
Length=361

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            M+ T +  VP RVE LASSGI+ IPKEYIRP+EE  SI D+FEEEK   GPQVPT+DLK 
Sbjct  1    MMVTSSFVVP-RVESLASSGIQSIPKEYIRPQEELSSIRDVFEEEKKVEGPQVPTIDLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            + SED  VREKCREEL KAA +WGVMHLVNHGI ++L  RVK AG+ FF  PIEEKEK+A
Sbjct  60   MESEDKVVREKCREELVKAATEWGVMHLVNHGIPDDLIDRVKKAGQAFFDLPIEEKEKHA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+GNVQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  120  NDQASGNVQGYGSKLANNASGQLEWEDYFFHLIF  153



>gb|AHZ97874.1| anthocyanidin synthase [Punica granatum]
Length=356

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            + ATV  RVE LASSGI+ IPKEY+RPEEE  SIG++FEEEK   GPQVPT+DL+ I SE
Sbjct  1    MVATVIPRVESLASSGIQSIPKEYVRPEEELTSIGNVFEEEKRDEGPQVPTIDLRDIESE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D  VREKCR EL+KAA DWGVMHLVNHGI + L  RVK AGE FF  PIEEKEKYANDQA
Sbjct  61   DKVVREKCRAELKKAAADWGVMHLVNHGIPDNLIERVKKAGEEFFNLPIEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASGQLEWEDYFFH +F
Sbjct  121  SGRIQGYGSKLANNASGQLEWEDYFFHLVF  150



>gb|AAB39995.1| anthocyanidin synthase, partial [Dianthus caryophyllus]
Length=355

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +3

Query  69   TATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSED  248
            T   PSRVE LASSGIE IPKEY+RPEEE  SIGD+FEEEK   GPQVPT+DLK I SED
Sbjct  3    TKIAPSRVETLASSGIECIPKEYVRPEEELTSIGDVFEEEKKDDGPQVPTIDLKDIASED  62

Query  249  LEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAA  428
             EVR K   EL+KAA++WGVMH+VNHGISEEL  RVK AGE FF  PIEEKEKYANDQ +
Sbjct  63   PEVRAKAIHELKKAAMEWGVMHIVNHGISEELINRVKVAGETFFEFPIEEKEKYANDQDS  122

Query  429  GNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            GNVQGYGSKLANNASGQLEWEDYFFH  +
Sbjct  123  GNVQGYGSKLANNASGQLEWEDYFFHLAY  151



>gb|ABA01483.1| gibberellin 3-hydroxylase 1 [Gossypium hirsutum]
 gb|ABM64801.1| anthocyanidin synthase [Gossypium hirsutum]
Length=354

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T+ +P RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DL  I SE
Sbjct  2    VTSVLP-RVESLASSGIQSIPKEYIRPQEELTSIGNVFEEEKKEEGPQVPTIDLTEIESE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EVRE+C++EL+KAA++WGVMHLVNHGISEEL  RV+  G+ FF  P+EEKEKYANDQ+
Sbjct  61   DKEVRERCQQELKKAAMEWGVMHLVNHGISEELMDRVRKVGQKFFELPVEEKEKYANDQS  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +GNVQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  SGNVQGYGSKLANNASGQLEWEDYFFHLIF  150



>gb|ACH56522.1| leucoanthoxyanidin dioxygenase [Gossypium hirsutum]
Length=354

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T+ +P RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DL  I SE
Sbjct  2    VTSVLP-RVESLASSGIQSIPKEYIRPQEELTSIGNVFEEEKKEEGPQVPTIDLTEIESE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EVRE+C++EL+KAA++WGVMHLVNHGISEEL  RV+  G+ FF  P+EEKEKYANDQ+
Sbjct  61   DKEVRERCQQELKKAAMEWGVMHLVNHGISEELMDRVRKVGQKFFELPVEEKEKYANDQS  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +GNVQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  SGNVQGYGSKLANNASGQLEWEDYFFHLIF  150



>gb|ACN38270.1| leucoanthocyanidin dioxygenase [Vitis amurensis]
Length=355

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE L+SSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I SE
Sbjct  1    MVTSVAPRVESLSSSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIESE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D  VRE+CREEL+KAA++WGVMHLVNHGIS++L  RVK AGE FF  PIEEKEKYANDQA
Sbjct  61   DEVVRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPIEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G + GYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  SGMIAGYGSKLANNASGQLEWEDYFFHLIF  150



>ref|XP_011071307.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Sesamum indicum]
Length=363

 Score =   232 bits (591),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +  +   RVE LA SGI  IPKEY+RPEEE +SIGDIF EEK   GPQVPT+DL+ 
Sbjct  1    MVSPMAPS--PRVEILARSGINTIPKEYVRPEEELKSIGDIFAEEKSMDGPQVPTIDLEA  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INS+D E+R+KC EEL++AA++WGVMHL+NHGI +EL  RVK AG  FF  P+EEKEKYA
Sbjct  59   INSDDEEMRKKCHEELKQAAMEWGVMHLINHGIPKELVNRVKVAGREFFELPVEEKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQ AGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NDQEAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>gb|KJB25723.1| hypothetical protein B456_004G205900 [Gossypium raimondii]
Length=354

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 128/150 (85%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T+ +P RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DL  I SE
Sbjct  2    VTSVLP-RVESLASSGIQSIPKEYIRPQEELTSIGNVFEEEKKEEGPQVPTIDLTEIESE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EVRE+CR+EL+ AA++WGVMHLVNHGISEEL  RV+  G+ FF  P+EEKEKYANDQ+
Sbjct  61   DKEVRERCRQELKNAAMEWGVMHLVNHGISEELMDRVRKVGQKFFELPVEEKEKYANDQS  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +GNVQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  SGNVQGYGSKLANNASGQLEWEDYFFHLIF  150



>gb|AEN71543.1| anthocyanidin synthase [Paeonia suffruticosa]
Length=354

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE LA+SGI+ IPKEY+R +EE+ SI +IFEEEK   GPQVPT+DLK I+SE
Sbjct  1    MVNSVAPRVESLATSGIQSIPKEYVRTKEEQTSITNIFEEEKKEEGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D+E+REKCREEL+KAA+DWGVMHLVNHGIS+EL  RVK AGE FF QP+EEKEKYANDQ 
Sbjct  61   DIELREKCREELKKAAMDWGVMHLVNHGISDELLERVKKAGEVFFQQPVEEKEKYANDQE  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G + GYGSKLANNASGQLEWEDYFFH +F
Sbjct  121  TGKIAGYGSKLANNASGQLEWEDYFFHLVF  150



>ref|NP_001268147.1| leucoanthocyanidin dioxygenase [Vitis vinifera]
 dbj|BAC07545.1| leucoanthocyanidin dioxgenase [Vitis labrusca x Vitis vinifera]
 gb|ABM67590.1| anthocyanidin synthase [Vitis vinifera]
 gb|ACT65728.1| leucocyanidin oxygenase [Vitis vinifera]
Length=355

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE L+SSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I SE
Sbjct  1    MVTSVAPRVESLSSSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIESE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D  VRE+CREEL+KAA++WGVMHLVNHGIS++L  RVK AGE FF  P+EEKEKYANDQA
Sbjct  61   DEVVRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G + GYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  SGKIAGYGSKLANNASGQLEWEDYFFHLIF  150



>gb|ABV82967.1| anthocyanidin synthase [Vitis vinifera]
Length=355

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE L+SSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I SE
Sbjct  1    MVTSVAPRVESLSSSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIESE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D  VRE+CREEL+KAA++WGVMHLVNHGIS++L  RVK AGE FF  P+EEKEKYANDQA
Sbjct  61   DEVVRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G + GYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  SGKIAGYGSKLANNASGQLEWEDYFFHLIF  150



>ref|XP_007210520.1| hypothetical protein PRUPE_ppa007738mg [Prunus persica]
 gb|ABX89941.1| leucoanthocyanidin dioxygenase [Prunus persica]
 gb|ABX89942.1| leucoanthocyanidin dioxygenase [Prunus persica]
 gb|ABX89943.1| leucoanthocyanidin dioxygenase [Prunus persica]
 gb|AEJ88221.1| leucoanthocyanidin dioxygenase [Prunus persica]
 gb|EMJ11719.1| hypothetical protein PRUPE_ppa007738mg [Prunus persica]
Length=357

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE L+SSGI  IPKEYIRP+EE  +I DIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLSSSGIATIPKEYIRPKEELINISDIFEQEKSTDGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SE+  VRE+CREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KEKYA
Sbjct  59   IDSENENVRERCREELKKAAVDWGVMHLVNHGISDELMDRVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHLVY  152



>gb|AIY22762.1| anthocyanidin synthase [Iochroma cyaneum]
Length=442

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +  T PSRVE L   GI+ IPKEY+RP+EE   IG+IFEEEK   GPQVPT+DLK 
Sbjct  1    MVSEVVPT-PSRVESLXKVGIKAIPKEYVRPQEELNGIGNIFEEEKKDEGPQVPTIDLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED E+REKC +EL+KAA++WGVMHLVNHGIS+EL  RVK AG  FF  P+EEKEKYA
Sbjct  60   IDSEDKEIREKCHQELKKAAMEWGVMHLVNHGISDELINRVKVAGGTFFDLPVEEKEKYA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQ +GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  120  NDQPSGNVQGYGSKLANSACGQLEWEDYFFHCVF  153



>gb|AJA79070.1| anthocyanidin synthase [Prunus persica]
Length=357

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE L+SSGI  IPKEYIRP+EE  +I DIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLSSSGIATIPKEYIRPKEELINISDIFEQEKSTDGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SE+  VRE+CREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KEKYA
Sbjct  59   IDSENENVRERCREELKKAAVDWGVMHLVNHGISDELMDRVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHLVY  152



>ref|XP_006440487.1| hypothetical protein CICLE_v10020815mg [Citrus clementina]
 gb|ESR53727.1| hypothetical protein CICLE_v10020815mg [Citrus clementina]
Length=357

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T T P RVE LA SGI+ IPKEY+RP+EE  SIG+IFEEE+   GPQVPT+D+K I+SE
Sbjct  2    VTPTAP-RVESLARSGIQAIPKEYVRPKEELMSIGNIFEEEEKDEGPQVPTIDIKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D   REKCREEL+KAA+DWGVMHLVNHGIS++LT RVK AG+ FF QP+EEKEKYAN+QA
Sbjct  61   DRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASGQLEWEDYFFH I+
Sbjct  121  SGKIQGYGSKLANNASGQLEWEDYFFHLIY  150



>gb|EYU28954.1| hypothetical protein MIMGU_mgv1a019361mg, partial [Erythranthe 
guttata]
Length=350

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +  +   RVE LA SGI+ IPKEY+R EEE +SIGDIF EEK+  GPQ+P +DL G
Sbjct  1    MVSIMAPS--PRVEVLARSGIDTIPKEYVRTEEELKSIGDIFAEEKVTDGPQLPVIDLAG  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+S+D E R KC EEL+KAAV+WGVMHLVNHG+ EEL  RVK AG  FF  P+EEKE+YA
Sbjct  59   ISSDDEETRLKCHEELKKAAVEWGVMHLVNHGVPEELMERVKNAGRAFFELPVEEKEEYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>dbj|BAM42676.1| leucoanthocyanidin dioxygenase [Vaccinium ashei]
Length=360

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 4/157 (3%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVST+ A  PSRVE LASSGI+ IPKEY+RP+EE  SIG+IFEEEK   GPQVPT+DL+ 
Sbjct  1    MVSTMVAA-PSRVESLASSGIQSIPKEYVRPKEELTSIGNIFEEEKKHEGPQVPTIDLED  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            + SED E RE+C E L+KAA +WGVMHLVNHG+ EEL  RV+ AGEGFF QP+EEKEKYA
Sbjct  60   LVSEDKEARERCHEALKKAATEWGVMHLVNHGVPEELMDRVRVAGEGFFNQPVEEKEKYA  119

Query  414  NDQAAGN---VQGYGSKLANNASGQLEWEDYFFHCIF  515
            ND   GN   +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  120  NDHDTGNSGKIQGYGSKLANNASGQLEWEDYFFHTVY  156



>gb|AIU98515.1| anthocyanidin synthase [Paeonia suffruticosa]
Length=354

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE LA+SGI+ IPKEY+R +EE+ SI +IFEEEK   GPQVPT+DLK I+SE
Sbjct  1    MVNSVAPRVESLATSGIQSIPKEYVRTKEEQTSITNIFEEEKKEEGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D+++REKCREEL+KAA+DWGVMHLVNHGIS+EL  RVK AGE FF QP+EEKEKYANDQ 
Sbjct  61   DIKLREKCREELKKAAMDWGVMHLVNHGISDELLERVKKAGEVFFQQPVEEKEKYANDQE  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G + GYGSKLANNASGQLEWEDYFFH +F
Sbjct  121  TGKIAGYGSKLANNASGQLEWEDYFFHLVF  150



>gb|ACJ02088.1| anthocyanin synthase [Solanum melongena]
Length=413

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS +  T PSRVE LA SGI+ IPKEY+RP+EE   IG+IFEEEK   GPQVPT++LK 
Sbjct  1    MVSEVVPT-PSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEEEKKEEGPQVPTINLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED E+REKC +EL++AA++WGVMHLVNHGIS+EL   VK AG  FF  P+EEKEKYA
Sbjct  60   IDSEDKEIREKCHQELKRAAMEWGVMHLVNHGISDELIDHVKVAGGTFFDLPVEEKEKYA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQ +GNVQGYGSKLANN  GQLEWEDYFFHC+F
Sbjct  120  NDQPSGNVQGYGSKLANNGCGQLEWEDYFFHCVF  153



>ref|XP_008374025.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Malus domestica]
Length=357

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEYIRP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCREEL+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  59   IESDNEKVRAKCREELKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|AJO67980.1| anthocyanidin synthase, partial [Prunus cerasus]
Length=355

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LASSGI  IPKEYIRP+EE  +IGDI E+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLASSGIATIPKEYIRPKEELINIGDISEQEKSTDGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SE+ +VRE+CREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KEKYA
Sbjct  59   IDSENEKVRERCREELKKAAVDWGVMHLVNHGISDELMDRVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFH  +
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHLTY  152



>gb|AGL50919.1| anthocyanidin synthase [Pyrus communis]
 gb|AGL81351.1| anthocyanidin synthase [Pyrus communis]
Length=357

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEYIRP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCREEL+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  59   IESDNEKVRAKCREELKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|ABB70119.1| anthocyanidin synthase [Pyrus communis]
Length=357

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEYIRP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCREEL+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  59   IESDNEKVRAKCREELKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|ADP09379.1| anthocyanidin synthase [Pyrus pyrifolia]
Length=357

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEY+RP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYVRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCREEL+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  59   IESDNEKVRAKCREELKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>ref|XP_009362830.1| PREDICTED: leucoanthocyanidin dioxygenase [Pyrus x bretschneideri]
Length=357

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEY+RP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYVRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCREEL+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  59   IESDNEKVRAKCREELKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>ref|XP_007040068.1| Leucoanthocyanidin dioxygenase isoform 2 [Theobroma cacao]
 gb|EOY24569.1| Leucoanthocyanidin dioxygenase isoform 2 [Theobroma cacao]
Length=354

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T+  P RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I+SE
Sbjct  2    VTSMAP-RVESLASSGIQSIPKEYIRPQEELTSIGNVFEEEKKEEGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EVRE+CR+EL+KAA +WGVMHLVNHGIS+EL  RVK AG+ FF   +EEKEKYANDQA
Sbjct  61   DREVRERCRQELKKAATEWGVMHLVNHGISDELMERVKKAGQKFFELSVEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  121  LGKIQGYGSKLANNASGQLEWEDYFFHLVY  150



>gb|AEN55613.2| anthocyanin synthase [Morus alba]
Length=358

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVERLASSGIE IP+EY+RP+EE  SIG++FEEEK   GP+VPT+DLKGINSE
Sbjct  1    MVISVAPRVERLASSGIEVIPQEYVRPQEELTSIGNVFEEEKKEEGPRVPTIDLKGINSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D   REKC+EEL+KAAV WGVMHLVNHGI +EL  RVK AGE FF  PIEEKEKYANDQA
Sbjct  61   DPVEREKCKEELKKAAVGWGVMHLVNHGIPDELIERVKKAGETFFDLPIEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G +QGYGSKLANNA GQLEWEDYFFH ++
Sbjct  121  TGKIQGYGSKLANNACGQLEWEDYFFHLVY  150



>gb|ADD51355.1| anthocyanidin synthase [Theobroma cacao]
Length=354

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T+  P RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I+SE
Sbjct  2    VTSMAP-RVESLASSGIQSIPKEYIRPQEELTSIGNVFEEEKKEEGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EVRE+CR+EL+KAA +WGVMHLVNHGIS+EL  RVK AG+ FF   +EEKEKYANDQA
Sbjct  61   DREVRERCRQELKKAATEWGVMHLVNHGISDELMERVKKAGQKFFELSVEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  121  LGKIQGYGSKLANNASGQLEWEDYFFHLVY  150



>gb|AJD00703.1| anthocyanidin synthase, partial [Pyrus x bretschneideri]
Length=358

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEY+RP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYVRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCREEL+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  59   IESDNEKVRAKCREELKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|KDO63651.1| hypothetical protein CISIN_1g018369mg [Citrus sinensis]
Length=357

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 128/150 (85%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T T   RVE LA SGI+ IPKEY+RP+EE  SIG+IFEEE+   GPQVPT+DLK I+SE
Sbjct  2    VTPTA-RRVESLARSGIQAIPKEYVRPKEELMSIGNIFEEEEKDEGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D   REKCREEL+KAA+DWGVMHLVNHGIS++LT RVK AG+ FF QP+EEKEKYAN+QA
Sbjct  61   DRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASGQLEWEDYFFH I+
Sbjct  121  SGKIQGYGSKLANNASGQLEWEDYFFHLIY  150



>gb|KDP25532.1| hypothetical protein JCGZ_20688 [Jatropha curcas]
Length=355

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  TV  RVE L+SSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK ++SE
Sbjct  1    MVITVAPRVESLSSSGIQSIPKEYIRPKEELTSIGNVFEEEKKEEGPQVPTIDLKEVDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D  VREKCR E  KAA +WGVMHLVNHGIS++L  RVK AGE FF QP+EEKEKYANDQA
Sbjct  61   DEVVREKCRAEFIKAAKEWGVMHLVNHGISDQLIERVKKAGEAFFDQPMEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASGQLEWEDYFFH I+
Sbjct  121  SGKIQGYGSKLANNASGQLEWEDYFFHLIY  150



>gb|AEJ90547.1| anthocyanin synthase [Solanum cardiophyllum]
Length=454

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+ +   +PSRVE LA SGI+ IPKEY+RP+EE   IG+IFE+EK   GPQVPT++LK 
Sbjct  1    MVNEVVP-IPSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEDEKKDEGPQVPTINLKE  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED E+REKC +EL+KAAV+WG MHLVNHGIS+EL  RVK AG  FF  P+EEKEKYA
Sbjct  60   IDSEDKEIREKCHQELKKAAVEWGAMHLVNHGISDELIDRVKVAGGAFFDLPVEEKEKYA  119

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQ +GNVQGYGSKLAN+A GQLEWEDYFFHC+F
Sbjct  120  NDQVSGNVQGYGSKLANSACGQLEWEDYFFHCVF  153



>sp|P51091.1|LDOX_MALDO RecName: Full=Leucoanthocyanidin dioxygenase; Short=LDOX; Short=Leucocyanidin 
oxygenase; AltName: Full=Anthocyanidin synthase; 
AltName: Full=Leucoanthocyanidin hydroxylase [Malus domestica]
 gb|AAD26205.1|AF117269_1 anthocyanidin synthase [Malus domestica]
 emb|CAA50498.1| anthocyanidin hydroxylase [Malus sp.]
 gb|ABD04052.1| anthocyanidin synthase [Malus domestica]
 gb|ACP30363.1| anthocyanidin synthase protein [Malus hybrid cultivar]
Length=357

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEYIRP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCRE+L+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  59   IESDNEKVRAKCREKLKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|AAZ79374.1| anthocyanidin synthase [Malus domestica]
Length=357

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEYIRP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCREEL+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE KEKYA
Sbjct  59   IESDNEKVRAKCREELKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIELKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>ref|XP_008374024.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Malus domestica]
Length=405

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEYIRP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  49   MVSS--DSVNSRVETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  106

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCRE+L+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  107  IESDNEKVRAKCREKLKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  166

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  167  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  200



>ref|XP_008356542.1| PREDICTED: leucoanthocyanidin dioxygenase [Malus domestica]
Length=409

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEYIRP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  53   MVSS--DSVNSRVETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  110

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCRE+L+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  111  IESDNEKVRAKCREKLKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  170

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  171  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  204



>ref|XP_008374023.1| PREDICTED: leucoanthocyanidin dioxygenase [Malus domestica]
Length=357

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEYIRP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCRE L+KAAVDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  59   IESDNEKVRAKCREXLKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>gb|AGK27790.1| anthocyanin synthase [Morus alba var. atropurpurea]
Length=358

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVERLASSGIE IP+EY+RP+EE  SIG++FEEEK   GP+VPT+DLKGINSE
Sbjct  1    MVISVAPRVERLASSGIEVIPQEYVRPQEELTSIGNVFEEEKKEEGPRVPTIDLKGINSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D   REKC+EEL+KAA  WGVMHLVNHGI +EL  RVK AGE FF  PIEEKEKYANDQA
Sbjct  61   DPVEREKCKEELKKAAAGWGVMHLVNHGIPDELIERVKKAGETFFDLPIEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G +QGYGSKLANNA GQLEWEDYFFH ++
Sbjct  121  TGKIQGYGSKLANNACGQLEWEDYFFHLVY  150



>ref|NP_001280767.1| leucoanthocyanidin dioxygenase-like [Malus domestica]
 dbj|BAB92998.1| anthocyanidin synthase [Malus domestica]
Length=357

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS+   +V SRVE LA SGI  IPKEYIRP++E  +IGDIFE+EK   GPQVPT+DLK 
Sbjct  1    MVSS--DSVNSRVETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S++ +VR KCRE+L+KA VDWGVMHLVNHGIS+EL  +V+ AG+ FF  PIE+KEKYA
Sbjct  59   IESDNEKVRAKCREKLKKATVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G +QGYGSKLANNASGQLEWEDYFFHC++
Sbjct  119  NDQASGKIQGYGSKLANNASGQLEWEDYFFHCVY  152



>ref|XP_010255605.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Nelumbo nucifera]
Length=359

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEK-IAGGPQVPTVDLKGINSEDLE  254
            V SRVE LASSGI  IPKEY+RP+EE  SI D+FE+EK I  GPQ+PTVDLK +NSED  
Sbjct  7    VASRVESLASSGIASIPKEYVRPQEELISIVDVFEDEKKIDEGPQIPTVDLKSLNSEDPA  66

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
             REKCREEL+KAA++WGVMHLVNHGIS++L  RVKAAG+ FF  PIEEKEKYANDQA+G 
Sbjct  67   EREKCREELKKAAMEWGVMHLVNHGISDDLIERVKAAGKTFFDLPIEEKEKYANDQASGK  126

Query  435  VQGYGSKLANNASGQLEWEDYFFHCIF  515
            + GYGSKLANNASGQLEWEDYFFH I+
Sbjct  127  IAGYGSKLANNASGQLEWEDYFFHLIY  153



>gb|ADD51356.1| anthocyanidin synthase [Theobroma cacao]
Length=354

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T+  P RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I+SE
Sbjct  2    VTSMAP-RVESLASSGIQSIPKEYIRPQEELTSIGNVFEEEKKEEGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EVRE+CR+EL++AA +WGVMHLVNHGIS+EL  RVK AG+ FF   +EEKEKYANDQ 
Sbjct  61   DREVRERCRQELKRAATEWGVMHLVNHGISDELMERVKKAGQKFFELSVEEKEKYANDQT  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  121  LGKIQGYGSKLANNASGQLEWEDYFFHLVY  150



>gb|AHG95986.1| anthocyanin synthase, partial [Epimedium sagittatum]
Length=360

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 2/155 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEE-KIAGGPQVPTVDLK  230
            M  TI AT  +RVE L+SSG+  IPKEY+RP+EE  SIGD+FEEE K   GPQ+P +DLK
Sbjct  1    MAPTI-ATAGTRVESLSSSGMTFIPKEYVRPQEELDSIGDVFEEERKYEEGPQIPIIDLK  59

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
            G+NSED E+RE+C EEL KAA+DWGVMH+VNHGI EEL  R++ AG+ FF  PIEEKEK+
Sbjct  60   GLNSEDKEIRERCMEELNKAAMDWGVMHIVNHGIPEELLNRLRVAGKAFFDLPIEEKEKH  119

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQ  G +QGYGSKLANNASGQLEWEDYFFH IF
Sbjct  120  ANDQVTGQIQGYGSKLANNASGQLEWEDYFFHLIF  154



>ref|XP_007040067.1| Leucoanthocyanidin dioxygenase isoform 1 [Theobroma cacao]
 gb|EOY24568.1| Leucoanthocyanidin dioxygenase isoform 1 [Theobroma cacao]
Length=379

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I+SED EVRE+
Sbjct  33   RVESLASSGIQSIPKEYIRPQEELTSIGNVFEEEKKEEGPQVPTIDLKEIDSEDREVRER  92

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            CR+EL+KAA +WGVMHLVNHGIS+EL  RVK AG+ FF   +EEKEKYANDQA G +QGY
Sbjct  93   CRQELKKAATEWGVMHLVNHGISDELMERVKKAGQKFFELSVEEKEKYANDQALGKIQGY  152

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  153  GSKLANNASGQLEWEDYFFHLVY  175



>gb|KHG30024.1| Leucoanthocyanidin dioxygenase [Gossypium arboreum]
Length=347

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            + +++  RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK  GGPQVPT+DLK I SE
Sbjct  1    MASSIAPRVESLASSGIQSIPKEYIRPKEELASIGNVFEEEK-KGGPQVPTIDLKDIESE  59

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D++VRE+C +EL+KAA++WGVMHLVNHGIS++L  RV+ AG+ FF  PIEEKEKYANDQA
Sbjct  60   DIKVRERCLQELKKAAMEWGVMHLVNHGISDQLMDRVRIAGQKFFELPIEEKEKYANDQA  119

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASG+LEW DYFFH +F
Sbjct  120  SGKIQGYGSKLANNASGKLEWIDYFFHLVF  149



>gb|AHJ80980.1| anthocyanidin synthase [Erythranthe lewisii]
Length=362

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MVS IT +   RVE LA +GI+ IP EY+RP+EE +SIGDIF EEK   GPQ+P +DL  
Sbjct  1    MVSVITPS--PRVEVLAQTGIDTIPIEYVRPKEELKSIGDIFAEEKRTDGPQLPIIDLAA  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            ++S D E R +C EEL+KAA +WGVMHLVNHG++EEL  RV+ AG GFF  P+EEKE+YA
Sbjct  59   VSSGDEEARRRCHEELKKAATEWGVMHLVNHGVAEELMDRVRNAGRGFFELPVEEKEEYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>ref|NP_001275784.1| anthocyanidin synthase [Citrus sinensis]
 gb|AAT02642.1| anthocyanidin synthase [Citrus sinensis]
Length=357

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T T   RVE LA SGI+ IPKEY+RP+EE   IG+IFEEE+   GPQVPT+DLK I+SE
Sbjct  2    VTPTA-RRVESLARSGIQAIPKEYVRPKEELMGIGNIFEEEEKDEGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D   REKCREEL+KAA+DWGVMHLVNHGIS++LT RVK AG+ FF QP+EEKEKYAN+QA
Sbjct  61   DRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASGQLEWEDYFFH I+
Sbjct  121  SGKIQGYGSKLANNASGQLEWEDYFFHLIY  150



>gb|AIL29327.1| anthocyanidin synthase [Paeonia suffruticosa]
Length=354

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE LA SGI+ IPKEY+R +EE+ SI +IFEEEK   GPQVPT+DL+ I+SE
Sbjct  1    MVNSVAPRVESLAISGIKFIPKEYVRTKEEQTSITNIFEEEKKEEGPQVPTIDLERIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D+++REKCREEL+KAA+DWGVMHLVNHGIS+EL  RVK AGE FF QP+EEKEKYANDQ 
Sbjct  61   DIKLREKCREELKKAAMDWGVMHLVNHGISDELLERVKKAGEVFFQQPVEEKEKYANDQE  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G + GYGSKLANNASGQLEWEDYFFH +F
Sbjct  121  TGKIAGYGSKLANNASGQLEWEDYFFHLVF  150



>ref|XP_010108066.1| Leucoanthocyanidin dioxygenase [Morus notabilis]
 gb|EXC17798.1| Leucoanthocyanidin dioxygenase [Morus notabilis]
Length=358

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVERLASSGIE IP+EY+RP+EE  SIG++FEEEK   GP+VPT+DLK INSE
Sbjct  1    MVISVAPRVERLASSGIEVIPQEYVRPQEELASIGNVFEEEKKEEGPRVPTIDLKSINSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D   REKC EEL+KAA +WGVMHLVNHGI +EL  RVK AGE FF  PIEEKEKYANDQA
Sbjct  61   DRVEREKCNEELKKAAAEWGVMHLVNHGIPDELIERVKKAGETFFDLPIEEKEKYANDQA  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G +QGYGSKLANNA GQLEWEDYFFH ++
Sbjct  121  TGKIQGYGSKLANNACGQLEWEDYFFHLVY  150



>dbj|BAJ08939.1| anthocyanidin synthase [Eustoma grandiflorum]
Length=362

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE +SI D+F EEK   GPQVP +D+K I SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELKSIADVFAEEKNDEGPQVPMIDIKDIESEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+CR+ L KAA++WGVMHLVNHGIS +L GRVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCRDVLNKAAMEWGVMHLVNHGISSDLIGRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>dbj|BAJ08937.1| anthocyanidin synthase [Eustoma grandiflorum]
 dbj|BAJ08938.1| anthocyanidin synthase [Eustoma grandiflorum]
Length=362

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE +SI D+F EEK   GPQVP +D+K I SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELKSIADVFAEEKNDEGPQVPMIDIKDIESEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+CR+ L KAA++WGVMHLVNHGIS +L GRVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCRDVLNKAAMEWGVMHLVNHGISSDLIGRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>ref|XP_010538776.1| PREDICTED: leucoanthocyanidin dioxygenase-like isoform X1 [Tarenaya 
hassleriana]
Length=350

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 126/154 (82%), Gaps = 6/154 (4%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+T      +RVE L +SGIE +PKEYIRP+EE  SIGDIF+EEK   GPQ+PT+DL+ 
Sbjct  1    MVAT------TRVESLVNSGIESVPKEYIRPKEELMSIGDIFQEEKNEEGPQLPTIDLQA  54

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED  VR KC EELR AA++WGVMHL+NHGI E+L  R+K +GEGFF  P+EEKEKYA
Sbjct  55   IDSEDETVRRKCMEELRNAAMEWGVMHLINHGIPEDLIERLKKSGEGFFRLPVEEKEKYA  114

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAG +QGYGSKLANNASGQLEWEDYFFH +F
Sbjct  115  NDQAAGKIQGYGSKLANNASGQLEWEDYFFHLVF  148



>ref|XP_011033842.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Populus euphratica]
Length=360

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  63   TITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
            T +  VP RVE L+SSGI+ IPKEYIRP+EE  SI D+FE+EK   GPQVPT+DLK + S
Sbjct  3    TSSFLVP-RVESLSSSGIQSIPKEYIRPQEELTSIRDVFEDEKKVEGPQVPTIDLKEMES  61

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            ED  VREKCREEL KAA +WGVMHLVNHGI ++L  RVK AG+ FF  PIEEKEK+ANDQ
Sbjct  62   EDKVVREKCREELVKAAKEWGVMHLVNHGIPDDLIDRVKKAGKAFFDLPIEEKEKHANDQ  121

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            A+GNVQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  122  ASGNVQGYGSKLANNASGQLEWEDYFFHLIF  152



>gb|ABP57081.1| anthocyanidin synthase [Solenostemon scutellarioides]
 gb|ABP57082.1| anthocyanidin synthase [Solenostemon scutellarioides]
Length=366

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+TI  +   RVE LA  G++ IPK+YIRPEEE +SIGDIF EEK   GP+VPT+DL  
Sbjct  1    MVATIAPS--PRVEELARRGLDTIPKDYIRPEEELKSIGDIFAEEKSIDGPEVPTIDLAE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+S D E R KC +EL+KAA DWGVM+++NHGI EEL  RVKAAG+ FF  P+EEKEK+A
Sbjct  59   IDSSDEERRRKCHDELKKAAEDWGVMYVINHGIPEELISRVKAAGKEFFELPVEEKEKHA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>ref|XP_010538778.1| PREDICTED: leucoanthocyanidin dioxygenase-like isoform X3 [Tarenaya 
hassleriana]
Length=361

 Score =   224 bits (572),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 126/154 (82%), Gaps = 6/154 (4%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+T      +RVE L +SGIE +PKEYIRP+EE  SIGDIF+EEK   GPQ+PT+DL+ 
Sbjct  1    MVAT------TRVESLVNSGIESVPKEYIRPKEELMSIGDIFQEEKNEEGPQLPTIDLQA  54

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+SED  VR KC EELR AA++WGVMHL+NHGI E+L  R+K +GEGFF  P+EEKEKYA
Sbjct  55   IDSEDETVRRKCMEELRNAAMEWGVMHLINHGIPEDLIERLKKSGEGFFRLPVEEKEKYA  114

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAG +QGYGSKLANNASGQLEWEDYFFH +F
Sbjct  115  NDQAAGKIQGYGSKLANNASGQLEWEDYFFHLVF  148



>gb|ABP57079.1| ANS1 [Solenostemon scutellarioides]
 gb|ABP57080.1| anthocyanidin synthase [Solenostemon scutellarioides]
Length=366

 Score =   224 bits (572),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+T+   V  RVE LA SG++ IPK+YIRPEEE +SIGDIF EEK   GP+VPT+DL  
Sbjct  1    MVATMA--VSPRVEELARSGLDTIPKDYIRPEEELKSIGDIFAEEKSMDGPEVPTIDLTE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I+S D E R KC  EL+KAA DWGVM+++NHGI EEL  RVKAAG+ FF  P+EEKEK+A
Sbjct  59   IDSSDEERRRKCHGELKKAAEDWGVMYVINHGIPEELISRVKAAGKEFFKLPVEEKEKHA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQAAGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>dbj|BAJ08927.1| anthocyanidin synthase [Eustoma grandiflorum]
Length=362

 Score =   224 bits (572),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE  SI D+F EEK   GPQVP +D+K I SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELTSIADVFAEEKNDEGPQVPMIDIKDIESEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+CR+ L KAA++WGVMHLVNHGIS +L GRVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCRDVLNKAAMEWGVMHLVNHGISSDLIGRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>dbj|BAJ08930.1| anthocyanidin synthase [Eustoma grandiflorum]
 dbj|BAJ08931.1| anthocyanidin synthase [Eustoma grandiflorum]
 dbj|BAJ08933.1| anthocyanidin synthase [Eustoma grandiflorum]
 dbj|BAJ08934.1| anthocyanidin synthase [Eustoma grandiflorum]
 dbj|BAJ08935.1| anthocyanidin synthase [Eustoma grandiflorum]
Length=362

 Score =   224 bits (572),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE  SI D+F EEK   GPQVP +D+K I SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELTSIADVFAEEKNDEGPQVPMIDIKDIESEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+CR+ L KAA++WGVMHLVNHGIS +L GRVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCRDVLNKAAMEWGVMHLVNHGISSDLIGRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>gb|AIL29326.1| anthocyanidin synthase [Paeonia rockii]
Length=354

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE LA SGI+ IPKEY+R +EE+ SI +IFEE K   GPQVPT+DLK I+SE
Sbjct  1    MVNSVAPRVESLAISGIKSIPKEYVRTKEEQTSITNIFEERKKEEGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D+++REKCREEL+KAA+DWGVMHLVNHGIS+EL  RVK AGE FF QP+EEKEKYAN+Q 
Sbjct  61   DIKLREKCREELKKAAMDWGVMHLVNHGISDELLERVKKAGEVFFQQPVEEKEKYANEQE  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G + GYGSKLANNASGQLEWEDYFFH +F
Sbjct  121  TGKIAGYGSKLANNASGQLEWEDYFFHLVF  150



>gb|AFI71900.1| anthocyanidin synthase [Paeonia lactiflora]
Length=354

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE LA+SGI+ IPKEY+R  EE+ SI +IFEEEK   GPQVPT+DLK I+SE
Sbjct  1    MVNSVAPRVESLATSGIQSIPKEYVRTIEEQTSITNIFEEEKKEEGPQVPTIDLKEIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D++VREKCREEL+KAA+DWGVMHLVNHGIS EL  +VK AGE FF Q +EEKEKYANDQ 
Sbjct  61   DIKVREKCREELKKAAMDWGVMHLVNHGISNELLEKVKKAGEVFFQQSVEEKEKYANDQE  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G + GYGSKLANNASGQLEWEDYFFH +F
Sbjct  121  TGKIAGYGSKLANNASGQLEWEDYFFHLVF  150



>dbj|BAJ08936.1| anthocyanidin synthase [Eustoma grandiflorum]
Length=362

 Score =   224 bits (572),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE  SI D+F EEK   GPQVP +D+K I SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELTSIADVFAEEKNDEGPQVPMIDIKDIESEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+CR+ L KAA++WGVMHLVNHGIS +L GRVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCRDVLNKAAMEWGVMHLVNHGISSDLIGRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>gb|AFA53722.1| anthocyanidin synthase [Vaccinium corymbosum]
Length=356

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +3

Query  81   PSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVR  260
            PSRVE LASSGI+ IPKEY+RP+EE  SIG+IFEEEK   GPQVPT+DL+ + SED E R
Sbjct  5    PSRVESLASSGIQSIPKEYVRPKEELTSIGNIFEEEKKHEGPQVPTIDLEDLVSEDKEAR  64

Query  261  EKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN--  434
            E+C E L+KAA +WGVMHLVNHG+ EEL  RV+ AGEGFF QP+EEKEKYAND   GN  
Sbjct  65   ERCHEALKKAATEWGVMHLVNHGVPEELMDRVRVAGEGFFNQPVEEKEKYANDHDTGNSG  124

Query  435  -VQGYGSKLANNASGQLEWEDYFFHCIF  515
             +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  125  KIQGYGSKLANNASGQLEWEDYFFHTVY  152



>gb|ABK96002.1| unknown [Populus trichocarpa]
Length=360

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +3

Query  63   TITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
            T +  VP RVE LASSGI+ IPKEYIRP+EE  +IG++FEE K   GPQVPT+DL  I S
Sbjct  3    TSSVLVP-RVESLASSGIKSIPKEYIRPQEELNNIGNVFEEVKNNEGPQVPTIDLMEIES  61

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            ED  VREKCREE+ KAA +WGVMHLVNHGI ++L  RV+ AG+ FF  PIEEKEKYANDQ
Sbjct  62   EDKVVREKCREEIVKAAKEWGVMHLVNHGIPDDLIDRVRKAGQAFFDLPIEEKEKYANDQ  121

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            A+GNVQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  122  ASGNVQGYGSKLANNASGQLEWEDYFFHLIF  152



>ref|XP_002298081.1| Leucoanthocyanidin dioxygenase family protein [Populus trichocarpa]
 gb|EEE82886.1| Leucoanthocyanidin dioxygenase family protein [Populus trichocarpa]
Length=360

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +3

Query  63   TITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
            T +  VP RVE LASSGI+ IPKEYIRP+EE  +IG++FEE K   GPQVPT+DL  I S
Sbjct  3    TSSVLVP-RVESLASSGIKSIPKEYIRPQEELNNIGNVFEEVKNNEGPQVPTIDLMEIES  61

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            ED  VREKCREE+ KAA +WGVMHLVNHGI ++L  RV+ AG+ FF  PIEEKEKYANDQ
Sbjct  62   EDKVVREKCREEIVKAAKEWGVMHLVNHGIPDDLIDRVRKAGQAFFDLPIEEKEKYANDQ  121

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            A+GNVQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  122  ASGNVQGYGSKLANNASGQLEWEDYFFHLIF  152



>ref|XP_006413609.1| hypothetical protein EUTSA_v10025559mg [Eutrema salsugineum]
 gb|ESQ55062.1| hypothetical protein EUTSA_v10025559mg [Eutrema salsugineum]
Length=358

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LASSGI+ IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED ++REK
Sbjct  6    RVESLASSGIKSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQDIESEDQKIREK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHLVNHG+  +L  RVK  GE FFG P+EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKAAMDWGVMHLVNHGVPVDLMERVKKTGEEFFGLPVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>ref|XP_010053365.1| PREDICTED: leucoanthocyanidin dioxygenase [Eucalyptus grandis]
 gb|KCW77644.1| hypothetical protein EUGRSUZ_D01945 [Eucalyptus grandis]
Length=353

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            + + V  RVE L+SSGI+ IP+EY+RP+EE  SIGDIFEEEK   GPQVPT+DL+ I S+
Sbjct  1    MVSVVAGRVESLSSSGIQSIPQEYVRPKEELTSIGDIFEEEKKHEGPQVPTIDLEDIASK  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D  VRE+C EELRKAA DWGVMHLVNHGI  +L  RVK AGE FF  PIEEKEK+ANDQ 
Sbjct  61   DPVVRERCHEELRKAATDWGVMHLVNHGIPNDLIERVKKAGEVFFNLPIEEKEKHANDQG  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            AG +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  121  AGKIQGYGSKLANNASGQLEWEDYFFHLVY  150



>ref|XP_011029132.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Populus euphratica]
Length=360

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +3

Query  63   TITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
            T +  VP RVE LASSGI+ IPKEYIRP+EE  +IG++FEE +   GPQVPT+DL  I S
Sbjct  3    TPSVLVP-RVESLASSGIKSIPKEYIRPQEELNNIGNVFEEVQKNEGPQVPTIDLMEIES  61

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            ED  VREKCREE+ KAA +WGVMHLVNHGI ++L  RVK AG+ FF  PIEEKEKYANDQ
Sbjct  62   EDKAVREKCREEIVKAAKEWGVMHLVNHGIPDDLIDRVKKAGQVFFDLPIEEKEKYANDQ  121

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            A+GNVQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  122  ASGNVQGYGSKLANNASGQLEWEDYFFHLIF  152



>dbj|BAJ08940.1| anthocyanidin synthase [Eustoma grandiflorum]
Length=362

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE  SI D+F EEK   GPQVP +D+K I SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELTSIADVFAEEKNDEGPQVPMIDIKDIESEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+CR+ L KAA+ WGVMHLVNHGIS +L GRVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCRDVLNKAAMGWGVMHLVNHGISSDLIGRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>gb|AHH30830.1| anthocyanin synthase [Fagopyrum dibotrys]
Length=358

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 122/150 (81%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            + +   SRVE LASSGI+ IPKEY+RPEEE  SIGD+FEEEK   GPQVPT+D+K I S+
Sbjct  1    MVSITSSRVESLASSGIQSIPKEYVRPEEELTSIGDVFEEEK-KEGPQVPTIDIKDIASD  59

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EVR K  EEL+KAA +WGVMHLVNHGI +ELT RVK AG  FF  PIEEKEKYANDQA
Sbjct  60   DKEVRAKAIEELKKAATEWGVMHLVNHGIPDELTTRVKNAGATFFELPIEEKEKYANDQA  119

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASGQLEWEDYFFH  +
Sbjct  120  SGKIQGYGSKLANNASGQLEWEDYFFHLAY  149



>dbj|BAE72879.1| anthocyanidin synthase [Verbena x hybrida]
Length=357

 Score =   222 bits (566),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            M ST+  +   RVE LA SGI+ IPKEY+RP+EE  SI D+F EE+   GPQVPT+DL  
Sbjct  1    MFSTVAPS--PRVEILAGSGIKTIPKEYVRPDEELESIRDVFAEERSIDGPQVPTIDLAE  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            INSE+ E+R+KC +EL+KA+++WGVMHL NHGI +EL  RV+ AG+GFF  P+EEKEK+A
Sbjct  59   INSENEEIRKKCHDELKKASMEWGVMHLTNHGIPDELINRVRKAGQGFFDLPVEEKEKHA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            N+Q AGNVQGYGSKLANNASGQLEWEDYFFHC+F
Sbjct  119  NNQEAGNVQGYGSKLANNASGQLEWEDYFFHCVF  152



>gb|ABY89681.1| anthocyanidin synthase 1 protein [Brassica rapa subsp. oleifera]
 gb|ABY89682.1| anthocyanidin synthase 2 protein [Brassica rapa subsp. oleifera]
 gb|ADC53481.1| anthoncyanidin synthase [Brassica rapa var. purpuraria]
Length=358

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED  +REK
Sbjct  6    RVESLAKSGISSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQDIESEDETIREK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHL+NHG+  EL  RVK +GE FFG P+EEKEKYANDQA+G +QGY
Sbjct  66   CIEELKKAAMDWGVMHLINHGVPVELMERVKKSGEEFFGLPVEEKEKYANDQASGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>dbj|BAJ08932.1| anthocyanidin synthase [Eustoma grandiflorum]
Length=362

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE  SI D+F EEK   GPQVP +D+K   SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELTSIADVFAEEKNDEGPQVPMIDIKDXESEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+CR+ L KAA++WGVMHLVNHGIS +L GRVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCRDVLNKAAMEWGVMHLVNHGISSDLIGRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>dbj|BAJ08928.1| anthocyanidin synthase [Eustoma grandiflorum]
Length=362

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE  SI D+F EEK   GPQVP +D+K I+S D+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELTSIADVFAEEKNDEGPQVPMIDIKDIDSADISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+C + L KAA++WGVMHLVNHGIS +L GRVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCHDVLNKAAIEWGVMHLVNHGISSDLIGRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>gb|AAB82287.1| anthocyanidin synthase [Matthiola incana]
Length=356

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI+ IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED E REK
Sbjct  6    RVESLAESGIKSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQNIESEDEETREK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHL+NHGI  +L  RVK +G+ FFG P+EEKEKYANDQA+G +QGY
Sbjct  66   CVEELKKAALDWGVMHLINHGIPVDLMERVKKSGQEFFGLPVEEKEKYANDQASGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>dbj|BAJ08929.2| anthocyanidin synthase [Eustoma grandiflorum]
Length=362

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE  SI D+F EEK   GPQVP +D+K I SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELTSIADVFAEEKNDEGPQVPMIDIKDIESEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+CR+ L KAA++WGVMHLVNHGIS +L  RVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCRDVLNKAAMEWGVMHLVNHGISSDLIRRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>dbj|BAD34462.1| leucoanthocyanidin dioxygenase [Eustoma grandiflorum]
Length=362

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE  SI D+F EEK   GPQVP +D+K I SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELTSIADVFAEEKNDEGPQVPMIDIKDIESEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            RE+CR+ L KAA++WGVMHLVNHGIS +L  RVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RERCRDVLNKAAMEWGVMHLVNHGISSDLIRRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>ref|XP_009136276.1| PREDICTED: leucoanthocyanidin dioxygenase [Brassica rapa]
Length=358

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IP+EYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED  +REK
Sbjct  6    RVESLAKSGISSIPREYIRPKEELESINDVFQEEKKEDGPQVPTIDLQDIESEDETIREK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHL+NHGI  EL  RVK +GE FFG P+EEKEKYANDQA+G +QGY
Sbjct  66   CIEELKKAAMDWGVMHLINHGIPVELMERVKKSGEEFFGLPVEEKEKYANDQASGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>gb|AAV88087.1| anthocyanidin synthase [Camellia sinensis]
Length=354

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T     RV+ LA+SGIE IPKEY+RP+EE   IG+IFEEEK   GPQVPT+DLK I+SE
Sbjct  1    MTTVAAPRVQSLATSGIESIPKEYVRPKEELTGIGNIFEEEKNEEGPQVPTIDLKDIDSE  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
              EVRE+CRE L+KAAVDWGVMHLVNHGI++++  RVK AGEGFF QP+EEKEKYAND  
Sbjct  61   VEEVRERCREALKKAAVDWGVMHLVNHGIADDVRERVKVAGEGFFEQPVEEKEKYANDPD  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             GN+QGYGSKLANNA GQ EWEDYFFH  +
Sbjct  121  NGNLQGYGSKLANNACGQFEWEDYFFHLAY  150



>gb|ACH58397.1| anthocyanidin synthase [Brassica juncea]
 gb|ACH58398.1| anthocyanidin synthase [Brassica juncea]
 emb|CDY41286.1| BnaA01g12530D [Brassica napus]
Length=358

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IP+EYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED  +REK
Sbjct  6    RVESLAKSGISSIPREYIRPKEELESINDVFQEEKKEDGPQVPTIDLQDIESEDETIREK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHL+NHGI  EL  RVK +GE FFG P+EEKEKYANDQA+G +QGY
Sbjct  66   CIEELKKAAMDWGVMHLINHGIPVELMERVKKSGEEFFGLPVEEKEKYANDQASGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>ref|XP_003611189.1| Leucoanthocyanidin dioxygenase [Medicago truncatula]
 gb|ABU40983.1| anthocyanidin synthase [Medicago truncatula]
 gb|AES94147.1| leucoanthocyanidin dioxygenase-like protein [Medicago truncatula]
Length=356

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            TV  RVE LA SGI  IPKEY+RP+EE  +IG+IF+EEK   GPQVPT+DLK INS D  
Sbjct  3    TVAQRVESLALSGISSIPKEYVRPKEELANIGNIFDEEK-KEGPQVPTIDLKEINSSDEI  61

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VR KCRE+L+KAA +WGVMHLVNHGIS++L  R+K AGE FF  P+EEKEKYANDQ++G 
Sbjct  62   VRGKCREKLKKAAEEWGVMHLVNHGISDDLINRLKKAGETFFELPVEEKEKYANDQSSGK  121

Query  435  VQGYGSKLANNASGQLEWEDYFFHCIF  515
            +QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  122  IQGYGSKLANNASGQLEWEDYFFHCIF  148



>ref|XP_009137289.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Brassica rapa]
Length=367

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA+SGI+ IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED  +RE+
Sbjct  6    RVENLANSGIKSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQNIESEDETIREQ  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHL+NHG+  +L  RVK AGE FFG P+EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKAAMDWGVMHLINHGVPVDLMERVKKAGEEFFGLPVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>gb|AAO73440.1| anthocyanidin synthase [Brassica oleracea var. capitata]
 emb|CDY10816.1| BnaC01g14310D [Brassica napus]
Length=358

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED  +REK
Sbjct  6    RVESLAKSGINSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQDIESEDETIREK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHL+NHG+  EL  RVK +GE FFG P+EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKAAMDWGVMHLINHGVPVELMERVKKSGEEFFGLPVEEKEKYANDQAKGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>gb|ADK37750.1| anthocyanidin synthase [Brassica oleracea var. alboglabra]
Length=358

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED  +REK
Sbjct  6    RVESLAKSGINSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQDIESEDETIREK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHL+NHG+  EL  RVK +GE FFG P+EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKAAMDWGVMHLINHGVPVELMERVKKSGEEFFGLPVEEKEKYANDQAKGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>ref|XP_010676602.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Beta vulgaris 
subsp. vulgaris]
Length=359

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  66   ITATV-PSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
            +TAT+  SRVE LASSG++ IPKEY+RP+EE  SIG++FEEE+   G QVPT+D+K I S
Sbjct  1    MTATIASSRVETLASSGMQSIPKEYVRPKEELISIGNVFEEEQKDEGSQVPTIDIKNIAS  60

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            EDLEVR+K   EL++AA++WGVMHLVNHGIS+EL  RVK AGE FF  PI EKEKYANDQ
Sbjct  61   EDLEVRDKAIHELKRAAMEWGVMHLVNHGISDELIDRVKVAGEAFFELPIAEKEKYANDQ  120

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            A+GNVQGYGSKLAN+ SGQLEWEDYFFH  F
Sbjct  121  ASGNVQGYGSKLANSVSGQLEWEDYFFHLSF  151



>sp|O04274.1|LDOX_PERFR RecName: Full=Leucoanthocyanidin dioxygenase; Short=LDOX; Short=Leucocyanidin 
oxygenase; AltName: Full=Leucoanthocyanidin 
hydroxylase [Perilla frutescens]
 dbj|BAA20143.1| leucoanthocyanidin dioxygenase [Perilla frutescens]
Length=362

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSI-GDIFEEEKIAGGPQVPTVDLK  230
            MV++     P RVE LA SG++ IPK+Y+RPEEE +SI G+I  EEK + GPQ+PT+DL+
Sbjct  1    MVTSAMGPSP-RVEELARSGLDTIPKDYVRPEEELKSIIGNILAEEKSSEGPQLPTIDLE  59

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
             ++S D E R+KC EEL+KAA DWGVMHL+NHGI EEL  RVKAAG+ FF  P+EEKE Y
Sbjct  60   EMDSRDEEGRKKCHEELKKAATDWGVMHLINHGIPEELIDRVKAAGKEFFELPVEEKEAY  119

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHC++
Sbjct  120  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVY  154



>gb|KJB51990.1| hypothetical protein B456_008G242100 [Gossypium raimondii]
Length=334

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            + +++  RVE LASSGI+ IPKEYIRP+EE  SIG++FEEEK  GGPQVPT+DLK I SE
Sbjct  1    MMSSIAPRVESLASSGIQSIPKEYIRPKEELESIGNVFEEEK-KGGPQVPTIDLKDIESE  59

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D++VRE+C +EL+K A+ WGVMHLVNHGIS++L  RV+  G+ FF  PIEEKEKYANDQA
Sbjct  60   DIKVRERCLQELKKTAMGWGVMHLVNHGISDQLMDRVRITGQKFFELPIEEKEKYANDQA  119

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYG+KLAN++SGQLEW DYFFH +F
Sbjct  120  SGKIQGYGNKLANSSSGQLEWIDYFFHLVF  149



>gb|ACM62747.1| leucoanthocyanidin dioxygenase [Garcinia mangostana]
Length=354

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 125/150 (83%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE LASSGI+ IPKEYIRP+EE  ++G+IFE+EK   GPQVPT+DL+GI SE
Sbjct  1    MVTSVAPRVETLASSGIQCIPKEYIRPQEELTNLGNIFEQEK-KEGPQVPTIDLEGIVSE  59

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EVR+KC +EL KAA +WGVMHLVNHGIS ELT +VK AGE FF  PIEEKEKYANDQ 
Sbjct  60   DKEVRDKCWDELMKAAKEWGVMHLVNHGISNELTEKVKIAGEAFFQLPIEEKEKYANDQG  119

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASG+LEWEDYFFH +F
Sbjct  120  SGMIQGYGSKLANNASGRLEWEDYFFHLVF  149



>ref|XP_010255604.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Nelumbo nucifera]
Length=358

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +3

Query  69   TATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAG-GPQVPTVDLKGINSE  245
            +A V SRVE LASSGI  IPKEY+RP+EE  +I ++FE+EK    GPQ+PTVDLKG+NSE
Sbjct  4    SAAVASRVESLASSGIASIPKEYVRPQEELINIVNVFEDEKKTDEGPQIPTVDLKGLNSE  63

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D   REKCREEL+KA++DWGVMHLVNHGI ++L  +VKAAG+ FF  PIEEKEK+ANDQA
Sbjct  64   DPAEREKCREELKKASMDWGVMHLVNHGIPDDLIDQVKAAGKIFFDLPIEEKEKHANDQA  123

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G + GYGSKLANNASGQLEW+DYFFH I+
Sbjct  124  SGKIAGYGSKLANNASGQLEWQDYFFHLIY  153



>dbj|BAJ08925.1| anthocyanidin synthase [Eustoma grandiflorum]
 dbj|BAJ08926.1| anthocyanidin synthase [Eustoma exaltatum subsp. russellianum]
Length=371

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            V  RVE LA SG + IPKEY+R +EE  SI D+F EEK   GPQVP +D+K I+SED+ V
Sbjct  5    VVPRVESLARSGTQEIPKEYVRTKEELTSIADVFAEEKNDEGPQVPMIDIKDIDSEDISV  64

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            R++C + L KAA++WGVMHLVNHGIS +L  RVK+AG+ FF  P+EEKEKYANDQA+GNV
Sbjct  65   RQRCHDVLNKAAMEWGVMHLVNHGISSDLIRRVKSAGQAFFDLPVEEKEKYANDQASGNV  124

Query  438  QGYGSKLANNASGQLEWEDYFFHCIF  515
            QGYGSKLANNASGQLEWEDYFFHCIF
Sbjct  125  QGYGSKLANNASGQLEWEDYFFHCIF  150



>emb|CEL26656.1| anthocyanidin synthase [Ribes nigrum]
Length=357

 Score =   219 bits (559),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +3

Query  63   TITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
            T++   P RVE L+SSGI+ IPKEY+R +EE  SI +IFEEEK   GPQVPT+DLK INS
Sbjct  3    TVSEAAP-RVEALSSSGIKSIPKEYVRTKEELISITNIFEEEKKEEGPQVPTIDLKDINS  61

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            +D  VR KCR++L++AA++WGVMHLVNHGIS+EL  RVK AGE FF QPIEEKEKYAN Q
Sbjct  62   DDEFVRNKCRQQLKEAAIEWGVMHLVNHGISDELIERVKIAGEAFFNQPIEEKEKYANKQ  121

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             +G +QGYGSKLANNA GQLEWEDYFFH IF
Sbjct  122  ESGMIQGYGSKLANNACGQLEWEDYFFHLIF  152



>emb|CDX94133.1| BnaC07g37670D [Brassica napus]
Length=358

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI+ IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED  VR++
Sbjct  6    RVENLAKSGIKSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQNIESEDETVRDQ  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+K A+DWGVMHL+NHG+  +L  RVK AGE FFG P+EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKVAMDWGVMHLINHGVPVDLMERVKKAGEEFFGLPVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>gb|AHW81902.1| anthocyanin synthase, partial [Morus alba var. atropurpurea]
 gb|AHW81903.1| anthocyanin synthase, partial [Morus alba var. atropurpurea]
Length=326

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +3

Query  99   LASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREE  278
            LASSGIE IP+EY+RP+EE  SIG++FEEEK   GP+VPT+DLKGINSED   REKC+EE
Sbjct  1    LASSGIEVIPQEYVRPQEELTSIGNVFEEEKKEEGPRVPTIDLKGINSEDPVEREKCKEE  60

Query  279  LRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKL  458
            L+KAA  WGVMHLVNHGI +EL  RVK AGE FF  PIEEKEKYANDQA G +QGYGSKL
Sbjct  61   LKKAAAGWGVMHLVNHGIPDELIERVKKAGETFFDLPIEEKEKYANDQATGKIQGYGSKL  120

Query  459  ANNASGQLEWEDYFFHCIF  515
            ANNA GQLEWEDYFFH ++
Sbjct  121  ANNACGQLEWEDYFFHLVY  139



>gb|AIM48928.1| anthocyanidin synthase [Raphanus sativus]
Length=359

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGIE IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I S+D  +R K
Sbjct  6    RVESLAKSGIESIPKEYIRPKEELESINDVFQEEKKQDGPQVPTIDLQNIESKDETIRGK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHL+NHG+  EL  RVK AGE FFG  +EEKEKYANDQAAG +QGY
Sbjct  66   CMEELKKAAMDWGVMHLINHGVPVELMERVKKAGEEFFGLNVEEKEKYANDQAAGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>gb|AAY15745.1| anthocyanidin synthase [Gerbera hybrid cultivar]
Length=355

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   TITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
             I AT  +RVE L++SGI +IPKEYIRP+EE RSI +IF+EE     PQVPTVDL  I S
Sbjct  2    VIQAT--TRVESLSTSGIHQIPKEYIRPQEELRSITNIFDEETNKQKPQVPTVDLTDIES  59

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            +D E R KC EEL+KAA++WGVMH+VNHG+S +L GRVKAAGEGFFG P+EEKEKY ND 
Sbjct  60   DDPEKRHKCSEELKKAAMEWGVMHVVNHGVSGDLIGRVKAAGEGFFGLPVEEKEKYGNDP  119

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
              G +QGYGSKLANNASGQLEWEDYFFH +F
Sbjct  120  DGGRIQGYGSKLANNASGQLEWEDYFFHLVF  150



>gb|AAY15743.2| anthocyanidin synthase [Gerbera hybrid cultivar]
Length=355

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   TITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
             I AT  +RVE L++SGI +IPKEYIRP+EE RSI +IF+EE     PQVPTVDL  I S
Sbjct  2    VIQAT--TRVESLSTSGIRQIPKEYIRPQEELRSITNIFDEETNKQKPQVPTVDLTDIES  59

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            +D E R KC EEL+KAA++WGVMH+VNHGIS +L GRVKAAGEGFFG P+EEKEKY ND 
Sbjct  60   DDPEKRHKCLEELKKAAMEWGVMHVVNHGISGDLIGRVKAAGEGFFGLPVEEKEKYGNDP  119

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
              G +QGYGSKLANNASGQLEWEDYFFH +F
Sbjct  120  DGGRIQGYGSKLANNASGQLEWEDYFFHLVF  150



>gb|ADT63066.1| anthocyanidin synthase [Fagopyrum esculentum]
Length=358

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 122/150 (81%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            + +   SRVE LASSGI+ IPKEY+RPEEE  SIG++FEEEK   GPQVPT+D+K I S+
Sbjct  1    MVSITSSRVESLASSGIQSIPKEYVRPEEELTSIGNVFEEEK-KEGPQVPTIDIKDIASD  59

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D EVR K  E L+KAA++WGVMHLVNHGI +ELT RVK AG  FF  PIEEKEKYANDQA
Sbjct  60   DKEVRAKAIETLKKAAMEWGVMHLVNHGIPDELTTRVKNAGATFFELPIEEKEKYANDQA  119

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGS+LANNASGQLEWEDYFFH  +
Sbjct  120  SGKIQGYGSRLANNASGQLEWEDYFFHLAY  149



>emb|CDX98776.1| BnaA03g45610D [Brassica napus]
Length=393

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA+SGI+ IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED  VREK
Sbjct  6    RVENLANSGIKSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQNIESEDETVREK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHLVNHG+  +L  RVK AGE FFG  +EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASMDWGVMHLVNHGVPVDLMERVKKAGEEFFGLSVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>dbj|BAP92907.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92909.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92910.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92911.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92912.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92913.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92914.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92917.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92919.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   210 bits (535),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTXGPQVPTIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKERYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>emb|CAA73094.1| anthocyanidin synthase [Forsythia x intermedia]
Length=354

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +   V  RVE LAS+GI+ IPKEY+RP+EE  SI D+FEEE    GPQ+PT+DL+G++S+
Sbjct  1    MAKVVNPRVEILASNGIQSIPKEYVRPQEELESIRDVFEEEMSDEGPQLPTIDLEGLDSD  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D +VREKC +EL KA+ +WGVMHLV HGIS+EL  RVK AG+ FF Q + EKEKYANDQA
Sbjct  61   DKQVREKCHQELIKASKEWGVMHLVKHGISDELIDRVKMAGKAFFNQSV-EKEKYANDQA  119

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +GNVQGYGSKLANNASGQLEW+DYFFHCIF
Sbjct  120  SGNVQGYGSKLANNASGQLEWQDYFFHCIF  149



>dbj|BAE54521.1| anthocyanidin synthase [Phytolacca americana]
Length=358

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  81   PSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVR  260
            PSRVE LA+SGI+ IPKEY+RP+EE  SIG++FEEE   GGPQVPT+D++ I S+D EVR
Sbjct  7    PSRVETLATSGIQSIPKEYVRPKEELTSIGNVFEEEMKDGGPQVPTIDIRDIASDDREVR  66

Query  261  EKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQ  440
            ++   EL +AA++WGVMHL+NHGI  EL  RVKA G  FF  PIEEKEKYANDQA GNVQ
Sbjct  67   DRAILELNRAAMEWGVMHLINHGIPNELIDRVKAVGGAFFELPIEEKEKYANDQATGNVQ  126

Query  441  GYGSKLANNASGQLEWEDYFFHCIF  515
            GYGSKLA NASGQLEWEDYFFH IF
Sbjct  127  GYGSKLAENASGQLEWEDYFFHLIF  151



>dbj|BAP92886.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92887.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92888.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92889.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92890.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92891.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92892.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92893.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92894.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92895.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92896.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92897.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92898.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92899.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92900.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92937.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92938.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92939.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92940.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92941.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92942.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92943.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92944.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92946.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92947.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92948.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92949.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92950.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92951.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92952.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92953.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92954.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92955.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92956.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92957.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92958.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92959.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92960.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92961.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92962.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92963.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92964.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92965.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92966.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92967.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92968.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92975.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92976.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92977.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92978.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92979.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92980.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92981.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP92982.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
Length=134

 Score =   210 bits (534),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPTIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKEQYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>dbj|BAP92908.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92915.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92916.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92921.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92922.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92923.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92924.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92925.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92926.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92927.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92928.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   209 bits (533),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPTIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKERYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>dbj|BAP92905.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92918.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92929.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92930.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92931.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92932.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92933.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92935.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   209 bits (533),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTLGPQVPTIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKERYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>gb|AAY15744.1| anthocyanidin synthase [Gerbera hybrid cultivar]
Length=355

 Score =   216 bits (551),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 121/151 (80%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   TITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
             I AT  +RVE L++SGI +IPKEYIRP+EE RSI +IF+EE     PQVPTVDL  I S
Sbjct  2    VIQAT--TRVESLSTSGIHQIPKEYIRPQEELRSITNIFDEEANKQKPQVPTVDLTDIES  59

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            +D E R KC EEL+KAA++WGVMH+VNHG+S +L GRVKAAGEGFFG P+EEKEKY ND 
Sbjct  60   DDPEKRHKCLEELKKAAMEWGVMHVVNHGVSGDLIGRVKAAGEGFFGLPVEEKEKYGNDP  119

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
              G  QGYGSKLANNASGQLEWEDYFFH +F
Sbjct  120  DGGRTQGYGSKLANNASGQLEWEDYFFHLVF  150



>ref|XP_006283819.1| hypothetical protein CARUB_v10004921mg [Capsella rubella]
 gb|EOA16717.1| hypothetical protein CARUB_v10004921mg [Capsella rubella]
Length=416

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DLK I SED ++RE 
Sbjct  6    RVETLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESEDQKIRES  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHLVNHGI  +L  RVK AGE FF  P+EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASLDWGVMHLVNHGIPVDLMERVKKAGEEFFELPVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH ++
Sbjct  126  GSKLANNASGQLEWEDYFFHLVY  148



>dbj|BAP92901.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92903.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   209 bits (531),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPTIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAA+DWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAMDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKERYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>dbj|BAJ21536.1| anthocyanidin synthase [Dahlia pinnata]
Length=355

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +  +RVE LA SGI++IPKEYIRP+ ER +I D+F +E     PQVPT+DL  INS 
Sbjct  1    MVTSTDTRVETLAKSGIQQIPKEYIRPQHERTTITDVFHQEPNQQCPQVPTIDLNDINST  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D + R+KCR+E+ KAA +WGVMHLVNHGIS++L  RVKAAGEGFF QP+EEKEKY ND  
Sbjct  61   DPKTRDKCRDEIVKAATEWGVMHLVNHGISDDLINRVKAAGEGFFDQPVEEKEKYCNDIG  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLAN A GQLEWEDYFFH +F
Sbjct  121  SGKIQGYGSKLANTACGQLEWEDYFFHLVF  150



>gb|AEF14411.1| anthocyanidin synthase [Onobrychis viciifolia]
Length=359

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            T+  RVE L+ SGI+ IPKEY+RP+EE  +IG+IFEEEK   GP+VPT+DLK I S+D  
Sbjct  3    TLAQRVESLSDSGIQSIPKEYVRPKEELANIGNIFEEEK-KEGPEVPTIDLKEIESKDEL  61

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VR KCRE+LRKAA +WGVMHLVNHGI +EL  R+K AG  FF  P+EEKEKYANDQA GN
Sbjct  62   VRGKCREKLRKAAEEWGVMHLVNHGIPDELLNRLKEAGAEFFSLPVEEKEKYANDQATGN  121

Query  435  VQGYGSKLANNASGQLEWEDYFFHCIF  515
            VQGYGSKLANNASGQLEWEDYFFH IF
Sbjct  122  VQGYGSKLANNASGQLEWEDYFFHLIF  148



>dbj|BAP92902.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92904.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92906.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92936.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   207 bits (528),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPTIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAA DWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAXDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKERYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>dbj|BAP92934.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   207 bits (528),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTLGPQVPTIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAA DWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAXDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKERYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>dbj|BAP92945.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
Length=134

 Score =   207 bits (528),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  + GDIFE+EK   GPQVPT+DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINXGDIFEDEKSTVGPQVPTIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKEQYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>dbj|BAP92877.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92971.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   207 bits (528),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPIIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKERYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>gb|AIZ70322.1| anthocyanidin synthase [Dahlia pinnata]
Length=355

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +  +RVE LA SGI +IPKEYIRP+ ER +I D+F +E     PQVPT+DL  INS 
Sbjct  1    MVTSTDTRVETLAKSGINQIPKEYIRPQHERTTITDVFHQEPNQQCPQVPTIDLNDINST  60

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
            D + R+KCR+E+ KAA +WGVMHLVNHGIS++L  RVKAAGEGFF QP+EEKEKY ND  
Sbjct  61   DPKTRDKCRDEIVKAATEWGVMHLVNHGISDDLINRVKAAGEGFFDQPVEEKEKYCNDIG  120

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             G +QGYGSKLAN A GQLEWEDYFFH +F
Sbjct  121  LGKIQGYGSKLANTACGQLEWEDYFFHLVF  150



>gb|AGI16383.1| anthocyanidin synthase [Ribes nigrum]
Length=357

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 122/151 (81%), Gaps = 1/151 (1%)
 Frame = +3

Query  63   TITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
            T++   P RVE L+SSGI+ IPKEY+R +EE  SI +IFEEEK   GPQVPT+DLK INS
Sbjct  3    TVSEAAP-RVEALSSSGIKSIPKEYVRTKEELISITNIFEEEKKEEGPQVPTIDLKDINS  61

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            +D  VR KCR++L++AA++WGVMHLVNHGIS+EL   VK AGE FF QPIEEKEKYAN Q
Sbjct  62   DDEFVRNKCRQQLKEAAIEWGVMHLVNHGISDELIEHVKIAGEAFFNQPIEEKEKYANKQ  121

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
             +G +QGYGSK ANNA GQLEWEDYFFH IF
Sbjct  122  ESGMIQGYGSKPANNACGQLEWEDYFFHLIF  152



>gb|ABU88895.1| anthocyanidin synthase [Prunus cerasifera]
Length=293

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  123  IPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAAVDW  302
            IPKEYIRP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE+ +VRE+CREEL+K AVDW
Sbjct  3    IPKEYIRPKEELVNIGDIFEQEKSNDGPQVPTIDLKEIDSENEKVRERCREELKKVAVDW  62

Query  303  GVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNASGQL  482
            GVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KEKYANDQA+G +QGYGSKLANNASGQL
Sbjct  63   GVMHLVNHGISDELMDRVRKAGKAFFDLPIEQKEKYANDQASGKIQGYGSKLANNASGQL  122

Query  483  EWEDYFFHCIF  515
            EWEDYFFH ++
Sbjct  123  EWEDYFFHLVY  133



>dbj|BAP92920.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   207 bits (526),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPXIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKEXYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>dbj|BAP92884.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92885.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92969.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92970.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92972.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92973.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   206 bits (525),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPIIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ +G+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNSGQAFFDLPIEQKERYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>dbj|BAE54520.1| anthocyanidin synthase [Spinacia oleracea]
Length=352

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +3

Query  66   ITATV-PSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINS  242
            +TAT+ PSRVE LASSGIE IPKEY+R  EE  S+G++FEEEK   G Q+PT+D+K I S
Sbjct  1    MTATIAPSRVESLASSGIESIPKEYVRLNEELTSMGNVFEEEKKDDGYQIPTIDIKDIAS  60

Query  243  EDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQ  422
            +D EVR+K  +EL++AA++WGVMHLVN+GIS+EL  RVK AGE FF  P+EEKEKYANDQ
Sbjct  61   KDQEVRDKAIQELKRAAMEWGVMHLVNYGISDELIHRVKVAGETFFELPVEEKEKYANDQ  120

Query  423  AAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            A+GN+QGYGSKLAN+ASG+LEWEDY+FH  F
Sbjct  121  ASGNLQGYGSKLANSASGRLEWEDYYFHLCF  151



>ref|XP_002867745.1| hypothetical protein ARALYDRAFT_492580 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44004.1| hypothetical protein ARALYDRAFT_492580 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DL+ I S+D ++RE 
Sbjct  6    RVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLQNIESDDEKIRET  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KAA+DWGVMHL+NHGIS +L  RVK AGE FFG  +EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKAALDWGVMHLINHGISVDLMERVKKAGEEFFGLSVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNA GQLEWEDYFFH ++
Sbjct  126  GSKLANNACGQLEWEDYFFHLVY  148



>gb|AHZ31754.1| anthocyanidin synthase [Viola x wittrockiana]
Length=406

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 123/156 (79%), Gaps = 7/156 (4%)
 Frame = +3

Query  69   TATVP-------SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDL  227
            TAT P       SRVE LA+SGI+ IPKEY+RP+EE  SIGDIF+EEK   GPQ+PT+DL
Sbjct  4    TATDPPSIDNSKSRVEILANSGIKSIPKEYVRPQEELTSIGDIFDEEKREDGPQIPTIDL  63

Query  228  KGINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEK  407
            K I+SED  VREKC E L +AA +WGVMH+VNHGI + L  RVK AG+GFF  PIEEKE 
Sbjct  64   KDISSEDQIVREKCIEGLVEAAKEWGVMHIVNHGIPDNLIDRVKEAGKGFFELPIEEKEI  123

Query  408  YANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +ANDQA G +QGYGSKLANNASGQLEWEDYFFH IF
Sbjct  124  HANDQATGKIQGYGSKLANNASGQLEWEDYFFHLIF  159



>dbj|BAN63164.1| anthocyanidin synthase [Diospyros kaki]
Length=360

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            M+ST+ A   SRVE LASSGI+ IP+EY+RP+EE  SIG++FEEEK   GPQVPT+DLK 
Sbjct  1    MMSTVAAPS-SRVESLASSGIQAIPREYVRPKEELASIGNVFEEEKKDEGPQVPTIDLKD  59

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            + +ED + R++C   L+KA+++WGVMHLVNHGIS+EL  RVKAAG+ FF  P+EEKEKYA
Sbjct  60   LEAEDEKARQRCHHALKKASMEWGVMHLVNHGISDELINRVKAAGDAFFNLPVEEKEKYA  119

Query  414  NDQAA---GNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ND  +   G +QGYGSKLANNASGQ EWEDYFFH  F
Sbjct  120  NDHDSNYTGKIQGYGSKLANNASGQREWEDYFFHLAF  156



>dbj|BAP92878.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92879.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92880.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92881.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92882.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP92883.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   206 bits (523),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPIIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+  G+ FF  PIE+KE+YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNXGQAFFDLPIEQKERYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>ref|XP_010448813.1| PREDICTED: leucoanthocyanidin dioxygenase [Camelina sativa]
Length=356

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DL+ I SED ++RE 
Sbjct  6    RVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLQNIESEDPKIRES  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHL+NHGI  EL  RVK AGE FF  P+EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASLDWGVMHLINHGIPVELMERVKKAGEEFFSLPVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNA GQLEWEDYFFH  +
Sbjct  126  GSKLANNACGQLEWEDYFFHLAY  148



>dbj|BAP93851.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP93852.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP93853.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP93854.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP93855.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP93856.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP93857.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP93858.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus grayanus]
 dbj|BAP93859.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93860.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93861.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93862.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93863.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93864.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93865.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93866.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93867.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93868.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93870.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93871.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93873.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93878.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93879.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93880.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93897.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93898.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93899.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93900.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93901.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93902.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93903.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93904.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93905.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93906.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93908.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93909.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93910.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93911.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93914.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93918.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
Length=131

 Score =   205 bits (522),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            + SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVPT+DLK I+SE ++V
Sbjct  1    IGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPTIDLKDIDSEVIQV  60

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            REKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN+
Sbjct  61   REKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKEQYANDQASGNI  120

Query  438  QGYGSKLANNA  470
            QGYGSKLANNA
Sbjct  121  QGYGSKLANNA  131



>gb|AGV53047.1| leucoanthocyanidin dioxygenase [Actinidia chinensis]
Length=355

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 3/154 (2%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+T+  T   RVE LASSGIE IPKEY+RP+EE  SIG+IFEE K   GPQVPT+DL+ 
Sbjct  1    MVATVVGT---RVESLASSGIEAIPKEYVRPQEELTSIGNIFEEGKKENGPQVPTIDLED  57

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            +  ED E R +C EEL++AA +WGVM +VNHGI  EL  RV+AAG  FF Q +EEKEKYA
Sbjct  58   LVPEDEEKRVRCHEELKRAATEWGVMQVVNHGIPIELMERVRAAGAEFFNQSVEEKEKYA  117

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ND A+GN+QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  118  NDHASGNIQGYGSKLANNASGQLEWEDYFFHLVY  151



>gb|KFK39258.1| hypothetical protein AALP_AA3G220900 [Arabis alpina]
Length=358

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI+ IPKEYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED ++REK
Sbjct  6    RVESLAMSGIKSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQNIESEDEKIREK  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C ++L+KAA+DWGVMHL+NHGIS +L  RVK +G  FFG  +EEKEKYAN+QA+G +QGY
Sbjct  66   CVDDLKKAALDWGVMHLINHGISIDLMERVKKSGAEFFGLAVEEKEKYANNQASGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH  +
Sbjct  126  GSKLANNASGQLEWEDYFFHLAY  148



>gb|ACA04011.1| anthocyanidin synthase, partial [Diplacus aurantiacus]
Length=279

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  123  IPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAAVDW  302
            IP +YIRPE+E +SIGDIF EEK   GPQ+PT+DL  I SED E R+KC +EL+KAA++W
Sbjct  1    IPPDYIRPEQELKSIGDIFTEEKSIDGPQLPTIDLAAITSEDEETRKKCHDELKKAAIEW  60

Query  303  GVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNASGQL  482
            GVMH++NHG+  ELT RVK AG  FF  P+EEKEKYANDQA GNVQGYGSKLANNASGQL
Sbjct  61   GVMHIINHGVPGELTDRVKNAGREFFELPVEEKEKYANDQATGNVQGYGSKLANNASGQL  120

Query  483  EWEDYFFHCIF  515
            EWEDYFFHC+F
Sbjct  121  EWEDYFFHCVF  131



>gb|ACB56922.1| anthocyanidin synthase [Pilosella officinarum]
Length=355

 Score =   212 bits (540),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            +RVE L+ SGI  IPKEYIRP++E  +I +I +E     GPQVPT+DL  INS+D +  E
Sbjct  7    TRVESLSKSGIHEIPKEYIRPQDELPTITNILDEVSTDQGPQVPTIDLNDINSDDPKTLE  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
             CR E  KAA +WGVMHLVNHGIS++L  RVKAAGE FFGQPIEEKEK++ND A+G +QG
Sbjct  67   NCRNEFIKAATEWGVMHLVNHGISDDLIARVKAAGESFFGQPIEEKEKHSNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNASGQLEWEDYFFH +F
Sbjct  127  YGSKLANNASGQLEWEDYFFHTVF  150



>ref|XP_004511625.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Cicer arietinum]
Length=353

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE L+ SGIE IPKEY+RP+EE  +IG+IFEEEK   GP+VPT+DLK INS D  VR K
Sbjct  8    RVESLSLSGIESIPKEYVRPKEELTNIGNIFEEEK-KEGPEVPTIDLKEINSSDELVRRK  66

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            CRE+L+KAA +WGVMHLVNHGIS +L  R+K  GE FFG  ++EKEKYANDQ+ G +QGY
Sbjct  67   CREKLKKAAEEWGVMHLVNHGISHDLINRLKKVGETFFGLSVDEKEKYANDQSCGKIQGY  126

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH IF
Sbjct  127  GSKLANNASGQLEWEDYFFHLIF  149



>dbj|BAP92974.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=134

 Score =   204 bits (520),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            ++ SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++
Sbjct  1    SIGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPXIDLKDIDSEVIQ  60

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VREKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+  G+ FF  PIE+KE YANDQA+GN
Sbjct  61   VREKCREELKKAAVDWGVMHLVNHGISDELMDRVRNXGQAFFDLPIEQKEXYANDQASGN  120

Query  435  VQGYGSKLANNASG  476
            +QGYGSKLANNASG
Sbjct  121  IQGYGSKLANNASG  134



>dbj|BAC75819.1| mutant protein of leucoanthocyanidin dioxygenase [Arabidopsis 
thaliana]
Length=325

 Score =   211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DLK I S+D ++RE 
Sbjct  6    RVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIREN  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHL+NHGI  +L  RVK AGE FF   +EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH  +
Sbjct  126  GSKLANNASGQLEWEDYFFHLAY  148



>ref|NP_001240884.1| leucoanthocyanidin dioxygenase-like [Glycine max]
 gb|AAR26525.1| anthocyanidin synthase [Glycine max]
 gb|ACU18773.1| unknown [Glycine max]
Length=352

 Score =   211 bits (538),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            TV  RVE LASSGI+ IPKEY+RPE+E +SIG++FEEEK   GP+VPT+DL+ I+SED  
Sbjct  3    TVAPRVESLASSGIKCIPKEYVRPEKELKSIGNVFEEEK-KEGPEVPTIDLREIDSEDEV  61

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VR KCR++L+KAA +WGVM+LVNHGI +EL  RVK AGE FFG  +EEKEKYANDQ +G 
Sbjct  62   VRGKCRQKLKKAAEEWGVMNLVNHGIQDELIERVKKAGEEFFGLAVEEKEKYANDQESGK  121

Query  435  VQGYGSKLANNASGQLEWEDYFFHCIF  515
            +QGYGSKLANNASGQLEWEDYFFH +F
Sbjct  122  IQGYGSKLANNASGQLEWEDYFFHLVF  148



>dbj|BAC75818.1| mutant protein of leucoanthocyanidin dioxygenase [Arabidopsis 
thaliana]
Length=337

 Score =   211 bits (536),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DLK I S+D ++RE 
Sbjct  6    RVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIREN  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHL+NHGI  +L  RVK AGE FF   +EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH  +
Sbjct  126  GSKLANNASGQLEWEDYFFHLAY  148



>gb|AHU88620.1| anthocyanidin synthase [Magnolia sprengeri]
Length=360

 Score =   211 bits (538),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  57   VSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGI  236
            ++T  A++P RVE LAS+GI+ IP EY+RPE ER SIGD+FEEEK   GPQ+P VDL G+
Sbjct  1    MATQVASIP-RVEMLASAGIQAIPTEYVRPEAERNSIGDVFEEEKKLEGPQIPVVDLMGL  59

Query  237  NSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYAN  416
              E+ EV +K  E+++KAA +WGVMH++NHGIS EL  RV+ AG+ FF  PIEEKE YAN
Sbjct  60   EWENEEVFKKVEEDMKKAASEWGVMHIINHGISMELMDRVRIAGKAFFDLPIEEKEMYAN  119

Query  417  DQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            DQA+G + GYGSKLANNASGQLEWEDYFFH IF
Sbjct  120  DQASGKIAGYGSKLANNASGQLEWEDYFFHLIF  152



>ref|XP_010433976.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Camelina sativa]
Length=356

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DL+ I S+D ++RE 
Sbjct  6    RVESLAKSGIVSIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLQNIESDDPKIRES  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHL+NHGI  +L  RVK AGE FF  P+EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASLDWGVMHLINHGIPLDLMERVKKAGEEFFSLPVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNA GQLEWEDYFFH  +
Sbjct  126  GSKLANNACGQLEWEDYFFHLAY  148



>emb|CAD91994.1| leucocyanidin dioxygenase [Arabidopsis thaliana]
Length=356

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DLK I S+D ++RE 
Sbjct  6    RVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIREN  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHL+NHGI  +L  RVK AGE FF   +EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH  +
Sbjct  126  GSKLANNASGQLEWEDYFFHLAY  148



>ref|NP_194019.1| leucoanthocyanidin dioxygenase [Arabidopsis thaliana]
 ref|NP_001031700.1| leucoanthocyanidin dioxygenase [Arabidopsis thaliana]
 sp|Q96323.1|LDOX_ARATH RecName: Full=Leucoanthocyanidin dioxygenase; Short=LDOX; Short=Leucocyanidin 
oxygenase; AltName: Full=Anthocyanidin synthase; 
Short=ANS; AltName: Full=Leucoanthocyanidin hydroxylase; 
AltName: Full=Protein TANNIN DEFICIENT SEED 4; Short=TDS4; 
AltName: Full=Protein TRANSPARENT TESTA 11; Short=TT11; AltName: 
Full=Protein TRANSPARENT TESTA 17; Short=TT17; AltName: 
Full=Protein TRANSPARENT TESTA 18; Short=TT18 [Arabidopsis 
thaliana]
 pdb|1GP5|A Chain A, Anthocyanidin Synthase From Arabidopsis Thaliana Complexed 
With Trans-dihydroquercetin
 pdb|1GP6|A Chain A, Anthocyanidin Synthase From Arabidopsis Thaliana Complexed 
With Trans-dihydroquercetin (with 30 Min Exposure To 
O2)
 gb|AAB09572.1| putative leucoanthocyanidin dioxygenase [Arabidopsis thaliana]
 emb|CAA19803.1| putative leucoanthocyanidin dioxygenase (LDOX) [Arabidopsis thaliana]
 emb|CAB79243.1| putative leucoanthocyanidin dioxygenase (LDOX) [Arabidopsis thaliana]
 gb|AAM65745.1| putative leucoanthocyanidin dioxygenase (LDOX) [Arabidopsis thaliana]
 dbj|BAE98562.1| putative leucoanthocyanidin dioxygenase [Arabidopsis thaliana]
 dbj|BAH20082.1| AT4G22880 [Arabidopsis thaliana]
 gb|AEE84672.1| leucoanthocyanidin dioxygenase [Arabidopsis thaliana]
 gb|AEE84673.1| leucoanthocyanidin dioxygenase [Arabidopsis thaliana]
Length=356

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DLK I S+D ++RE 
Sbjct  6    RVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIREN  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHL+NHGI  +L  RVK AGE FF   +EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH  +
Sbjct  126  GSKLANNASGQLEWEDYFFHLAY  148



>pdb|2BRT|A Chain A, Anthocyanidin Synthase From Arabidopsis Thaliana Complexed 
With Naringenin
Length=355

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DLK I S+D ++RE 
Sbjct  5    RVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIREN  64

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHL+NHGI  +L  RVK AGE FF   +EEKEKYANDQA G +QGY
Sbjct  65   CIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGY  124

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH  +
Sbjct  125  GSKLANNASGQLEWEDYFFHLAY  147



>ref|XP_010439268.1| PREDICTED: leucoanthocyanidin dioxygenase-like isoform X1 [Camelina 
sativa]
Length=351

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEY+RP+EE  SI D+F EEK   GPQVPT+DL+ I S+D ++RE 
Sbjct  6    RVESLAKSGIVSIPKEYVRPKEELESINDVFLEEKREDGPQVPTIDLQNIESDDPKIRES  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C E+L+KA++DWGVMHL+NHGI  EL  RVK AGE FF  P+EEKEKYANDQA G +QGY
Sbjct  66   CIEDLKKASLDWGVMHLINHGIPVELMERVKKAGEEFFSLPVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNA GQLEWEDYFFH  +
Sbjct  126  GSKLANNACGQLEWEDYFFHLAY  148



>dbj|BAP93924.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93927.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
Length=131

 Score =   203 bits (516),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            + SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++V
Sbjct  1    IGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPIIDLKDIDSEVIQV  60

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            REKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE+YANDQA+GN+
Sbjct  61   REKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKERYANDQASGNI  120

Query  438  QGYGSKLANNA  470
            QGYGSKLANNA
Sbjct  121  QGYGSKLANNA  131



>ref|NP_001239794.1| anthocyanidin synthase [Glycine max]
 gb|ACU19542.1| unknown [Glycine max]
Length=352

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            TV  RVE LASSGI+ IPKEY+RP+EE +SIG++FEEEK   G QVPT+DL+ I+SED  
Sbjct  3    TVAPRVESLASSGIKCIPKEYVRPQEELKSIGNVFEEEK-KEGLQVPTIDLREIDSEDEV  61

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VR KCRE+L+KAA +WGVMHLVNHGI +EL  RVK AGE FFG  +EEKEKYAND  +G 
Sbjct  62   VRGKCREKLKKAAEEWGVMHLVNHGIPDELIERVKKAGETFFGLAVEEKEKYANDLESGK  121

Query  435  VQGYGSKLANNASGQLEWEDYFFHCIF  515
            +QGYGSKLANNASGQLEWEDYFFH  F
Sbjct  122  IQGYGSKLANNASGQLEWEDYFFHLAF  148



>gb|KHN25745.1| Leucoanthocyanidin dioxygenase [Glycine soja]
Length=352

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            TV  RVE LASSGI+ IPKEY+RP+EE +SIG++FEEEK   G QVPT+DL+ I+SED  
Sbjct  3    TVAPRVESLASSGIKCIPKEYVRPQEELKSIGNVFEEEK-KEGLQVPTIDLREIDSEDEV  61

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VR KCRE+L+KAA +WGVMHLVNHGI +EL  RVK AGE FFG  +EEKEKYAND  +G 
Sbjct  62   VRGKCREKLKKAAEEWGVMHLVNHGIPDELIERVKKAGETFFGLAVEEKEKYANDLESGK  121

Query  435  VQGYGSKLANNASGQLEWEDYFFHCIF  515
            +QGYGSKLANNASGQLEWEDYFFH  F
Sbjct  122  IQGYGSKLANNASGQLEWEDYFFHLAF  148



>gb|AAD56581.1|AF184274_1 leucoanthocyanidin dioxygenase 2 [Daucus carota]
Length=389

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+T   +   RVE LA SGI+ IPKEY+RP++E  SI +IFEEEK   GPQVPTVD+  
Sbjct  1    MVATTLES--PRVETLAGSGIQLIPKEYVRPKDELISITNIFEEEKSDEGPQVPTVDIAD  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I S+D  VREKC E ++ AAVDWGVMHLVNHGIS EL  RV+ AG+ FF +PI EKEKYA
Sbjct  59   ILSDDKAVREKCYERIKDAAVDWGVMHLVNHGISNELMDRVRVAGQAFFAEPIGEKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ND   G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  119  NDPGTGMIQGYGSKLANNASGQLEWEDYFFHLVY  152



>gb|AEI99590.1| anthocyanidin synthase [Arabidopsis thaliana]
Length=356

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DL+ I S+D ++RE 
Sbjct  6    RVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLQNIESDDEKIRES  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGVMHL+NHGI  +L  RVK AGE FF   +EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH  +
Sbjct  126  GSKLANNASGQLEWEDYFFHLAY  148



>dbj|BAJ17658.1| anthocyanidin synthase [Gynura bicolor]
Length=355

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            SRVE LA SGI  IPKEYIR + E  +I +IFE ++   GPQVPT+DLK INS D ++RE
Sbjct  7    SRVESLAKSGIHEIPKEYIRTQHELTTITNIFEAKEDQQGPQVPTIDLKDINSNDPKIRE  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC +EL KAA +WGVMHLVNHGIS +L  RVKAAGE FF QP+EEKEK+ ND A+G +QG
Sbjct  67   KCIDELIKAATEWGVMHLVNHGISNDLINRVKAAGENFFDQPVEEKEKHCNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA GQLEWEDYFFH ++
Sbjct  127  YGSKLANNACGQLEWEDYFFHLVY  150



>gb|AAR26526.1| anthocyanidin synthase 2 [Glycine max]
 gb|AAR26527.1| anthocyanidin synthase 3 [Glycine max]
Length=352

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            TV  RVE LASSGI+ IPKEY+RP+EE +SIG++FEEEK   G QVPT+DL+ I+SED  
Sbjct  3    TVAPRVESLASSGIKCIPKEYVRPQEELKSIGNVFEEEK-KEGLQVPTIDLREIDSEDEV  61

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VR KCRE+L+KAA +WGVMHLVNHGI +EL  RVK AGE FFG  +EEKEKYAND  +G 
Sbjct  62   VRGKCREKLKKAAEEWGVMHLVNHGIPDELIERVKKAGETFFGLAVEEKEKYANDLESGK  121

Query  435  VQGYGSKLANNASGQLEWEDYFFHCIF  515
            +QGYGSKLANNASGQLEWEDYFFH  F
Sbjct  122  IQGYGSKLANNASGQLEWEDYFFHLAF  148



>dbj|BAP93869.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93872.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93907.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93912.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93913.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93916.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93917.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93919.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
Length=131

 Score =   202 bits (513),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            + SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++V
Sbjct  1    IGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPXIDLKDIDSEVIQV  60

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            REKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ AG+ FF  PIE+KE YANDQA+GN+
Sbjct  61   REKCREELKKAAVDWGVMHLVNHGISDELMDRVRNAGQAFFDLPIEQKEXYANDQASGNI  120

Query  438  QGYGSKLANNA  470
            QGYGSKLANNA
Sbjct  121  QGYGSKLANNA  131



>dbj|BAP93882.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93883.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93887.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93895.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP93896.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP93921.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93922.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93923.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93925.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
Length=131

 Score =   202 bits (513),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            + SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++V
Sbjct  1    IGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPIIDLKDIDSEVIQV  60

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            REKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+ +G+ FF  PIE+KE+YANDQA+GN+
Sbjct  61   REKCREELKKAAVDWGVMHLVNHGISDELMDRVRNSGQAFFDLPIEQKERYANDQASGNI  120

Query  438  QGYGSKLANNA  470
            QGYGSKLANNA
Sbjct  121  QGYGSKLANNA  131



>dbj|BAD91805.1| anthocyanidin synthase [Gentiana triflora]
Length=365

 Score =   209 bits (532),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = +3

Query  72   ATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQ--VPTVDLKGINSE  245
            + +PSRVE LA SGI+ IPKEYIRP+EE  SIG+IFEE K        VPT+DLK ++S 
Sbjct  3    SLLPSRVESLAISGIKTIPKEYIRPKEELASIGNIFEEAKNNNKTSQIVPTIDLKDMDSL  62

Query  246  D--LEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYAND  419
            D   +V+ +C +EL+ AA++WGVM+LVNHGIS+EL  RVK+AG+ FF  PIEEKEKYAND
Sbjct  63   DNNKDVQTQCHDELKNAAMEWGVMNLVNHGISQELINRVKSAGQAFFDLPIEEKEKYAND  122

Query  420  QAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            QA+GNVQGYGS+LANNASGQLEWEDYFFHCI+
Sbjct  123  QASGNVQGYGSRLANNASGQLEWEDYFFHCIY  154



>sp|P51093.1|LDOX_VITVI RecName: Full=Leucoanthocyanidin dioxygenase; Short=LDOX; Short=Leucocyanidin 
oxygenase; AltName: Full=Leucoanthocyanidin 
hydroxylase [Vitis vinifera]
 emb|CAA53580.1| leucoanthocyanidin dioxygenase [Vitis vinifera]
Length=362

 Score =   209 bits (532),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +  +V  RVE L+SSGI+ IPKEYIRP+EE  SIG++FEEEK   GPQVPT+DLK I SE
Sbjct  1    MVTSVAPRVESLSSSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIESE  60

Query  246  DLEVREKCREE----LRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            D  VR + RE     L+KAA++WGVMHLVNHGIS++L  RVK AGE FF  P+EEKEKYA
Sbjct  61   DEVVRREIRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYA  120

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            NDQA+G + GYGSKLANNASGQLEWEDYFFH IF
Sbjct  121  NDQASGKIAGYGSKLANNASGQLEWEDYFFHLIF  154



>gb|AIL56404.1| anthocyanidin synthase [Chrysanthemum x morifolium]
Length=355

 Score =   209 bits (531),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            +RVE LA+SGI +IPKEYIR ++E  +I +IF+EEK   GPQVPT+DL  INS D + R+
Sbjct  7    TRVETLATSGIHQIPKEYIRTQDELTTITNIFDEEKKELGPQVPTIDLNNINSNDPKTRK  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC  EL KAA +WGVMH++NHGIS +L  RVK AGE FF QP+EEKEKY+ND A+G +QG
Sbjct  67   KCCNELVKAATEWGVMHVINHGISSDLINRVKDAGERFFDQPVEEKEKYSNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA GQLEWEDYFFH +F
Sbjct  127  YGSKLANNACGQLEWEDYFFHLVF  150



>gb|AAD56580.1|AF184273_1 leucoanthocyanidin dioxygenase 1 [Daucus carota]
Length=402

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKG  233
            MV+T   +   RVE LA SGI+ IPKEY+RP++E  SI +IFEEEK   GPQVPTVD+  
Sbjct  1    MVATTLES--PRVETLAGSGIQLIPKEYVRPKDELISITNIFEEEKSDEGPQVPTVDIAD  58

Query  234  INSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYA  413
            I SED  VREKC E ++ AAV+WGVMHLVNHGIS EL  RV+ AG+ FF +PI EKEKYA
Sbjct  59   ILSEDKAVREKCYERIKDAAVEWGVMHLVNHGISNELMDRVRVAGQAFFAEPIGEKEKYA  118

Query  414  NDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ND   G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  119  NDPGTGMIQGYGSKLANNASGQLEWEDYFFHLVY  152



>dbj|BAP93881.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93884.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93885.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93886.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93889.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP93890.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP93891.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP93892.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP93893.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
 dbj|BAP93894.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus palmatus]
Length=131

 Score =   201 bits (511),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            + SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++V
Sbjct  1    IGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPIIDLKDIDSEVIQV  60

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            REKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+  G+ FF  PIE+KE+YANDQA+GN+
Sbjct  61   REKCREELKKAAVDWGVMHLVNHGISDELMDRVRNXGQAFFDLPIEQKERYANDQASGNI  120

Query  438  QGYGSKLANNA  470
            QGYGSKLANNA
Sbjct  121  QGYGSKLANNA  131



>gb|ACH73183.1| leucoanthocyanidin dioxygenase [Chrysanthemum x morifolium]
Length=355

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            +RVE LA+SGI +IPKEYIR ++E  +I +IF+EEK   GPQVPT+DL  INS D + R+
Sbjct  7    TRVETLATSGIHQIPKEYIRTQDELTTITNIFDEEKKELGPQVPTIDLNNINSSDPKTRK  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC  EL KAA +WGVMH+VNHGIS +L  RVK AGE FF QP+EEKEKY+ND A+G +QG
Sbjct  67   KCCNELVKAATEWGVMHIVNHGISGDLINRVKDAGERFFDQPVEEKEKYSNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA GQLEWEDYFFH +F
Sbjct  127  YGSKLANNACGQLEWEDYFFHLVF  150



>gb|ACH73180.1| leucoanthocyanidin dioxygenase [Chrysanthemum x morifolium]
Length=355

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            +RVE LA+SGI +IPKEYIR ++E  +I +IF+EEK   GPQVPT+DL  INS D + R+
Sbjct  7    TRVETLATSGIHQIPKEYIRTQDELTTITNIFDEEKKELGPQVPTIDLNNINSSDPKTRK  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC  EL KAA +WGVMH+VNHGIS +L  RVK AGE FF QP+EEKEKY+ND A+G +QG
Sbjct  67   KCCNELVKAATEWGVMHIVNHGISGDLINRVKDAGERFFDQPVEEKEKYSNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA GQLEWEDYFFH +F
Sbjct  127  YGSKLANNACGQLEWEDYFFHLVF  150



>ref|XP_007158443.1| hypothetical protein PHAVU_002G152700g [Phaseolus vulgaris]
 gb|ESW30437.1| hypothetical protein PHAVU_002G152700g [Phaseolus vulgaris]
Length=353

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   ITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSE  245
            +T  V  RVE LASSG++ IPKEY+RP+EE  +IG++FEEEK   GPQVPT+DL  I+S 
Sbjct  1    MTGMVAQRVESLASSGMKHIPKEYVRPQEELDNIGNVFEEEK-KEGPQVPTIDLAEIDSP  59

Query  246  DLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQA  425
               VR KCRE L+KAA +WGVM+LVNHGI E+L  R++ AGE FF  PIEEKE YANDQA
Sbjct  60   SEVVRGKCRENLKKAAEEWGVMNLVNHGIPEDLLNRLRKAGETFFSLPIEEKENYANDQA  119

Query  426  AGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            +G +QGYGSKLANNASGQLEWEDYFFH ++
Sbjct  120  SGKIQGYGSKLANNASGQLEWEDYFFHLVY  149



>gb|ACH73178.1| leucoanthocyanidin dioxygenase [Chrysanthemum x morifolium]
Length=355

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            +RVE LA+SGI +IPKEYIR ++E  +I +IF+EEK   GPQVPT+DL  +NS D + R+
Sbjct  7    TRVETLATSGIHQIPKEYIRTQDELTTITNIFDEEKKELGPQVPTIDLNNVNSNDPKTRK  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC  EL KAA +WGVMH++NHGIS +L  RVK AGE FF QP+EEKEKY+ND A+G +QG
Sbjct  67   KCCNELVKAATEWGVMHVINHGISSDLINRVKDAGERFFDQPVEEKEKYSNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA GQLEWEDYFFH +F
Sbjct  127  YGSKLANNACGQLEWEDYFFHLVF  150



>gb|ACH73179.1| leucoanthocyanidin dioxygenase [Chrysanthemum x morifolium]
Length=355

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            +RVE LA+SGI +IPKEYIR ++E  +I +IF+EEK   GPQVPT+DL  INS D + R+
Sbjct  7    TRVETLATSGIHQIPKEYIRTQDELTTITNIFDEEKKELGPQVPTIDLNNINSSDPKTRK  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC  EL KAA +WGVMH+VNHGIS +L  RVK AGE FF QP+EEKEKY+ND A+G +QG
Sbjct  67   KCCNELVKAATEWGVMHIVNHGISGDLINRVKDAGERFFDQPVEEKEKYSNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA GQLEWEDYFFH +F
Sbjct  127  YGSKLANNACGQLEWEDYFFHLVF  150



>gb|AAB66560.1| anthocyanidin synthase [Callistephus chinensis]
Length=355

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            +RVE LA+SG + IPKEYIR  +E  +I +IF+EEK   GPQVP +DL  INS D + R+
Sbjct  7    TRVESLATSGSDLIPKEYIRTHDELTTITNIFDEEKSDQGPQVPIIDLHDINSNDPKTRD  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC  ELRKAA +WGVMHLVNHGIS +L  RVKAAG+ FF QP+EEKEKY ND A+G +QG
Sbjct  67   KCTYELRKAATEWGVMHLVNHGISSDLINRVKAAGKSFFDQPVEEKEKYCNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA GQLEWEDYFFH  F
Sbjct  127  YGSKLANNACGQLEWEDYFFHLAF  150



>gb|ACF75873.2| anthocyanidin synthase [Chrysanthemum x morifolium]
Length=355

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            +RVE LA+SGI +IPKEYIR ++E  +I +IF+EEK   GPQVPT+DL  INS D + R+
Sbjct  7    TRVETLATSGIHQIPKEYIRTQDELTTITNIFDEEKKELGPQVPTIDLNNINSNDPKTRK  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC  EL KAA +WGVMH+VNHGI  +L  RVK AGE FF QP+EEKEKY+ND A+G +QG
Sbjct  67   KCCNELVKAATEWGVMHIVNHGIPSDLINRVKDAGERFFDQPVEEKEKYSNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA GQLEWEDYFFH +F
Sbjct  127  YGSKLANNACGQLEWEDYFFHLVF  150



>gb|ADN03369.1| anthocyanidin synthase [Pyrus communis]
Length=214

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  135  YIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAAVDWGVMH  314
            YIRP++E  +IGDIFE+EK   GPQVPT+DLK I S++ +VR KCREEL+KAAVDWGVMH
Sbjct  1    YIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKEIESDNEKVRAKCREELKKAAVDWGVMH  60

Query  315  LVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNASGQLEWED  494
            LVNHGIS+EL  +V+ AG+ FF  PIE+KEKYANDQA+G +QGYGSKLANNASGQLEWED
Sbjct  61   LVNHGISDELMDKVRKAGKAFFDLPIEQKEKYANDQASGKIQGYGSKLANNASGQLEWED  120

Query  495  YFFHCIF  515
            YFFHC++
Sbjct  121  YFFHCVY  127



>gb|AAR01567.1| anthocyanidin synthase [Sinningia cardinalis]
Length=367

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSI-GDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            RVE LASSG + IP EY+R +EE +S+  DIF EEK   GPQVP +DLK I++ED + R+
Sbjct  6    RVEILASSGNQSIPMEYVRSKEELKSMCTDIFLEEKSNEGPQVPIIDLKAISAEDEDTRK  65

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC EEL+KAA++WGVMHL+NHG+SEE+  RVK AG+ FF  P+EEKEKYANDQAAGN+ G
Sbjct  66   KCHEELKKAAMEWGVMHLINHGVSEEIISRVKIAGKEFFELPVEEKEKYANDQAAGNLHG  125

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA+G LEWEDYFFHCIF
Sbjct  126  YGSKLANNANGMLEWEDYFFHCIF  149



>dbj|BAP93874.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93875.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93876.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93877.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93888.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93915.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93920.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
 dbj|BAP93926.1| leucoanthocyanidin dioxygenase homolog, partial [Rubus sp. MM-2014]
Length=131

 Score =   200 bits (508),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  78   VPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEV  257
            + SRVE LASSGI +IPKEY+RP+EE  +IGDIFE+EK   GPQVP +DLK I+SE ++V
Sbjct  1    IGSRVESLASSGISKIPKEYVRPKEELINIGDIFEDEKSTVGPQVPXIDLKDIDSEVIQV  60

Query  258  REKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNV  437
            REKCREEL+KAAVDWGVMHLVNHGIS+EL  RV+  G+ FF  PIE+KE YANDQA+GN+
Sbjct  61   REKCREELKKAAVDWGVMHLVNHGISDELMDRVRNXGQAFFDLPIEQKEXYANDQASGNI  120

Query  438  QGYGSKLANNA  470
            QGYGSKLANNA
Sbjct  121  QGYGSKLANNA  131



>pdb|1GP4|A Chain A, Anthocyanidin Synthase From Arabidopsis Thaliana (selenomethionine 
Substituted)
Length=356

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGI  IPKEYIRP+EE  SI D+F EEK   GPQVPT+DLK I S+D ++RE 
Sbjct  6    RVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIREN  65

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            C EEL+KA++DWGV HL+NHGI  +L  RVK AGE FF   +EEKEKYANDQA G +QGY
Sbjct  66   CIEELKKASLDWGVXHLINHGIPADLXERVKKAGEEFFSLSVEEKEKYANDQATGKIQGY  125

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANNASGQLEWEDYFFH  +
Sbjct  126  GSKLANNASGQLEWEDYFFHLAY  148



>gb|ADB45308.1| anthocyanidin synthase [Brassica juncea var. napiformis]
Length=334

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  123  IPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRKAAVDW  302
            IP+EYIRP+EE  SI D+F+EEK   GPQVPT+DL+ I SED  +REKC EEL+KAA+DW
Sbjct  1    IPREYIRPKEELESINDVFQEEKKEDGPQVPTIDLQDIESEDETIREKCIEELKKAAMDW  60

Query  303  GVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANNASGQL  482
            GVMHL+NHG+  EL  RVK +GE FFG P+EEKEKYANDQA+G +QGYGSKLANNASGQL
Sbjct  61   GVMHLINHGVPVELMERVKKSGEEFFGLPVEEKEKYANDQASGKIQGYGSKLANNASGQL  120

Query  483  EWEDYFFHCIF  515
            EWEDYFFH ++
Sbjct  121  EWEDYFFHLVY  131



>gb|ACH73182.1| leucoanthocyanidin dioxygenase [Chrysanthemum x morifolium]
Length=355

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVRE  263
            +RVE LA+SGI +IPKEYIR ++E  +I +IF+EEK   GPQVPT+DL  INS D + R+
Sbjct  7    TRVETLATSGIHQIPKEYIRTQDELTTITNIFDEEKKELGPQVPTIDLNNINSSDPKTRK  66

Query  264  KCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQG  443
            KC  EL KAA +WGVMH+VNHGIS +L  RVK  GE FF QP+EEKEKY+ND A+G +QG
Sbjct  67   KCCNELVKAATEWGVMHIVNHGISGDLINRVKDVGERFFDQPVEEKEKYSNDIASGKIQG  126

Query  444  YGSKLANNASGQLEWEDYFFHCIF  515
            YGSKLANNA GQLEWEDYFFH +F
Sbjct  127  YGSKLANNACGQLEWEDYFFHLVF  150



>gb|ADY02656.1| leucoanthocyanidin dioxygenase [Parrya nudicaulis]
 gb|ADY02657.1| leucoanthocyanidin dioxygenase [Parrya nudicaulis]
Length=363

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  108  SGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRK  287
            SGI+ IPKEYIRP+EE  SI D+F EEK   GPQVPT+DL+ I SED + REKC EEL+K
Sbjct  2    SGIKSIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLQNIESEDEKTREKCVEELKK  61

Query  288  AAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANN  467
            AA+DWGVMHL+NHGI  +L  RVK +GE FFG  +EEKEKYANDQAAG +QGYGSKLANN
Sbjct  62   AALDWGVMHLINHGIPVDLMERVKKSGEEFFGLAVEEKEKYANDQAAGKIQGYGSKLANN  121

Query  468  ASGQLEWEDYFFHCIF  515
            A GQLEWEDYFFH ++
Sbjct  122  ACGQLEWEDYFFHLVY  137



>gb|ADY02659.1| leucoanthocyanidin dioxygenase [Parrya nudicaulis]
Length=363

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  108  SGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRK  287
            SGI+ IPKEYIRP+EE  SI D+F EEK   GPQVPT+DL+ I SED + REKC EEL+K
Sbjct  2    SGIKSIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLQNIESEDEKTREKCVEELKK  61

Query  288  AAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANN  467
            AA+DWGVMHL+NHGI  +L  RVK +GE FFG  +EEKEKYANDQAAG +QGYGSKLANN
Sbjct  62   AALDWGVMHLINHGIPVDLMERVKKSGEEFFGLAVEEKEKYANDQAAGKIQGYGSKLANN  121

Query  468  ASGQLEWEDYFFHCIF  515
            A GQLEWEDYFFH ++
Sbjct  122  ACGQLEWEDYFFHLVY  137



>gb|ADY02658.1| leucoanthocyanidin dioxygenase [Parrya nudicaulis]
Length=363

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  108  SGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRK  287
            SGI+ IPKEYIRP+EE  SI D+F EEK   GPQVPT+DL+ I SED + REKC EEL+K
Sbjct  2    SGIKSIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLQNIESEDEKTREKCVEELKK  61

Query  288  AAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANN  467
            AA+DWGVMHL+NHGI  +L  RVK +GE FFG  +EEKEKYANDQAAG +QGYGSKLANN
Sbjct  62   AALDWGVMHLINHGIPVDLMERVKKSGEEFFGLAVEEKEKYANDQAAGKIQGYGSKLANN  121

Query  468  ASGQLEWEDYFFHCIF  515
            A GQLEWEDYFFH ++
Sbjct  122  ACGQLEWEDYFFHLVY  137



>gb|ADY02655.1| leucoanthocyanidin dioxygenase [Parrya nudicaulis]
Length=363

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  108  SGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREKCREELRK  287
            SGI+ IPKEYIRP+EE  SI D+F EEK   GPQVPT+DL+ I SED + REKC EEL+K
Sbjct  2    SGIKSIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLQNIESEDEKTREKCVEELKK  61

Query  288  AAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGYGSKLANN  467
            AA+DWGVMHL+NHGI  +L  RVK +GE FFG  +EEKEKYANDQAAG +QGYGSKLANN
Sbjct  62   AALDWGVMHLINHGIPVDLMERVKKSGEEFFGLAVEEKEKYANDQAAGKIQGYGSKLANN  121

Query  468  ASGQLEWEDYFFHCIF  515
            A GQLEWEDYFFH ++
Sbjct  122  ACGQLEWEDYFFHLVY  137



>gb|ABY51685.1| anthocyanidin synthase [Glycine max]
Length=352

 Score =   206 bits (525),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = +3

Query  75   TVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLE  254
            TV  + + LASSGI+ IPKEY+RPE+E +SIG++FEEEK   GP+VPT+DL+ I+SED  
Sbjct  3    TVAPKKKSLASSGIKCIPKEYVRPEKELKSIGNVFEEEK-KEGPEVPTIDLREIDSEDEV  61

Query  255  VREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGN  434
            VR KCR++L+KAA +WGVM+LVNHGI +EL  RVK AGE FFG  +EEKEKYANDQ +G 
Sbjct  62   VRGKCRQKLKKAAEEWGVMNLVNHGIQDELIERVKKAGEEFFGLAVEEKEKYANDQESGK  121

Query  435  VQGYGSKLANNASGQLEWEDYFFHCIF  515
            +QGYGSKLANNASGQLEWEDYFFH +F
Sbjct  122  IQGYGSKLANNASGQLEWEDYFFHLVF  148



>dbj|BAE44202.1| anthocyanidin synthase [Gentiana triflora]
Length=365

 Score =   206 bits (525),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = +3

Query  72   ATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQ--VPTVDLKGINSE  245
            + +PSRVE LA SGI+ IPKEYIRP+EE  SIG+IFEE K        VPT+DLK ++S 
Sbjct  3    SLLPSRVESLAISGIKTIPKEYIRPKEELASIGNIFEEAKNNNETTQIVPTIDLKDMDSL  62

Query  246  D--LEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYAND  419
            D   +V+ +C  EL+ AA++WGVM+LVNHGIS+EL  RVK+AG+ FF  PIEEKEKYAND
Sbjct  63   DNNKDVQTQCHGELKNAAMEWGVMNLVNHGISQELINRVKSAGQAFFDLPIEEKEKYAND  122

Query  420  QAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            QA+GNVQGYGS+LANNASGQLEWEDYFFHCI+
Sbjct  123  QASGNVQGYGSRLANNASGQLEWEDYFFHCIY  154



>gb|AGC73738.1| anthocyanidin synthase [Strelitzia reginae]
Length=360

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = +3

Query  54   MVSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEE-EKIAGGPQVPTVDLK  230
            M + + + VP RVE LA SGI  IP EYIRPE ER S+GD FEE  K A GPQ+P VDL+
Sbjct  1    MATKVVSAVP-RVEILARSGINEIPTEYIRPESERLSVGDAFEEVRKTAEGPQIPVVDLQ  59

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
            G +S D  VR  C EE++KAA DWGVMH+VNHGIS EL  +++  G+ FF  PIE+KE+Y
Sbjct  60   GFDSPDEAVRLACVEEVKKAASDWGVMHIVNHGISLELIEQLRRVGKEFFDLPIEQKEQY  119

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQ++G +QGYGSKLANNASGQLEWEDYFFH IF
Sbjct  120  ANDQSSGKIQGYGSKLANNASGQLEWEDYFFHLIF  154



>gb|AGC92011.1| anthocyanidin synthase [Lilium cernuum]
Length=361

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 117/155 (75%), Gaps = 2/155 (1%)
 Frame = +3

Query  57   VSTITATVPSRVERLASSGIERIPKEYIRPEEERRSIGDIFEE--EKIAGGPQVPTVDLK  230
            + T    +P RVE LASSG+  IPKEY+RPE ER S+GD F+E  +  + GPQVP VDL 
Sbjct  1    MPTEIMPLPERVESLASSGLTTIPKEYVRPESERDSLGDAFDEAMKLNSSGPQVPVVDLA  60

Query  231  GINSEDLEVREKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKY  410
            G +S D  VR KC EEL+KAA DWGVMH+VNH I  EL  RV+  G+GFF  P+E+KEKY
Sbjct  61   GFDSPDEAVRAKCVEELKKAAEDWGVMHIVNHRIPLELIDRVREVGKGFFDLPVEQKEKY  120

Query  411  ANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCIF  515
            ANDQA+G +QGYGSKLANN SGQLEWEDY+FH IF
Sbjct  121  ANDQASGEIQGYGSKLANNESGQLEWEDYYFHLIF  155



>dbj|BAJ10383.1| anthocyanidin synthase [Lactuca sativa]
Length=355

 Score =   204 bits (519),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = +3

Query  84   SRVERLASSGIERIPKEYIRPEEERRSIGDIFEE-EKIAGGPQVPTVDLKGINSEDLEVR  260
            +RVE L+ SGI +IPKEYIRP++E  +I +I  E      GPQ+PT+DL  INS D +  
Sbjct  7    TRVESLSKSGIHQIPKEYIRPQDELSTITNILHEINNDDKGPQLPTIDLNDINSGDPKTL  66

Query  261  EKCREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQ  440
            E C  ELRKAA +WGVMHLVNHGIS++L  RVKAAGE FF QP+EEKEK+ ND A+G +Q
Sbjct  67   ENCSNELRKAATEWGVMHLVNHGISDDLIARVKAAGESFFSQPVEEKEKHCNDIASGKIQ  126

Query  441  GYGSKLANNASGQLEWEDYFFHCIF  515
            GYGSKLANNASGQLEWEDYFFH +F
Sbjct  127  GYGSKLANNASGQLEWEDYFFHTVF  151



>dbj|BAF49295.1| leucoanthocyanidin dioxygenase [Clitoria ternatea]
Length=354

 Score =   204 bits (518),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  87   RVERLASSGIERIPKEYIRPEEERRSIGDIFEEEKIAGGPQVPTVDLKGINSEDLEVREK  266
            RVE LA SGIE IPKEY+R +EE  +IG++FEEE   G  QVPT+DL  I+S D  VR+K
Sbjct  8    RVESLARSGIESIPKEYVRAKEEVGNIGNVFEEENKEGWEQVPTIDLSEIDSSDEVVRKK  67

Query  267  CREELRKAAVDWGVMHLVNHGISEELTGRVKAAGEGFFGQPIEEKEKYANDQAAGNVQGY  446
            CRE+L+KAA +WGVMHLVNHGI  E+  R+K AGE FF QP+EEKEKYANDQ +G +QGY
Sbjct  68   CREKLKKAAEEWGVMHLVNHGIPSEVIQRLKKAGEEFFSQPVEEKEKYANDQESGEIQGY  127

Query  447  GSKLANNASGQLEWEDYFFHCIF  515
            GSKLANN+SGQLEWEDYFFH +F
Sbjct  128  GSKLANNSSGQLEWEDYFFHLVF  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325