BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H19

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006298710.1|  hypothetical protein CARUB_v10014805mg             283   2e-94   
ref|NP_001274965.1|  ribosomal protein L17-like protein                 281   4e-94   Solanum tuberosum [potatoes]
gb|AAP80667.1|AF479048_1  ribosomal Pr 117                              281   5e-94   Triticum aestivum [Canadian hard winter wheat]
emb|CDY59177.1|  BnaC08g50110D                                          281   9e-94   Brassica napus [oilseed rape]
ref|NP_001048495.1|  Os02g0814700                                       280   1e-93   
ref|XP_009621521.1|  PREDICTED: 60S ribosomal protein L23               280   1e-93   Nicotiana tomentosiformis
ref|XP_004296407.1|  PREDICTED: 60S ribosomal protein L23               280   1e-93   Fragaria vesca subsp. vesca
ref|XP_006354439.1|  PREDICTED: 60S ribosomal protein L23-like          280   1e-93   Solanum tuberosum [potatoes]
ref|XP_009111101.1|  PREDICTED: 60S ribosomal protein L23-like          280   2e-93   Brassica rapa
ref|XP_002464505.1|  hypothetical protein SORBIDRAFT_01g019770          280   2e-93   Sorghum bicolor [broomcorn]
gb|KCW60243.1|  hypothetical protein EUGRSUZ_H02959                     282   2e-93   Eucalyptus grandis [rose gum]
ref|NP_001235125.1|  uncharacterized protein LOC100306699               279   3e-93   Glycine max [soybeans]
gb|ABK23460.1|  unknown                                                 279   3e-93   Picea sitchensis
ref|XP_004289983.1|  PREDICTED: 60S ribosomal protein L23-like          279   3e-93   Fragaria vesca subsp. vesca
ref|XP_004140575.1|  PREDICTED: 60S ribosomal protein L23-like          279   4e-93   Cucumis sativus [cucumbers]
gb|EPS68554.1|  hypothetical protein M569_06215                         279   4e-93   Genlisea aurea
gb|ACG48540.1|  60S ribosomal protein L23                               279   4e-93   Zea mays [maize]
gb|KHG28463.1|  60S ribosomal L23 -like protein                         278   5e-93   Gossypium arboreum [tree cotton]
ref|XP_009781617.1|  PREDICTED: 60S ribosomal protein L23-like          278   5e-93   Nicotiana sylvestris
ref|NP_180895.1|  60S ribosomal protein L23B                            278   6e-93   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558849.1|  PREDICTED: 60S ribosomal protein L23-like          278   7e-93   Brachypodium distachyon [annual false brome]
gb|ABK22634.1|  unknown                                                 278   8e-93   Picea sitchensis
ref|XP_010089213.1|  60S ribosomal protein L23                          278   9e-93   Morus notabilis
ref|XP_009334207.1|  PREDICTED: 60S ribosomal protein L23-like          278   1e-92   Pyrus x bretschneideri [bai li]
ref|XP_009395287.1|  PREDICTED: 60S ribosomal protein L23-like          278   1e-92   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010542959.1|  PREDICTED: 60S ribosomal protein L23-like          278   1e-92   Tarenaya hassleriana [spider flower]
sp|Q07760.1|RL23_TOBAC  RecName: Full=60S ribosomal protein L23         278   1e-92   Nicotiana tabacum [American tobacco]
gb|ACJ86039.1|  unknown                                                 277   2e-92   Medicago truncatula
emb|CDY42923.1|  BnaC05g47280D                                          277   2e-92   Brassica napus [oilseed rape]
ref|XP_003625359.1|  60S ribosomal protein L23                          278   3e-92   
gb|AAM67199.1|  putative 60S ribosomal protein L17                      276   3e-92   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140843.1|  uncharacterized protein LOC100272919               276   4e-92   Zea mays [maize]
ref|XP_009119294.1|  PREDICTED: 60S ribosomal protein L23               276   6e-92   Brassica rapa
gb|ABX75541.1|  60S ribosomal protein L17-like protein                  276   7e-92   Panax ginseng [Asiatic ginseng]
ref|XP_011041429.1|  PREDICTED: 60S ribosomal protein L23-like          275   9e-92   Populus euphratica
ref|XP_011029764.1|  PREDICTED: 60S ribosomal protein L23-like          273   5e-91   Populus euphratica
ref|XP_009134763.1|  PREDICTED: 60S ribosomal protein L23-like          273   7e-91   Brassica rapa
ref|XP_010558737.1|  PREDICTED: 60S ribosomal protein L23-like is...    273   1e-90   Tarenaya hassleriana [spider flower]
ref|XP_009614473.1|  PREDICTED: 60S ribosomal protein L23-like is...    272   2e-90   Nicotiana tomentosiformis
ref|XP_004152000.1|  PREDICTED: 60S ribosomal protein L23-like          272   2e-90   
ref|XP_001754766.1|  predicted protein                                  271   4e-90   
gb|AAB70426.1|  Strong similarity to 60S ribosomal protein L17 (g...    271   6e-90   Arabidopsis thaliana [mouse-ear cress]
gb|ABY56104.1|  ribosomal protein                                       271   6e-90   Cucumis sativus [cucumbers]
ref|XP_010521796.1|  PREDICTED: 60S ribosomal protein L23-like is...    270   1e-89   Tarenaya hassleriana [spider flower]
ref|XP_001763615.1|  predicted protein                                  270   1e-89   
ref|XP_001755040.1|  predicted protein                                  268   1e-88   
gb|AAC32130.1|  60S ribosomal protein L17                               266   3e-88   Picea mariana [black spruce]
ref|XP_002963106.1|  hypothetical protein SELMODRAFT_165708             265   1e-87   Selaginella moellendorffii
ref|XP_009124996.1|  PREDICTED: 60S ribosomal protein L23-like          264   2e-87   Brassica rapa
ref|XP_001763682.1|  predicted protein                                  262   1e-86   
ref|XP_010556919.1|  PREDICTED: 60S ribosomal protein L23-like is...    261   1e-85   
sp|Q9XEK8.1|RL23_TORRU  RecName: Full=60S ribosomal protein L23; ...    257   1e-84   Syntrichia ruralis
gb|KHN02473.1|  60S ribosomal protein L23                               255   4e-84   Glycine soja [wild soybean]
gb|EXX60184.1|  ribosomal 60S subunit protein L23B                      255   8e-84   Rhizophagus irregularis DAOM 197198w
gb|EMT07675.1|  60S ribosomal protein L23                               252   6e-83   
gb|ACF81716.1|  unknown                                                 251   1e-82   Zea mays [maize]
ref|NP_001189805.1|  60S ribosomal protein L23                          251   2e-82   Arabidopsis thaliana [mouse-ear cress]
gb|EYU32582.1|  hypothetical protein MIMGU_mgv1a015942mg                251   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_009773907.1|  PREDICTED: 60S ribosomal protein L23-like is...    251   2e-82   Nicotiana sylvestris
ref|XP_010942115.1|  PREDICTED: 60S ribosomal protein L23-like          251   3e-82   Elaeis guineensis
ref|XP_006857497.1|  hypothetical protein AMTR_s00067p00206470          251   3e-82   Amborella trichopoda
ref|XP_005651156.1|  ribosomal protein L14b/L23e                        251   3e-82   Coccomyxa subellipsoidea C-169
gb|KHG17588.1|  60S ribosomal L23 -like protein                         250   4e-82   Gossypium arboreum [tree cotton]
gb|KGN46379.1|  hypothetical protein Csa_6G088070                       250   6e-82   Cucumis sativus [cucumbers]
ref|XP_003625360.1|  60S ribosomal protein L23                          248   3e-81   
gb|ACG32297.1|  60S ribosomal protein L23                               248   4e-81   Zea mays [maize]
ref|XP_006824374.1|  PREDICTED: 60S ribosomal protein L23-like          246   2e-80   Saccoglossus kowalevskii
ref|XP_009614475.1|  PREDICTED: 60S ribosomal protein L23-like is...    246   2e-80   Nicotiana tomentosiformis
ref|XP_002908532.1|  60S ribosomal protein L23                          246   2e-80   Phytophthora infestans T30-4
ref|XP_004318392.1|  PREDICTED: 60S ribosomal protein L23               247   2e-80   
ref|XP_008890949.1|  60S ribosomal protein L23                          246   2e-80   Phytophthora parasitica INRA-310
ref|XP_004282758.1|  PREDICTED: 60S ribosomal protein L23               247   3e-80   Orcinus orca [Orca]
ref|XP_008011089.1|  PREDICTED: 60S ribosomal protein L23               249   4e-80   Chlorocebus sabaeus
ref|XP_005584045.1|  PREDICTED: 60S ribosomal protein L23 isoform X1    249   4e-80   
gb|AGH70171.1|  60S ribosomal protein L23                               246   4e-80   Placozoa sp. H4
emb|CCA20856.1|  60S ribosomal protein L23 putative                     245   6e-80   Albugo laibachii Nc14
ref|NP_957026.1|  60S ribosomal protein L23                             245   9e-80   Danio rerio [leopard danio]
gb|KDO43340.1|  hypothetical protein CISIN_1g032476mg                   244   9e-80   Citrus sinensis [apfelsine]
ref|NP_001154037.1|  60S ribosomal protein L23                          244   3e-79   Oncorhynchus mykiss
ref|NP_000969.1|  60S ribosomal protein L23                             243   3e-79   Homo sapiens [man]
ref|XP_002592201.1|  hypothetical protein BRAFLDRAFT_123946             243   4e-79   Branchiostoma floridae
ref|XP_005368366.1|  PREDICTED: 60S ribosomal protein L23               243   5e-79   Microtus ochrogaster [prairie voles]
ref|XP_006012703.1|  PREDICTED: 60S ribosomal protein L23-like is...    243   6e-79   Latimeria chalumnae
ref|XP_004633745.1|  PREDICTED: 60S ribosomal protein L23               243   6e-79   Octodon degus
gb|AAH62716.1|  Ribosomal protein L23                                   243   6e-79   Homo sapiens [man]
ref|XP_010373454.1|  PREDICTED: 60S ribosomal protein L23-like          242   9e-79   Rhinopithecus roxellana
ref|NP_001124779.1|  60S ribosomal protein L23                          242   9e-79   Pongo abelii [orang utan]
ref|NP_001279708.1|  ribosomal protein L23                              242   9e-79   Callorhinchus milii [Australian ghost shark]
ref|XP_003400755.1|  PREDICTED: 60S ribosomal protein L23-like          242   1e-78   Bombus terrestris [large earth bumblebee]
dbj|BAB28415.1|  unnamed protein product                                242   1e-78   Mus musculus [mouse]
gb|AAD25102.1|  ribosomal protein L17                                   242   1e-78   Dicentrarchus labrax [European sea bass]
ref|XP_005718380.1|  unnamed protein product                            242   1e-78   Chondrus crispus [carageen]
ref|NP_001155385.1|  ribosomal protein L23-like                         242   1e-78   Acyrthosiphon pisum
ref|NP_001085921.1|  ribosomal protein L23                              242   2e-78   Xenopus laevis [clawed frog]
gb|ACO07760.1|  60S ribosomal protein L23                               242   2e-78   Oncorhynchus mykiss
gb|AAG13342.1|AF266222_1  ribosomal protein L23                         242   2e-78   Gillichthys mirabilis
ref|XP_392812.2|  PREDICTED: 60S ribosomal protein L23                  241   2e-78   Apis mellifera [bee]
dbj|BAB22203.1|  unnamed protein product                                241   2e-78   Mus musculus [mouse]
gb|AFM88969.1|  60S ribosomal protein L23                               241   2e-78   Callorhinchus milii [Australian ghost shark]
gb|ABV44723.1|  60S ribosomal protein L23-like protein                  241   2e-78   Phlebotomus papatasi
ref|XP_005098440.1|  PREDICTED: 60S ribosomal protein L23-like is...    241   2e-78   Aplysia californica
dbj|BAN20164.1|  ribosomal protein L23                                  241   3e-78   Riptortus pedestris
ref|NP_001030186.1|  60S ribosomal protein L23                          241   3e-78   Bos taurus [bovine]
ref|XP_005861970.1|  PREDICTED: 60S ribosomal protein L23               241   3e-78   Myotis brandtii
gb|AGM32246.1|  60S ribosomal protein L23                               241   3e-78   Coptotermes formosanus
ref|NP_001134137.1|  60S ribosomal protein L23                          241   3e-78   Salmo salar
ref|XP_005706554.1|  60S ribosomal protein L23e                         241   3e-78   Galdieria sulphuraria
gb|ACO08124.1|  60S ribosomal protein L23                               241   3e-78   Oncorhynchus mykiss
ref|XP_008557858.1|  PREDICTED: 60S ribosomal protein L23               241   4e-78   Microplitis demolitor
ref|XP_006681055.1|  hypothetical protein BATDEDRAFT_26800              241   4e-78   Batrachochytrium dendrobatidis JAM81
gb|AAY66949.1|  60S ribosomal protein L23                               241   4e-78   Ixodes scapularis [blacklegged tick]
ref|NP_001037227.1|  ribosomal protein L23                              241   4e-78   Bombyx mori [silk moth]
ref|XP_003922660.1|  PREDICTED: 60S ribosomal protein L23               241   4e-78   Saimiri boliviensis boliviensis
ref|XP_002430176.1|  60S ribosomal protein L23, putative                240   5e-78   Pediculus humanus corporis [human body lice]
ref|NP_001290643.1|  ribosomal protein L23                              240   5e-78   Esox lucius
ref|XP_002719380.2|  PREDICTED: 60S ribosomal protein L23               243   6e-78   
ref|XP_011049408.1|  PREDICTED: 60S ribosomal protein L23               240   6e-78   Acromyrmex echinatior
dbj|BAM17763.1|  ribosomal protein L23                                  240   7e-78   Papilio xuthus [Chinese swallowtail]
ref|XP_005693789.1|  PREDICTED: 60S ribosomal protein L23               240   8e-78   
gb|ACO08568.1|  60S ribosomal protein L23                               240   8e-78   Oncorhynchus mykiss
gb|AFM87360.1|  60S ribosomal protein L23                               240   8e-78   Callorhinchus milii [Australian ghost shark]
ref|XP_006624709.1|  PREDICTED: 60S ribosomal protein L23-like          240   9e-78   Apis dorsata [rock honeybee]
gb|ABW04138.1|  ribosomal protein L23                                   240   1e-77   Epinephelus coioides [estuary cod]
ref|XP_001650232.1|  AAEL015006-PA                                      239   1e-77   
ref|XP_008011900.1|  PREDICTED: 60S ribosomal protein L23               239   1e-77   Chlorocebus sabaeus
gb|AFM86359.1|  60S ribosomal protein L23                               239   1e-77   Callorhinchus milii [Australian ghost shark]
ref|XP_974360.1|  PREDICTED: 60S ribosomal protein L23                  239   1e-77   Tribolium castaneum [rust-red flour beetle]
emb|CAJ17291.1|  ribosomal protein L23e                                 239   2e-77   Sphaerius sp. APV-2005
ref|NP_001003100.1|  60S ribosomal protein L23                          239   2e-77   
gb|ACY71293.1|  ribosomal protein L23                                   239   2e-77   Chrysomela tremula
ref|XP_009094975.1|  PREDICTED: 60S ribosomal protein L23               239   2e-77   Serinus canaria [canary]
ref|XP_002192767.1|  PREDICTED: 60S ribosomal protein L23               240   2e-77   Taeniopygia guttata
ref|XP_005177126.1|  PREDICTED: 60S ribosomal protein L23               238   3e-77   Musca domestica
ref|XP_006007528.1|  PREDICTED: 60S ribosomal protein L23-like          238   3e-77   Latimeria chalumnae
ref|XP_002719902.1|  PREDICTED: 60S ribosomal protein L23-like          238   4e-77   Oryctolagus cuniculus [domestic rabbit]
ref|XP_011352087.1|  PREDICTED: 60S ribosomal protein L23               238   4e-77   Ooceraea biroi
gb|KFO97478.1|  60S ribosomal protein L23                               238   5e-77   Calypte anna
emb|CBN75776.1|  conserved unknown protein                              238   5e-77   Ectocarpus siliculosus
ref|NP_523813.1|  ribosomal protein L23                                 238   5e-77   Drosophila melanogaster
gb|ABM55583.1|  putative 60S ribosomal protein L23                      238   6e-77   Maconellicoccus hirsutus [pink hibiscus mealybug]
ref|XP_006892698.1|  PREDICTED: 60S ribosomal protein L23-like          238   8e-77   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|ENN81247.1|  hypothetical protein YQE_02341                          238   8e-77   Dendroctonus ponderosae
ref|XP_006126287.1|  PREDICTED: 60S ribosomal protein L23               238   8e-77   
ref|XP_007468010.1|  PREDICTED: 60S ribosomal protein L23-like          238   8e-77   Lipotes vexillifer [baiji]
tpe|CAL69069.1|  TPA: putative 60S ribosomal protein L23                237   1e-76   Spadella cephaloptera
ref|XP_007524549.1|  PREDICTED: 60S ribosomal protein L23-like          237   1e-76   Erinaceus europaeus [common hedgehog]
gb|ABV82416.1|  TA01212p                                                237   1e-76   Drosophila melanogaster
gb|AIU94818.1|  60S ribosomal protein                                   237   1e-76   Phragmatopoma lapidosa
ref|XP_005684126.1|  PREDICTED: 60S ribosomal protein L23-like          237   1e-76   
ref|XP_010310859.1|  PREDICTED: 60S ribosomal protein L23               237   1e-76   Balearica regulorum gibbericeps
ref|XP_002713585.1|  PREDICTED: 60S ribosomal protein L23               237   1e-76   Oryctolagus cuniculus [domestic rabbit]
ref|XP_009474121.1|  PREDICTED: 60S ribosomal protein L23               238   2e-76   Nipponia nippon
ref|XP_004526407.1|  PREDICTED: 60S ribosomal protein L23-like          236   2e-76   Ceratitis capitata [medfly]
emb|CDW53715.1|  large subunit ribosomal protein 23                     236   2e-76   Trichuris trichiura
ref|XP_008503868.1|  PREDICTED: 60S ribosomal protein L23               236   2e-76   Calypte anna
gb|EFB19935.1|  hypothetical protein PANDA_004968                       236   2e-76   Ailuropoda melanoleuca
gb|EMC85376.1|  60S ribosomal protein L23                               236   2e-76   
gb|ACH56903.1|  60S ribosomal protein L14/L17/L23                       236   3e-76   Simulium vittatum
emb|CDQ88886.1|  unnamed protein product                                236   3e-76   Oncorhynchus mykiss
gb|KIZ00334.1|  60S ribosomal protein                                   236   3e-76   Monoraphidium neglectum
gb|ABW23177.1|  ribosomal protein rpl23                                 236   3e-76   Arenicola marina [rock worm]
ref|XP_005232723.1|  PREDICTED: 60S ribosomal protein L23               236   3e-76   
ref|XP_007127753.1|  PREDICTED: 60S ribosomal protein L23-like          236   3e-76   Physeter catodon
ref|XP_005061658.1|  PREDICTED: 60S ribosomal protein L23               236   4e-76   Ficedula albicollis
gb|EFX69895.1|  hypothetical protein DAPPUDRAFT_300630                  236   4e-76   Daphnia pulex
ref|XP_004008323.1|  PREDICTED: 60S ribosomal protein L23-like          238   4e-76   
gb|ABG82011.1|  putative ribosomal protein L17/23                       235   5e-76   Diaphorina citri
gb|KFH64795.1|  60S ribosomal protein L23                               235   5e-76   Mortierella verticillata NRRL 6337
ref|XP_003797302.1|  PREDICTED: 60S ribosomal protein L23-like          235   6e-76   Otolemur garnettii
ref|XP_003213136.2|  PREDICTED: 60S ribosomal protein L23               235   6e-76   
ref|XP_004338344.1|  60S ribosomal protein L23, putative                235   6e-76   Acanthamoeba castellanii str. Neff
ref|XP_007189021.1|  PREDICTED: 60S ribosomal protein L23-like          235   6e-76   Balaenoptera acutorostrata scammoni
gb|EPQ05063.1|  60S ribosomal protein L23                               235   8e-76   Myotis brandtii
ref|XP_008351954.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    234   8e-76   
gb|EHH58057.1|  60S ribosomal protein L17                               234   9e-76   Macaca fascicularis [crab eating macaque]
ref|XP_002109491.1|  conserved hypothetical protein                     234   9e-76   Trichoplax adhaerens
gb|ABX75501.1|  ribosomal protein l23                                   234   1e-75   Lycosa singoriensis
gb|AGN29657.1|  60S ribosomal protein L23                               234   1e-75   Acartia pacifica
ref|XP_010134403.1|  PREDICTED: 60S ribosomal protein L23               234   1e-75   Buceros rhinoceros silvestris
ref|XP_009679385.1|  PREDICTED: 60S ribosomal protein L23               235   1e-75   Struthio camelus australis
gb|AAP20205.1|  ribosomal protein L17                                   234   2e-75   Pagrus major [red tail]
gb|KGL72736.1|  60S ribosomal protein L23                               234   2e-75   Tinamus guttatus
ref|XP_002839313.1|  60S ribosomal protein L23                          234   2e-75   Tuber melanosporum Mel28
gb|AEE62943.1|  unknown                                                 234   2e-75   Dendroctonus ponderosae
ref|XP_003389687.1|  PREDICTED: 60S ribosomal protein L23               234   2e-75   Amphimedon queenslandica
ref|XP_005098439.1|  PREDICTED: 60S ribosomal protein L23-like is...    234   2e-75   Aplysia californica
ref|XP_002957495.1|  component of cytosolic 80S ribosome and 60S ...    234   2e-75   Volvox carteri f. nagariensis
emb|CAB56830.1|  60S ribosomal protein L17                              234   2e-75   Cyanophora paradoxa
gb|ACD65173.1|  putative 60S ribosomal protein RPL23                    233   3e-75   Phoronis muelleri
gb|EAZ25517.1|  hypothetical protein OsJ_09341                          233   3e-75   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE78800.1|  ribosomal protein L23                                  233   3e-75   Pelodiscus sinensis [Chinese softshell turtle]
gb|KIV93651.1|  60S ribosomal protein L23-A                             233   4e-75   Exophiala mesophila
ref|XP_005334591.1|  PREDICTED: 60S ribosomal protein L23-like          233   4e-75   Ictidomys tridecemlineatus
emb|CAJ17289.1|  ribosomal protein L23e                                 233   5e-75   Biphyllus lunatus
ref|XP_011424740.1|  PREDICTED: 60S ribosomal protein L23               233   6e-75   Crassostrea gigas
ref|XP_009154822.1|  60S ribosomal protein L23                          233   6e-75   Exophiala dermatitidis NIH/UT8656
gb|ACO57591.1|  ribosomal protein L23                                   232   7e-75   Gillichthys seta
ref|WP_036770884.1|  50S ribosomal protein L14                          232   8e-75   Pontibacillus halophilus
ref|XP_008479129.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    232   8e-75   
emb|CCQ18586.1|  60S ribosomal protein L23                              232   8e-75   Sycon ciliatum
gb|AAH03518.1|  Similar to ribosomal protein L23                        232   8e-75   Homo sapiens [man]
ref|XP_003252985.1|  PREDICTED: 60S ribosomal protein L23-like is...    232   9e-75   
ref|XP_007184247.1|  PREDICTED: uncharacterized protein LOC103006299    237   1e-74   Balaenoptera acutorostrata scammoni
gb|EFN77642.1|  60S ribosomal protein L23                               234   2e-74   Harpegnathos saltator
ref|XP_003745601.1|  PREDICTED: 60S ribosomal protein L23-like          231   2e-74   Galendromus occidentalis
gb|AAN05612.1|  ribosomal protein L17A                                  231   2e-74   Argopecten irradians
gb|EYE98017.1|  ribosomal protein L14b/L23e                             231   2e-74   Aspergillus ruber CBS 135680
gb|EKV07775.1|  Alkaline serine protease                                231   3e-74   Penicillium digitatum Pd1
gb|EGI68616.1|  60S ribosomal protein L23                               231   3e-74   Acromyrmex echinatior
gb|KIV87048.1|  60S ribosomal protein L23                               233   4e-74   Exophiala sideris
gb|ACO14635.1|  60S ribosomal protein L23                               231   4e-74   Caligus clemensi
ref|XP_002489484.1|  60S ribosomal protein L23                          230   4e-74   Komagataella phaffii GS115
ref|XP_011357841.1|  PREDICTED: 60S ribosomal protein L23-like          230   5e-74   Pteropus vampyrus
ref|XP_010023856.1|  PREDICTED: 60S ribosomal protein L23 isoform X2    230   5e-74   Eucalyptus grandis [rose gum]
ref|XP_010091793.1|  60S ribosomal protein L23                          231   5e-74   
ref|WP_036844039.1|  hypothetical protein                               230   5e-74   
ref|XP_001540679.1|  60S ribosomal protein L23                          230   6e-74   Histoplasma capsulatum NAm1
gb|ERE67619.1|  60S ribosomal protein L23-like protein                  236   6e-74   Cricetulus griseus [Chinese hamsters]
ref|XP_010213367.1|  PREDICTED: 60S ribosomal protein L23               232   7e-74   Tinamus guttatus
ref|XP_007958989.1|  PREDICTED: 60S ribosomal protein L23-like          229   9e-74   Chlorocebus sabaeus
ref|XP_002562222.1|  Pc18g03860                                         229   1e-73   Penicillium rubens Wisconsin 54-1255
ref|XP_002626001.1|  60S ribosomal protein L23                          229   1e-73   Blastomyces gilchristii SLH14081
gb|ELU02136.1|  hypothetical protein CAPTEDRAFT_172799                  229   1e-73   Capitella teleta
ref|XP_001636882.1|  predicted protein                                  229   1e-73   Nematostella vectensis
gb|AIL48394.1|  large subunit ribosomal protein 23                      229   1e-73   Teratodiplogaster sp. 1 VS-2014
gb|EPX70990.1|  60S ribosomal protein L23                               229   2e-73   Schizosaccharomyces octosporus yFS286
gb|KJB28525.1|  hypothetical protein B456_005G053300                    229   2e-73   Gossypium raimondii
gb|AFW64022.1|  hypothetical protein ZEAMMB73_988730                    229   2e-73   
gb|EXX60185.1|  ribosomal 60S subunit protein L23B                      228   2e-73   Rhizophagus irregularis DAOM 197198w
ref|XP_001900778.1|  60S ribosomal protein L23                          229   2e-73   Brugia malayi [agent of lymphatic filariasis]
ref|XP_005850601.1|  hypothetical protein CHLNCDRAFT_59578              229   2e-73   Chlorella variabilis
ref|NP_588139.1|  60S ribosomal protein L23                             228   3e-73   Schizosaccharomyces pombe
emb|CCX32527.1|  Similar to 60S ribosomal protein L23-A; acc. no....    228   3e-73   Pyronema omphalodes CBS 100304
gb|ERG81802.1|  60s ribosomal protein l23                               228   3e-73   
ref|XP_008756250.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    228   4e-73   Rattus norvegicus [brown rat]
ref|XP_001712219.1|  rpl23                                              228   4e-73   Hemiselmis andersenii
gb|ERZ95751.1|  hypothetical protein GLOINDRAFT_341052                  228   4e-73   
dbj|BAJ98222.1|  predicted protein                                      228   4e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBK20405.2|  Ribosomal protein L14b/L23e                            228   5e-73   Blastocystis hominis
gb|KHN78547.1|  60S ribosomal protein L23                               228   6e-73   Toxocara canis
gb|AIL48390.1|  large subunit ribosomal protein 23                      228   6e-73   Acrostichus rhynchophori
gb|ACO10576.1|  60S ribosomal protein L23                               227   8e-73   Caligus rogercresseyi
gb|AIL48398.1|  large subunit ribosomal protein 23                      227   9e-73   Bunonema sp. VS-2014
ref|XP_011400127.1|  60S ribosomal protein L23                          227   1e-72   Auxenochlorella protothecoides
gb|AIL48399.1|  large subunit ribosomal protein 23                      227   1e-72   Koerneria sp. 2 VS-2014
gb|KHJ89553.1|  ribosomal protein L14p/L23e                             227   1e-72   Oesophagostomum dentatum [nodule worm]
emb|CDJ89872.1|  Ribosomal protein L14b L23e domain containing pr...    227   1e-72   Haemonchus contortus [red stomach worm]
gb|ELK01583.1|  F-box only protein 47                                   237   1e-72   Pteropus alecto
ref|XP_007182335.1|  PREDICTED: 60S ribosomal protein L23-like          227   1e-72   Balaenoptera acutorostrata scammoni
gb|AIL48389.1|  large subunit ribosomal protein 23                      226   1e-72   Sachsia zurstrasseni
ref|XP_006866188.1|  PREDICTED: 60S ribosomal protein L23-like          226   1e-72   Chrysochloris asiatica
gb|AIL48393.1|  large subunit ribosomal protein 23                      226   2e-72   Rhabditolaimus sp. 1 VS-2014
gb|EZF25633.1|  60S ribosomal protein L23                               226   2e-72   Trichophyton rubrum MR850
gb|KIH57230.1|  ribosomal protein L14p/L23e                             226   2e-72   Ancylostoma duodenale
ref|XP_001791157.1|  hypothetical protein SNOG_00472                    226   2e-72   Parastagonospora nodorum SN15
gb|KJB10026.1|  hypothetical protein B456_001G180900                    226   2e-72   Gossypium raimondii
ref|XP_457899.2|  60S ribosomal protein L23                             226   2e-72   Debaryomyces hansenii CBS767
gb|AIL48387.1|  large subunit ribosomal protein 23                      226   2e-72   Koerneria luziae
ref|XP_002172354.1|  60S ribosomal protein L23                          226   2e-72   Schizosaccharomyces japonicus yFS275
gb|ESW99475.1|  60S ribosomal protein L23-A                             226   2e-72   Ogataea parapolymorpha DL-1
ref|XP_001218177.1|  60S ribosomal protein L23                          226   2e-72   Aspergillus terreus NIH2624
ref|XP_002845774.1|  60S ribosomal protein L23                          226   3e-72   Microsporum canis CBS 113480
ref|XP_008716183.1|  60S ribosomal protein L23                          226   3e-72   Cyphellophora europaea CBS 101466
ref|XP_007377409.1|  60S ribosomal protein L23                          226   3e-72   Spathaspora passalidarum NRRL Y-27907
ref|XP_004283659.1|  PREDICTED: 60S ribosomal protein L23-like          226   4e-72   Orcinus orca [Orca]
gb|KIW00881.1|  60S ribosomal protein L23                               225   4e-72   Verruconis gallopava
gb|AIL48384.1|  large subunit ribosomal protein 23                      225   5e-72   Fictor sp. 1 VS-2014
gb|AIL48396.1|  large subunit ribosomal protein 23                      225   5e-72   Oigolaimella sp. VS-2014
ref|XP_001391859.1|  60S ribosomal protein L23                          225   5e-72   Aspergillus niger CBS 513.88
ref|XP_009808796.1|  PREDICTED: 60S ribosomal protein L23               224   6e-72   Gavia stellata
gb|KFV52489.1|  60S ribosomal protein L23                               224   6e-72   Gavia stellata
ref|XP_002480854.1|  60S ribosomal protein L23                          225   7e-72   Talaromyces stipitatus ATCC 10500
gb|AIL48391.1|  large subunit ribosomal protein 23                      225   7e-72   Diplogastrellus sp. VS-2014
gb|AAA28867.1|  ribosomal protein L17A                                  225   8e-72   Drosophila melanogaster
ref|XP_009554996.1|  PREDICTED: 60S ribosomal protein L23               225   8e-72   Cuculus canorus
gb|AIL48388.1|  large subunit ribosomal protein 23                      224   8e-72   Diplogasteroides halleri
ref|XP_002548609.1|  60S ribosomal protein L23                          224   8e-72   Candida tropicalis MYA-3404
ref|XP_001265902.1|  60S ribosomal protein L23                          224   9e-72   Aspergillus fischeri NRRL 181
ref|XP_001384383.1|  60S ribosomal protein L23                          224   9e-72   Scheffersomyces stipitis CBS 6054
ref|XP_006958165.1|  ribosomal protein L14b/L23e                        224   9e-72   
ref|XP_001523998.1|  60S ribosomal protein L23                          224   1e-71   
ref|XP_006543439.1|  PREDICTED: 60S ribosomal protein L23 isoform X1    224   1e-71   
ref|XP_004993616.1|  ribosomal protein rpl23                            224   1e-71   
emb|CDR37810.1|  CYFA0S01e17700g1_1                                     224   2e-71   
ref|XP_002495127.1|  60S ribosomal protein L23                          224   2e-71   
ref|XP_002502751.1|  predicted protein                                  224   2e-71   
ref|XP_004828856.1|  60S ribosomal protein L23, putative                224   2e-71   
emb|CEP60236.1|  LALA0S01e06106g1_1                                     223   2e-71   
ref|XP_003870635.1|  Rpl23a ribosomal protein                           223   2e-71   
gb|EMF14091.1|  ribosomal protein L14b/L23e                             223   2e-71   
ref|XP_005440131.1|  PREDICTED: 60S ribosomal protein L23               223   2e-71   
gb|AIL48397.1|  large subunit ribosomal protein 23                      223   3e-71   
ref|XP_002552489.1|  60S ribosomal protein L23                          223   3e-71   
gb|EKC32688.1|  60S ribosomal protein L23                               223   3e-71   
ref|XP_007875086.1|  hypothetical protein PNEG_03035                    223   3e-71   
ref|NP_498231.1|  Protein RPL-23                                        223   3e-71   
emb|CEF65874.1|  60S ribosomal protein L23                              223   3e-71   
ref|XP_011122913.1|  hypothetical protein AOL_s00080g236                223   4e-71   
ref|XP_007124201.1|  PREDICTED: 60S ribosomal protein L23-like          224   5e-71   
sp|Q93140.1|RL23_BRUMA  RecName: Full=60S ribosomal protein L23         223   5e-71   
ref|XP_009062507.1|  hypothetical protein LOTGIDRAFT_128584             223   5e-71   
ref|XP_003680378.1|  60S ribosomal protein L23                          222   5e-71   
gb|KGG51366.1|  ribosomal protein L23                                   222   6e-71   
ref|XP_009690338.1|  ribosomal protein L23                              222   6e-71   
ref|XP_006686301.1|  ribosomal protein L14b/L23e                        222   6e-71   
ref|XP_001940446.1|  60S ribosomal protein L23                          222   8e-71   
gb|EEQ46793.1|  conserved hypothetical protein                          222   9e-71   
ref|XP_004197283.1|  Piso0_004530                                       222   9e-71   
ref|XP_001245088.1|  60S ribosomal protein L23                          222   9e-71   
gb|ABX44825.1|  putative 60S ribosomal protein RPL23                    222   1e-70   
ref|XP_009831256.1|  60S ribosomal protein L23                          222   1e-70   
ref|XP_005538895.1|  60S ribosomal protein L23                          221   1e-70   
gb|EKG12988.1|  Ribosomal protein L14b/L23e                             221   2e-70   
gb|ABZ04234.1|  ribosomal protein rpl23                                 221   2e-70   
gb|AFJ91752.1|  ribosomal protein L17/23                                221   2e-70   
ref|XP_007925861.1|  hypothetical protein MYCFIDRAFT_52202              221   2e-70   
ref|NP_986379.1|  60S ribosomal protein L23                             221   2e-70   
gb|KDN41617.1|  putative RPL23A-60S large subunit ribosomal prote...    221   2e-70   
gb|ABR87220.1|  large subunit ribosomal protein 23                      221   2e-70   
gb|ACX54278.1|  ribosomal protein L23                                   221   2e-70   
emb|CCK68663.1|  hypothetical protein KNAG_0B02210                      221   2e-70   
ref|XP_007234496.1|  PREDICTED: 60S ribosomal protein L23-like          221   2e-70   
gb|EPB93037.1|  60S ribosomal protein L23                               221   3e-70   
ref|XP_010558736.1|  PREDICTED: 60S ribosomal protein L23-like is...    221   3e-70   
emb|CCG83645.1|  60S ribosomal protein L23                              220   3e-70   
ref|XP_567903.1|  60s ribosomal protein l23                             221   3e-70   
dbj|GAM83489.1|  hypothetical protein ANO11243_014770                   221   3e-70   
ref|XP_002681470.1|  60S ribosomal protein L23                          221   3e-70   
gb|EPS30341.1|  hypothetical protein PDE_05292                          221   3e-70   
ref|XP_007357134.1|  ribosomal protein L14b/L23e                        221   3e-70   
ref|XP_002151871.1|  60S ribosomal protein L23                          220   3e-70   
dbj|GAN10916.1|  60S ribosomal protein L23                              220   3e-70   
dbj|GAD93394.1|  60S ribosomal protein L23                              220   4e-70   
ref|XP_001611768.1|  ribosomal protein L14p/L23e                        220   4e-70   
ref|XP_007008300.1|  hypothetical protein TREMEDRAFT_74898              220   4e-70   
ref|XP_007261709.1|  60S ribosomal protein L17/L23                      220   4e-70   
emb|CCI47056.1|  unnamed protein product                                220   4e-70   
ref|XP_003959688.1|  hypothetical protein KAFR_0K01990                  220   4e-70   
emb|CEG63891.1|  Putative 60S ribosomal protein L23                     220   4e-70   
ref|XP_003196567.1|  60S ribosomal protein L23                          220   4e-70   
ref|NP_009466.1|  ribosomal 60S subunit protein L23A                    220   4e-70   
dbj|GAN10031.1|  60S ribosomal protein L23                              222   5e-70   
emb|CDO94403.1|  unnamed protein product                                220   5e-70   
ref|XP_001483150.1|  60S ribosomal protein L23                          220   5e-70   
ref|XP_764889.1|  60S ribosomal protein L23                             220   5e-70   
pdb|4BYN|V  Chain V, Cryo-em Reconstruction Of The 80s-eif5b-met-...    220   5e-70   
ref|XP_011389970.1|  ribosomal 60S subunit protein L23                  220   5e-70   
dbj|GAM36887.1|  alkaline serine protease                               220   5e-70   
gb|ACV21039.1|  large subunit ribosomal protein 23                      219   7e-70   
ref|XP_009268451.1|  60S ribosomal protein L23                          219   7e-70   
gb|EIE81015.1|  60S ribosomal protein L23                               219   7e-70   
gb|EJT47613.1|  60s ribosomal protein l23                               219   8e-70   
ref|XP_008871308.1|  60S ribosomal protein L23                          219   8e-70   
ref|XP_003674393.1|  hypothetical protein NCAS_0A14560                  219   8e-70   
ref|XP_009585538.1|  PREDICTED: 60S ribosomal protein L23               219   9e-70   
ref|XP_005785080.1|  hypothetical protein EMIHUDRAFT_418142             219   9e-70   
ref|XP_005828315.1|  large subunit ribosomal protein L23e, cytopl...    219   9e-70   
ref|XP_007323057.1|  hypothetical protein SERLADRAFT_477753             219   1e-69   
emb|CEG70875.1|  Putative 60S ribosomal protein L23                     219   1e-69   
gb|ACV21038.1|  large subunit ribosomal protein 23                      219   1e-69   
ref|XP_008051687.1|  PREDICTED: 60S ribosomal protein L23-like          219   1e-69   
gb|ACD65125.1|  putative 60S ribosomal protein RPL23                    219   1e-69   
ref|XP_001645895.1|  hypothetical protein Kpol_1045p23                  219   1e-69   
ref|XP_454264.1|  60S ribosomal protein L23                             219   1e-69   
gb|AAX48855.1|  L23                                                     219   1e-69   
ref|XP_003855882.1|  60S ribosomal protein L23                          219   2e-69   
gb|AJQ09496.1|  Rpl23ap                                                 219   2e-69   
gb|KIM76874.1|  hypothetical protein PILCRDRAFT_633200                  219   2e-69   
ref|XP_003667549.1|  ribosomal protein L23                              219   2e-69   
ref|XP_004180072.1|  hypothetical protein TBLA_0D00430                  219   2e-69   
ref|XP_007878308.1|  hypothetical protein PFL1_02601                    218   2e-69   
ref|XP_004480666.1|  PREDICTED: 60S ribosomal protein L23-like          218   2e-69   
ref|XP_502651.1|  60S ribosomal protein L23                             218   2e-69   
gb|KDD75295.1|  ribosomal protein L14p/L23e                             218   2e-69   
ref|XP_007852386.1|  60s ribosomal protein l23                          218   2e-69   
ref|XP_001823986.1|  60S ribosomal protein L23                          218   2e-69   
ref|XP_007363685.1|  60S ribosomal protein L17/L23                      218   3e-69   
tpe|CBF77394.1|  TPA: hypothetical protein similar to AGL288Wp (B...    218   3e-69   
gb|KFM71204.1|  60S ribosomal protein L23                               218   3e-69   
ref|XP_008041470.1|  60S ribosomal protein L17/L23                      218   3e-69   
pdb|3JYW|R  Chain R, Structure Of The 60s Proteins For Eukaryotic...    218   3e-69   
pdb|2X7N|C  Chain C, Mechanism Of Eif6s Anti-association Activity       218   4e-69   
gb|ACV21028.1|  large subunit ribosomal protein 23                      218   4e-69   
emb|CCU97981.1|  unnamed protein product                                218   4e-69   
ref|XP_001731934.1|  hypothetical protein MGL_1202                      218   4e-69   
dbj|BAO42003.2|  60S ribosomal protein L23                              218   4e-69   
ref|XP_446519.1|  60S ribosomal protein L23                             218   4e-69   
ref|XP_003060857.1|  predicted protein                                  218   5e-69   
ref|XP_009614474.1|  PREDICTED: 60S ribosomal protein L23-like is...    217   5e-69   
gb|AFP65420.1|  60S ribosomal protein L23                               218   5e-69   
gb|EME46170.1|  hypothetical protein DOTSEDRAFT_70233                   218   5e-69   
gb|KHJ32000.1|  putative 60s ribosomal protein l23                      218   5e-69   
gb|KIM97806.1|  hypothetical protein OIDMADRAFT_147331                  218   6e-69   
ref|XP_007870016.1|  ribosomal protein L14b/L23e                        218   6e-69   
gb|AAC96111.1|  ribosomal protein L17 homolog                           218   6e-69   
gb|KEZ45919.1|  hypothetical protein SAPIO_CDS1301                      217   6e-69   
gb|EIF49543.1|  60s ribosomal protein l23                               217   7e-69   
ref|XP_008609030.1|  60S ribosomal protein L23                          217   7e-69   
gb|KDQ14577.1|  hypothetical protein BOTBODRAFT_346224                  217   8e-69   
gb|ACV21037.1|  large subunit ribosomal protein 23                      216   1e-68   
ref|XP_004364834.1|  60S ribosomal protein L23                          217   1e-68   
ref|XP_002396325.1|  hypothetical protein MPER_03468                    216   1e-68   
ref|XP_008088824.1|  Ribosomal protein L14                              217   1e-68   
ref|XP_006163727.1|  PREDICTED: 60S ribosomal protein L23-like          217   1e-68   
gb|ABR87219.1|  large subunit ribosomal protein 23                      216   1e-68   
gb|EKD01386.1|  60s ribosomal protein l23                               221   1e-68   
gb|AGR45372.2|  large subunit ribosomal protein 23                      216   1e-68   
emb|CDW73454.1|  60s ribosomal protein l23                              216   1e-68   
gb|AHZ34805.1|  large subunit ribosomal protein 23                      216   1e-68   
gb|KFP88637.1|  60S ribosomal protein L23                               216   1e-68   
ref|XP_003327910.1|  60S ribosomal protein L23                          216   1e-68   
gb|AHZ34802.1|  large subunit ribosomal protein 23                      216   2e-68   
ref|XP_007291814.1|  60S ribosomal protein L23                          216   2e-68   
gb|KFV98641.1|  60S ribosomal protein L23                               216   2e-68   
gb|KHN24882.1|  60S ribosomal protein L23                               216   2e-68   
gb|ACV21033.1|  large subunit ribosomal protein 23                      216   2e-68   
ref|XP_007584091.1|  putative 60s ribosomal protein l23 protein         216   2e-68   
ref|XP_006965616.1|  hypothetical protein TRIREDRAFT_122001             216   2e-68   
ref|XP_965587.1|  60S ribosomal protein L23                             216   3e-68   
gb|AHZ34801.1|  large subunit ribosomal protein 23                      216   3e-68   
gb|KIM43620.1|  hypothetical protein M413DRAFT_384984                   216   3e-68   
gb|EHK39929.1|  hypothetical protein TRIATDRAFT_259796                  216   3e-68   
gb|AHZ34803.1|  large subunit ribosomal protein 23                      215   3e-68   
gb|ABR87218.1|  large subunit ribosomal protein 23                      215   3e-68   
gb|ACV21040.1|  large subunit ribosomal protein 23                      215   3e-68   
ref|XP_003712412.1|  60S ribosomal protein L23                          215   3e-68   
gb|AHZ34810.1|  large subunit ribosomal protein 23                      215   3e-68   
gb|AGR45362.1|  large subunit ribosomal protein 23                      215   3e-68   
gb|KDE08453.1|  60S ribosomal protein L23                               215   3e-68   
gb|ABR87209.1|  large subunit ribosomal protein 23                      215   4e-68   
gb|KIJ56405.1|  hypothetical protein M422DRAFT_73179                    215   4e-68   
ref|XP_007797601.1|  putative 60s ribosomal protein l23 protein         215   4e-68   
gb|KJA17243.1|  hypothetical protein HYPSUDRAFT_90886                   215   4e-68   
ref|XP_003175207.1|  60S ribosomal protein L23                          216   5e-68   
ref|XP_001560050.1|  60S ribosomal protein L23                          215   5e-68   
gb|AHZ34804.1|  large subunit ribosomal protein 23                      215   5e-68   
ref|XP_011072164.1|  PREDICTED: 60S ribosomal protein L23-like          217   6e-68   
gb|AFJ92675.1|  large ribosomal protein 23                              214   6e-68   
gb|ABR87211.1|  large subunit ribosomal protein 23                      214   6e-68   
ref|XP_002999938.1|  60S ribosomal protein L23                          214   7e-68   
gb|KIY66270.1|  ribosomal protein L14b/L23e                             214   8e-68   
gb|ACV21026.1|  large subunit ribosomal protein 23                      214   8e-68   
gb|KIP11278.1|  hypothetical protein PHLGIDRAFT_124935                  214   9e-68   
gb|EFX03705.1|  60S ribosomal protein l23                               214   9e-68   
gb|EHL02311.1|  putative 60S ribosomal protein L23-B                    215   1e-67   
ref|XP_003352015.1|  60S ribosomal protein L23                          214   1e-67   
gb|ENH84580.1|  60s ribosomal protein l23                               214   1e-67   
ref|XP_007811836.1|  60S ribosomal protein L23                          214   1e-67   
gb|ACV21027.1|  large subunit ribosomal protein 23                      214   1e-67   
ref|XP_001912212.1|  hypothetical protein                               214   1e-67   
gb|KDQ27390.1|  hypothetical protein PLEOSDRAFT_1096799                 214   1e-67   
ref|XP_007398013.1|  hypothetical protein PHACADRAFT_259596             214   1e-67   
ref|XP_007773259.1|  ribosomal protein L17                              214   2e-67   
gb|KIL62790.1|  hypothetical protein M378DRAFT_165258                   213   2e-67   
emb|CAO94738.1|  putative ribosomal protein L23                         214   2e-67   
gb|ABR87202.1|  large subunit ribosomal protein 23                      213   2e-67   
ref|XP_009039226.1|  hypothetical protein AURANDRAFT_60218              213   2e-67   
ref|XP_007387328.1|  ribosomal protein L14b/L23e                        213   2e-67   
ref|XP_001221309.1|  60S ribosomal protein L23                          213   2e-67   
gb|ABR87207.1|  large subunit ribosomal protein 23                      213   2e-67   
ref|XP_003053865.1|  60S ribosomal protein L23                          213   2e-67   
gb|ACV21035.1|  large subunit ribosomal protein 23                      213   2e-67   
ref|XP_007307032.1|  ribosomal protein L14b/L23e                        213   2e-67   
emb|CEP12045.1|  hypothetical protein                                   213   3e-67   
gb|ACV21036.1|  large subunit ribosomal protein 23                      213   3e-67   
gb|KDR67686.1|  hypothetical protein GALMADRAFT_105644                  213   3e-67   
ref|XP_007612035.1|  PREDICTED: 60S ribosomal protein L23-like          213   3e-67   
gb|KIO32689.1|  hypothetical protein M407DRAFT_241358                   213   3e-67   
gb|ABR87215.1|  large subunit ribosomal protein 23                      213   3e-67   
ref|XP_003664773.1|  hypothetical protein MYCTH_71369                   213   3e-67   
ref|XP_009261336.1|  hypothetical protein FPSE_09944                    213   3e-67   
ref|XP_008830279.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    213   3e-67   
gb|EYU41354.1|  hypothetical protein MIMGU_mgv1a022252mg                212   3e-67   
gb|KEY68413.1|  hypothetical protein S7711_01189                        213   3e-67   
gb|KDN39728.1|  60S ribosomal protein L23                               213   3e-67   
gb|KIY52204.1|  ribosomal protein L14b/L23e                             213   3e-67   
gb|EPS99489.1|  hypothetical protein FOMPIDRAFT_1024157                 213   4e-67   
gb|ACV21030.1|  large subunit ribosomal protein 23                      213   4e-67   
gb|EPB84556.1|  60S ribosomal protein L23                               212   4e-67   
gb|ABR87212.1|  large subunit ribosomal protein 23                      213   4e-67   
gb|ACV21031.1|  large subunit ribosomal protein 23                      213   4e-67   
ref|XP_001421560.1|  Ribosomal protein L23, component of cytosoli...    213   4e-67   
gb|AHZ34807.1|  large subunit ribosomal protein 23                      213   4e-67   
ref|XP_002161668.2|  PREDICTED: 60S ribosomal protein L23-like          213   4e-67   
gb|AHW80358.1|  ribosomal protein                                       213   4e-67   
emb|CEG00280.1|  Ribosomal protein L14b/L23e                            213   5e-67   
ref|XP_001423803.1|  hypothetical protein                               213   5e-67   
ref|XP_006697696.1|  60S ribosomal protein l23-like protein             213   5e-67   
gb|EIE78087.1|  60S ribosomal protein L23                               212   6e-67   
gb|ACV21032.1|  large subunit ribosomal protein 23                      212   6e-67   
ref|XP_009011694.1|  hypothetical protein HELRODRAFT_156361             212   6e-67   
ref|XP_009494403.1|  50S ribosomal protein L23e, variant 1              212   7e-67   
gb|KII85559.1|  hypothetical protein PLICRDRAFT_94447                   212   7e-67   
gb|AAT38741.1|  60S ribosomal protein L23, putative                     211   7e-67   
gb|ABR87204.1|  large subunit ribosomal protein 23                      212   7e-67   
ref|XP_011116879.1|  hypothetical protein H072_11578                    214   7e-67   
gb|EJU05390.1|  ribosomal protein L14b/L23e                             212   7e-67   
gb|KFH47196.1|  60S ribosomal protein L23-B-like protein                212   7e-67   
ref|XP_007650928.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    212   7e-67   
ref|XP_001748762.1|  hypothetical protein                               220   7e-67   



>ref|XP_006298710.1| hypothetical protein CARUB_v10014805mg, partial [Capsella rubella]
 gb|EOA31608.1| hypothetical protein CARUB_v10014805mg, partial [Capsella rubella]
Length=161

 Score =   283 bits (723),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  33   AEGFTMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSA  212
            A+  TMSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSA
Sbjct  17   AKSATMSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSA  76

Query  213  CVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGS  392
            CVGDMVMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGS
Sbjct  77   CVGDMVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGS  136

Query  393  AITGPIGKECADLWPRIASAANAIV  467
            AITGPIGKECADLWPRIASAANAIV
Sbjct  137  AITGPIGKECADLWPRIASAANAIV  161



>ref|NP_001274965.1| ribosomal protein L17-like protein [Solanum tuberosum]
 ref|XP_002301852.1| hypothetical protein POPTR_0002s25930g [Populus trichocarpa]
 ref|XP_002312599.1| ribosomal protein L17 [Populus trichocarpa]
 ref|XP_002315585.1| 60S ribosomal protein L23 [Populus trichocarpa]
 ref|XP_003570378.1| PREDICTED: 60S ribosomal protein L23 [Brachypodium distachyon]
 ref|XP_003574026.1| PREDICTED: 60S ribosomal protein L23 [Brachypodium distachyon]
 ref|XP_004240479.1| PREDICTED: 60S ribosomal protein L23 [Solanum lycopersicum]
 ref|XP_004242371.1| PREDICTED: 60S ribosomal protein L23 [Solanum lycopersicum]
 ref|XP_004247766.1| PREDICTED: 60S ribosomal protein L23 [Solanum lycopersicum]
 ref|XP_006358421.1| PREDICTED: 60S ribosomal protein L23-like [Solanum tuberosum]
 ref|XP_006364561.1| PREDICTED: 60S ribosomal protein L23-like [Solanum tuberosum]
 ref|XP_006387328.1| hypothetical protein POPTR_1243s00200g [Populus trichocarpa]
 ref|XP_006420330.1| hypothetical protein CICLE_v10006177mg [Citrus clementina]
 ref|XP_006443749.1| hypothetical protein CICLE_v10022774mg [Citrus clementina]
 ref|XP_006479455.1| PREDICTED: 60S ribosomal protein L23-like [Citrus sinensis]
 ref|XP_006489646.1| PREDICTED: 60S ribosomal protein L23-like [Citrus sinensis]
 ref|XP_009627849.1| PREDICTED: 60S ribosomal protein L23-like [Nicotiana tomentosiformis]
 ref|XP_009788852.1| PREDICTED: 60S ribosomal protein L23-like [Nicotiana sylvestris]
 ref|XP_010069106.1| PREDICTED: 60S ribosomal protein L23 [Eucalyptus grandis]
 ref|XP_010023855.1| PREDICTED: 60S ribosomal protein L23 isoform X1 [Eucalyptus grandis]
 ref|XP_010326636.1| PREDICTED: 60S ribosomal protein L23 [Solanum lycopersicum]
 ref|XP_010670947.1| PREDICTED: 60S ribosomal protein L23 [Beta vulgaris subsp. vulgaris]
 ref|XP_010684890.1| PREDICTED: 60S ribosomal protein L23 [Beta vulgaris subsp. vulgaris]
 ref|XP_011024466.1| PREDICTED: 60S ribosomal protein L23 [Populus euphratica]
 ref|XP_011013441.1| PREDICTED: 60S ribosomal protein L23 [Populus euphratica]
 pdb|3J61|V Chain V, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50991.1| ribosomal protein L17 [Triticum aestivum]
 gb|ABA46769.1| ribosomal protein L17-like protein [Solanum tuberosum]
 gb|ABK92687.1| unknown [Populus trichocarpa]
 gb|ABK93001.1| unknown [Populus trichocarpa]
 gb|ABK93527.1| unknown [Populus trichocarpa]
 gb|ABK93531.1| unknown [Populus trichocarpa]
 gb|ABK94078.1| unknown [Populus trichocarpa]
 gb|ABK95413.1| unknown [Populus trichocarpa]
 gb|EEE81125.1| hypothetical protein POPTR_0002s25930g [Populus trichocarpa]
 gb|EEE89966.1| ribosomal protein L17 [Populus trichocarpa]
 gb|EEF01756.1| 60S ribosomal protein L23 [Populus trichocarpa]
 dbj|BAJ86704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50725.1| 60S ribosomal protein L23 [Triticum urartu]
 gb|EMS59771.1| 60S ribosomal protein L23 [Triticum urartu]
 gb|EMT11203.1| 60S ribosomal protein L23 [Aegilops tauschii]
 gb|ERP46242.1| hypothetical protein POPTR_1243s00200g [Populus trichocarpa]
 gb|ESR33570.1| hypothetical protein CICLE_v10006177mg [Citrus clementina]
 gb|ESR56989.1| hypothetical protein CICLE_v10022774mg [Citrus clementina]
 gb|KCW57341.1| hypothetical protein EUGRSUZ_H00134 [Eucalyptus grandis]
 gb|KCW57342.1| hypothetical protein EUGRSUZ_H00134 [Eucalyptus grandis]
 gb|KDO43339.1| hypothetical protein CISIN_1g032476mg [Citrus sinensis]
Length=140

 Score =   281 bits (720),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>gb|AAP80667.1|AF479048_1 ribosomal Pr 117, partial [Triticum aestivum]
Length=147

 Score =   281 bits (720),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  45   TMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD  224
            +MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD
Sbjct  7    SMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD  66

Query  225  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG  404
            MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG
Sbjct  67   MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG  126

Query  405  PIGKECADLWPRIASAANAIV  467
            PIGKECADLWPRIASAANAIV
Sbjct  127  PIGKECADLWPRIASAANAIV  147



>emb|CDY59177.1| BnaC08g50110D [Brassica napus]
Length=167

 Score =   281 bits (720),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  45   TMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD  224
            TMSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD
Sbjct  27   TMSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD  86

Query  225  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG  404
            MVMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG
Sbjct  87   MVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG  146

Query  405  PIGKECADLWPRIASAANAIV  467
            PIGKECADLWPRIASAANAIV
Sbjct  147  PIGKECADLWPRIASAANAIV  167



>ref|NP_001048495.1| Os02g0814700 [Oryza sativa Japonica Group]
 ref|NP_001048912.1| Os03g0139100 [Oryza sativa Japonica Group]
 ref|NP_001064806.1| Os10g0466700 [Oryza sativa Japonica Group]
 ref|NP_001132424.1| uncharacterized protein LOC100193874 [Zea mays]
 ref|NP_001132737.1| uncharacterized protein LOC100194224 [Zea mays]
 ref|NP_001148342.1| 60S ribosomal protein L23 [Zea mays]
 ref|NP_001149366.1| 60S ribosomal protein L23 [Zea mays]
 ref|NP_001159003.1| 60S ribosomal protein L23 [Zea mays]
 ref|XP_002285443.1| PREDICTED: 60S ribosomal protein L23 [Vitis vinifera]
 ref|XP_002526555.1| 60S ribosomal protein L23, putative [Ricinus communis]
 ref|XP_002528364.1| 60S ribosomal protein L23, putative [Ricinus communis]
 ref|XP_006648099.1| PREDICTED: 60S ribosomal protein L23-like [Oryza brachyantha]
 ref|XP_006649375.1| PREDICTED: 60S ribosomal protein L23-like [Oryza brachyantha]
 ref|XP_006661847.1| PREDICTED: 60S ribosomal protein L23-like [Oryza brachyantha]
 ref|XP_008796917.1| PREDICTED: 60S ribosomal protein L23 [Phoenix dactylifera]
 ref|XP_008796374.1| PREDICTED: 60S ribosomal protein L23 [Phoenix dactylifera]
 ref|XP_008799638.1| PREDICTED: 60S ribosomal protein L23 [Phoenix dactylifera]
 ref|XP_008807448.1| PREDICTED: 60S ribosomal protein L23 [Phoenix dactylifera]
 ref|XP_009405895.1| PREDICTED: 60S ribosomal protein L23 [Musa acuminata subsp. malaccensis]
 ref|XP_009395487.1| PREDICTED: 60S ribosomal protein L23 [Musa acuminata subsp. malaccensis]
 ref|XP_010927527.1| PREDICTED: 60S ribosomal protein L23 [Elaeis guineensis]
 ref|XP_010932241.1| PREDICTED: 60S ribosomal protein L23 [Elaeis guineensis]
 ref|XP_010936032.1| PREDICTED: 60S ribosomal protein L23 [Elaeis guineensis]
 ref|XP_010936033.1| PREDICTED: 60S ribosomal protein L23 [Elaeis guineensis]
 ref|XP_010940715.1| PREDICTED: 60S ribosomal protein L23 [Elaeis guineensis]
 gb|AAK27802.1|AC022457_5 60S ribosomal protein L17 [Oryza sativa Japonica Group]
 gb|AAP54196.1| 60S ribosomal protein L23, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAD21668.1| 60S ribosomal protein L17 [Oryza sativa Japonica Group]
 gb|ABF93884.1| 60S ribosomal protein L23, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10409.1| Os02g0814700 [Oryza sativa Japonica Group]
 dbj|BAF10826.1| Os03g0139100 [Oryza sativa Japonica Group]
 dbj|BAF26720.1| Os10g0466700 [Oryza sativa Japonica Group]
 gb|EAY78853.1| hypothetical protein OsI_33956 [Oryza sativa Indica Group]
 gb|EAZ16370.1| hypothetical protein OsJ_31833 [Oryza sativa Japonica Group]
 gb|ACF81257.1| unknown [Zea mays]
 gb|ACG24604.1| 60S ribosomal protein L23 [Zea mays]
 gb|ACG25457.1| 60S ribosomal protein L23 [Zea mays]
 gb|ACG30872.1| 60S ribosomal protein L23 [Zea mays]
 gb|ACG31002.1| 60S ribosomal protein L23 [Zea mays]
 gb|ACG33188.1| 60S ribosomal protein L23 [Zea mays]
 gb|ACG33222.1| 60S ribosomal protein L23 [Zea mays]
 gb|ACG35070.1| 60S ribosomal protein L23 [Zea mays]
 gb|ACG35168.1| 60S ribosomal protein L23 [Zea mays]
 gb|ACG37821.1| 60S ribosomal protein L23 [Zea mays]
 gb|ACG39991.1| 60S ribosomal protein L23 [Zea mays]
 dbj|BAG99967.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74230.1| hypothetical protein OsI_09417 [Oryza sativa Indica Group]
 gb|EEE58034.1| hypothetical protein OsJ_08852 [Oryza sativa Japonica Group]
 gb|EEF34036.1| 60S ribosomal protein L23, putative [Ricinus communis]
 gb|EEF35833.1| 60S ribosomal protein L23, putative [Ricinus communis]
 gb|ACN27514.1| unknown [Zea mays]
 gb|ADB93064.1| 60S ribosomal protein L17 [Jatropha curcas]
 emb|CBI23709.3| unnamed protein product [Vitis vinifera]
 emb|CBI37175.3| unnamed protein product [Vitis vinifera]
 gb|ADR71276.1| 60S ribosomal protein L23A [Hevea brasiliensis]
 gb|ADR71277.1| 60S ribosomal protein L23B [Hevea brasiliensis]
 gb|AFW64023.1| 60S ribosomal protein L23 [Zea mays]
 gb|AFW74001.1| 60S ribosomal protein L23 [Zea mays]
 gb|AFW89629.1| 60S ribosomal protein L23 [Zea mays]
 tpg|DAA43286.1| TPA: 60S ribosomal protein L23 [Zea mays]
 gb|KDP26479.1| hypothetical protein JCGZ_17637 [Jatropha curcas]
 gb|KDP40385.1| hypothetical protein JCGZ_02383 [Jatropha curcas]
 emb|CDP03787.1| unnamed protein product [Coffea canephora]
 emb|CDO99293.1| unnamed protein product [Coffea canephora]
Length=140

 Score =   280 bits (717),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_009621521.1| PREDICTED: 60S ribosomal protein L23 [Nicotiana tomentosiformis]
 ref|XP_009599674.1| PREDICTED: 60S ribosomal protein L23 [Nicotiana tomentosiformis]
 ref|XP_009775264.1| PREDICTED: 60S ribosomal protein L23 [Nicotiana sylvestris]
Length=140

 Score =   280 bits (717),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAAT+NCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATINCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAV+VRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVVVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_004296407.1| PREDICTED: 60S ribosomal protein L23 [Fragaria vesca subsp. vesca]
 ref|XP_004486225.1| PREDICTED: 60S ribosomal protein L23-like [Cicer arietinum]
 ref|XP_004493817.1| PREDICTED: 60S ribosomal protein L23-like [Cicer arietinum]
 ref|XP_004495066.1| PREDICTED: 60S ribosomal protein L23-like [Cicer arietinum]
 ref|XP_007144856.1| hypothetical protein PHAVU_007G189900g [Phaseolus vulgaris]
 ref|XP_007162592.1| hypothetical protein PHAVU_001G164200g [Phaseolus vulgaris]
 ref|XP_007207356.1| hypothetical protein PRUPE_ppa013091mg [Prunus persica]
 ref|XP_007227549.1| hypothetical protein PRUPE_ppa013088mg [Prunus persica]
 ref|XP_008218349.1| PREDICTED: 60S ribosomal protein L23 [Prunus mume]
 ref|XP_008224171.1| PREDICTED: 60S ribosomal protein L23 [Prunus mume]
 ref|XP_008340651.1| PREDICTED: 60S ribosomal protein L23 [Malus domestica]
 ref|XP_009357984.1| PREDICTED: 60S ribosomal protein L23 [Pyrus x bretschneideri]
 ref|XP_009334189.1| PREDICTED: 60S ribosomal protein L23 [Pyrus x bretschneideri]
 ref|XP_009343781.1| PREDICTED: 60S ribosomal protein L23 [Pyrus x bretschneideri]
 gb|AAK25758.1|AF334838_1 ribosomal protein L17 [Castanea sativa]
 gb|AFK34301.1| unknown [Lotus japonicus]
 gb|EMJ08555.1| hypothetical protein PRUPE_ppa013091mg [Prunus persica]
 gb|EMJ28748.1| hypothetical protein PRUPE_ppa013088mg [Prunus persica]
 gb|ESW16850.1| hypothetical protein PHAVU_007G189900g [Phaseolus vulgaris]
 gb|ESW34586.1| hypothetical protein PHAVU_001G164200g [Phaseolus vulgaris]
Length=140

 Score =   280 bits (716),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_006354439.1| PREDICTED: 60S ribosomal protein L23-like [Solanum tuberosum]
 gb|EYU32583.1| hypothetical protein MIMGU_mgv1a015942mg [Erythranthe guttata]
 gb|EYU46406.1| hypothetical protein MIMGU_mgv1a015943mg [Erythranthe guttata]
Length=140

 Score =   280 bits (716),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_009111101.1| PREDICTED: 60S ribosomal protein L23-like [Brassica rapa]
 ref|XP_009118642.1| PREDICTED: 60S ribosomal protein L23-like [Brassica rapa]
 emb|CDY53193.1| BnaAnng12180D [Brassica napus]
 emb|CDY15508.1| BnaA08g27920D [Brassica napus]
Length=140

 Score =   280 bits (715),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_002464505.1| hypothetical protein SORBIDRAFT_01g019770 [Sorghum bicolor]
 ref|XP_002468543.1| hypothetical protein SORBIDRAFT_01g047680 [Sorghum bicolor]
 ref|XP_002453026.1| hypothetical protein SORBIDRAFT_04g036970 [Sorghum bicolor]
 ref|XP_004954346.1| PREDICTED: 60S ribosomal protein L23-like [Setaria italica]
 ref|XP_004982926.1| PREDICTED: 60S ribosomal protein L23-like [Setaria italica]
 ref|XP_004985770.1| PREDICTED: 60S ribosomal protein L23-like [Setaria italica]
 ref|XP_009396104.1| PREDICTED: 60S ribosomal protein L23 [Musa acuminata subsp. malaccensis]
 ref|XP_009414980.1| PREDICTED: 60S ribosomal protein L23 [Musa acuminata subsp. malaccensis]
 ref|XP_009418495.1| PREDICTED: 60S ribosomal protein L23 [Musa acuminata subsp. malaccensis]
 ref|XP_009382680.1| PREDICTED: 60S ribosomal protein L23 [Musa acuminata subsp. malaccensis]
 ref|XP_010264899.1| PREDICTED: 60S ribosomal protein L23 [Nelumbo nucifera]
 ref|XP_010264900.1| PREDICTED: 60S ribosomal protein L23 [Nelumbo nucifera]
 ref|XP_011080107.1| PREDICTED: 60S ribosomal protein L23 [Sesamum indicum]
 ref|XP_011091247.1| PREDICTED: 60S ribosomal protein L23 [Sesamum indicum]
 gb|EER91503.1| hypothetical protein SORBIDRAFT_01g019770 [Sorghum bicolor]
 gb|EER95541.1| hypothetical protein SORBIDRAFT_01g047680 [Sorghum bicolor]
 gb|EES06002.1| hypothetical protein SORBIDRAFT_04g036970 [Sorghum bicolor]
Length=140

 Score =   280 bits (715),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>gb|KCW60243.1| hypothetical protein EUGRSUZ_H02959 [Eucalyptus grandis]
Length=211

 Score =   282 bits (721),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  72   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  131

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  132  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  191

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  192  IGKECADLWPRIASAANAIV  211



>ref|NP_001235125.1| uncharacterized protein LOC100306699 [Glycine max]
 ref|XP_003521308.1| PREDICTED: 60S ribosomal protein L23-like [Glycine max]
 ref|XP_003542437.1| PREDICTED: 60S ribosomal protein L23-like isoform 1 [Glycine 
max]
 ref|XP_003554300.1| PREDICTED: 60S ribosomal protein L23-like [Glycine max]
 ref|XP_007035241.1| Ribosomal protein L14p/L23e family protein [Theobroma cacao]
 ref|XP_007050184.1| Ribosomal protein L14p/L23e family protein [Theobroma cacao]
 gb|ACU15002.1| unknown [Glycine max]
 gb|EOX94341.1| Ribosomal protein L14p/L23e family protein [Theobroma cacao]
 gb|EOY06167.1| Ribosomal protein L14p/L23e family protein [Theobroma cacao]
 gb|KHG01739.1| 60S ribosomal L23 -like protein [Gossypium arboreum]
 gb|KHG06216.1| 60S ribosomal L23 -like protein [Gossypium arboreum]
 gb|KHG06457.1| 60S ribosomal L23 -like protein [Gossypium arboreum]
 gb|KHG12720.1| 60S ribosomal L23 -like protein [Gossypium arboreum]
 gb|KHG15341.1| 60S ribosomal L23 -like protein [Gossypium arboreum]
 gb|KHN05881.1| 60S ribosomal protein L23 [Glycine soja]
 gb|KHN10775.1| 60S ribosomal protein L23 [Glycine soja]
 gb|KHN48939.1| 60S ribosomal protein L23 [Glycine soja]
 gb|KJB10025.1| hypothetical protein B456_001G180900 [Gossypium raimondii]
 gb|KJB28526.1| hypothetical protein B456_005G053300 [Gossypium raimondii]
 gb|KJB38359.1| hypothetical protein B456_006G251500 [Gossypium raimondii]
 gb|KJB42355.1| hypothetical protein B456_007G149400 [Gossypium raimondii]
 gb|KJB72436.1| hypothetical protein B456_011G178500 [Gossypium raimondii]
Length=140

 Score =   279 bits (714),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>gb|ABK23460.1| unknown [Picea sitchensis]
 gb|ABK24404.1| unknown [Picea sitchensis]
 gb|ABK26350.1| unknown [Picea sitchensis]
 gb|ABR17239.1| unknown [Picea sitchensis]
 gb|ACN40083.1| unknown [Picea sitchensis]
 gb|ACN40310.1| unknown [Picea sitchensis]
 gb|ACN40455.1| unknown [Picea sitchensis]
 gb|ACN40739.1| unknown [Picea sitchensis]
 gb|ACN40998.1| unknown [Picea sitchensis]
Length=140

 Score =   279 bits (714),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLP+ACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPAACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_004289983.1| PREDICTED: 60S ribosomal protein L23-like [Fragaria vesca subsp. 
vesca]
Length=140

 Score =   279 bits (714),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAAT+NCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATINCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAV+VRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVVVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_004140575.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
 ref|XP_004147166.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
 ref|XP_004157585.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
 ref|XP_004160577.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
 ref|XP_004170097.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
 ref|XP_008447383.1| PREDICTED: 60S ribosomal protein L23 [Cucumis melo]
 ref|XP_008459953.1| PREDICTED: 60S ribosomal protein L23 [Cucumis melo]
 ref|XP_008460685.1| PREDICTED: 60S ribosomal protein L23 [Cucumis melo]
 gb|KGN58294.1| hypothetical protein Csa_3G608730 [Cucumis sativus]
 gb|KGN61566.1| Ribosomal protein L17 [Cucumis sativus]
Length=140

 Score =   279 bits (713),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 139/139 (100%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            IGKECADLWPRIASAANAI
Sbjct  121  IGKECADLWPRIASAANAI  139



>gb|EPS68554.1| hypothetical protein M569_06215, partial [Genlisea aurea]
Length=140

 Score =   279 bits (713),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 139/139 (100%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGI+GRLNRLPSACVGDM
Sbjct  2    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIQGRLNRLPSACVGDM  61

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  62   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  121

Query  408  IGKECADLWPRIASAANAI  464
            IGKECADLWPRIASAANAI
Sbjct  122  IGKECADLWPRIASAANAI  140



>gb|ACG48540.1| 60S ribosomal protein L23 [Zea mays]
Length=140

 Score =   279 bits (713),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPS CVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSXCVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>gb|KHG28463.1| 60S ribosomal L23 -like protein [Gossypium arboreum]
Length=140

 Score =   278 bits (712),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDG++MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGIYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_009781617.1| PREDICTED: 60S ribosomal protein L23-like [Nicotiana sylvestris]
Length=140

 Score =   278 bits (712),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAAT+NCADNTGAKNLYIISVKGIK RLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATINCADNTGAKNLYIISVKGIKARLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAV+VRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVVVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|NP_180895.1| 60S ribosomal protein L23B [Arabidopsis thaliana]
 ref|NP_187090.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 ref|NP_563707.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 ref|XP_002881278.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002882349.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889509.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006295201.1| hypothetical protein CARUB_v10024281mg [Capsella rubella]
 ref|XP_006304841.1| hypothetical protein CARUB_v10012532mg [Capsella rubella]
 ref|XP_006418124.1| hypothetical protein EUTSA_v10009056mg [Eutrema salsugineum]
 ref|XP_006408189.1| hypothetical protein EUTSA_v10021724mg [Eutrema salsugineum]
 ref|XP_006410476.1| hypothetical protein EUTSA_v10017398mg [Eutrema salsugineum]
 ref|XP_009123995.1| PREDICTED: 60S ribosomal protein L23 [Brassica rapa]
 ref|XP_010414847.1| PREDICTED: 60S ribosomal protein L23 [Camelina sativa]
 ref|XP_010483863.1| PREDICTED: 60S ribosomal protein L23 [Camelina sativa]
 ref|XP_010509899.1| PREDICTED: 60S ribosomal protein L23 [Camelina sativa]
 ref|XP_010413881.1| PREDICTED: 60S ribosomal protein L23 [Camelina sativa]
 ref|XP_010457497.1| PREDICTED: 60S ribosomal protein L23 [Camelina sativa]
 ref|XP_010463918.1| PREDICTED: 60S ribosomal protein L23 [Camelina sativa]
 ref|XP_010469484.1| PREDICTED: 60S ribosomal protein L23 [Camelina sativa]
 ref|XP_010475108.1| PREDICTED: 60S ribosomal protein L23 [Camelina sativa]
 ref|XP_010485817.1| PREDICTED: 60S ribosomal protein L23 [Camelina sativa]
 ref|XP_010549656.1| PREDICTED: 60S ribosomal protein L23 [Tarenaya hassleriana]
 sp|P49690.3|RL23_ARATH RecName: Full=60S ribosomal protein L23; AltName: Full=Protein 
EMBRYO DEFECTIVE 2171 [Arabidopsis thaliana]
 gb|AAB80655.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gb|AAF63771.1| ribosomal protein L17, putative [Arabidopsis thaliana]
 gb|AAK68783.1| 60S ribosomal protein L17 [Arabidopsis thaliana]
 gb|AAK96699.1| Strong similarity to 60S ribosomal protein L17 [Arabidopsis thaliana]
 gb|AAL66896.1| unknown protein [Arabidopsis thaliana]
 gb|AAM10239.1| similar to 60S ribosomal protein L17 [Arabidopsis thaliana]
 gb|AAM63901.1| putative 60S ribosomal protein L17 [Arabidopsis thaliana]
 gb|AAM65768.1| putative 60S ribosomal protein L17 [Arabidopsis thaliana]
 gb|ABF59023.1| At2g33370 [Arabidopsis thaliana]
 gb|EFH57537.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58608.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65768.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 gb|AEC08824.1| 60S ribosomal protein L23B [Arabidopsis thaliana]
 gb|AEE27702.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gb|AEE74076.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gb|EOA28099.1| hypothetical protein CARUB_v10024281mg [Capsella rubella]
 gb|EOA37739.1| hypothetical protein CARUB_v10012532mg [Capsella rubella]
 gb|ESQ36477.1| hypothetical protein EUTSA_v10009056mg [Eutrema salsugineum]
 gb|ESQ49642.1| hypothetical protein EUTSA_v10021724mg [Eutrema salsugineum]
 gb|ESQ51929.1| hypothetical protein EUTSA_v10017398mg [Eutrema salsugineum]
 gb|KFK31053.1| hypothetical protein AALP_AA6G062200 [Arabis alpina]
 gb|KFK37860.1| hypothetical protein AALP_AA3G038600 [Arabis alpina]
 gb|KFK42786.1| hypothetical protein AALP_AA1G039100 [Arabis alpina]
 emb|CDY18235.1| BnaC05g02580D [Brassica napus]
 emb|CDX92068.1| BnaC03g33700D [Brassica napus]
 emb|CDX74191.1| BnaA03g28560D [Brassica napus]
Length=140

 Score =   278 bits (712),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_003558849.1| PREDICTED: 60S ribosomal protein L23-like [Brachypodium distachyon]
 dbj|BAK05203.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS56602.1| 60S ribosomal protein L23 [Triticum urartu]
 gb|EMT12421.1| 60S ribosomal protein L23 [Aegilops tauschii]
Length=140

 Score =   278 bits (711),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVI+RQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIIRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKECADLWPRIAS ANAIV
Sbjct  121  VGKECADLWPRIASNANAIV  140



>gb|ABK22634.1| unknown [Picea sitchensis]
Length=140

 Score =   278 bits (711),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNR+P+ACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRIPAACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_010089213.1| 60S ribosomal protein L23 [Morus notabilis]
 gb|EXB37491.1| 60S ribosomal protein L23 [Morus notabilis]
Length=140

 Score =   278 bits (711),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV+PAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_009334207.1| PREDICTED: 60S ribosomal protein L23-like [Pyrus x bretschneideri]
Length=140

 Score =   278 bits (710),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPV ATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVPATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_009395287.1| PREDICTED: 60S ribosomal protein L23-like [Musa acuminata subsp. 
malaccensis]
Length=140

 Score =   278 bits (710),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AGNKFRMSL LPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTAGNKFRMSLALPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_010542959.1| PREDICTED: 60S ribosomal protein L23-like [Tarenaya hassleriana]
 ref|XP_010556920.1| PREDICTED: 60S ribosomal protein L23-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010557302.1| PREDICTED: 60S ribosomal protein L23-like [Tarenaya hassleriana]
 ref|XP_010521797.1| PREDICTED: 60S ribosomal protein L23-like isoform X2 [Tarenaya 
hassleriana]
Length=140

 Score =   278 bits (710),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>sp|Q07760.1|RL23_TOBAC RecName: Full=60S ribosomal protein L23 [Nicotiana tabacum]
 gb|AAA34113.1| 60S ribosomal protein subunit L17 [Nicotiana tabacum]
Length=140

 Score =   278 bits (710),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAAT+NCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATINCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAV+VRQRKPWRRKDGVFMYFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVVVRQRKPWRRKDGVFMYFEDNAGVIVNAKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>gb|ACJ86039.1| unknown [Medicago truncatula]
 gb|AFK47997.1| unknown [Medicago truncatula]
 gb|AES81577.2| 60S ribosomal L23-like protein [Medicago truncatula]
 gb|KEH42478.1| 60S ribosomal L23-like protein [Medicago truncatula]
Length=140

 Score =   277 bits (708),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSAC GDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACAGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            I KECADLWPRIASAANAIV
Sbjct  121  IAKECADLWPRIASAANAIV  140



>emb|CDY42923.1| BnaC05g47280D [Brassica napus]
Length=140

 Score =   277 bits (708),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKG LNRLPSACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGHLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_003625359.1| 60S ribosomal protein L23 [Medicago truncatula]
Length=169

 Score =   278 bits (710),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSAC GDM
Sbjct  30   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACAGDM  89

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  90   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  149

Query  408  IGKECADLWPRIASAANAIV  467
            I KECADLWPRIASAANAIV
Sbjct  150  IAKECADLWPRIASAANAIV  169



>gb|AAM67199.1| putative 60S ribosomal protein L17 [Arabidopsis thaliana]
Length=140

 Score =   276 bits (707),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKG+MKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGDMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|NP_001140843.1| uncharacterized protein LOC100272919 [Zea mays]
 gb|ACF84782.1| unknown [Zea mays]
 gb|ACG30037.1| 60S ribosomal protein L23 [Zea mays]
 gb|AFW68630.1| 60S ribosomal protein L23 [Zea mays]
Length=140

 Score =   276 bits (706),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRK WRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKLWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_009119294.1| PREDICTED: 60S ribosomal protein L23 [Brassica rapa]
Length=140

 Score =   276 bits (705),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKP RRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPGRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>gb|ABX75541.1| 60S ribosomal protein L17-like protein [Panax ginseng]
Length=138

 Score =   276 bits (705),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/138 (99%), Positives = 138/138 (100%), Gaps = 0/138 (0%)
 Frame = +3

Query  54   KRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVM  233
            KRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVM
Sbjct  1    KRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVM  60

Query  234  ATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIG  413
            ATVKKGKP+LRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIG
Sbjct  61   ATVKKGKPELRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIG  120

Query  414  KECADLWPRIASAANAIV  467
            KECADLWPRIASAANAIV
Sbjct  121  KECADLWPRIASAANAIV  138



>ref|XP_011041429.1| PREDICTED: 60S ribosomal protein L23-like [Populus euphratica]
Length=140

 Score =   275 bits (704),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVN ADNTGAK LYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNFADNTGAKKLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_011029764.1| PREDICTED: 60S ribosomal protein L23-like [Populus euphratica]
Length=140

 Score =   273 bits (699),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSAC GDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACFGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKPD RK+V+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VLATVKKGKPDRRKRVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_009134763.1| PREDICTED: 60S ribosomal protein L23-like [Brassica rapa]
Length=140

 Score =   273 bits (698),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMA VKKGK DLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMANVKKGKNDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_010558737.1| PREDICTED: 60S ribosomal protein L23-like isoform X2 [Tarenaya 
hassleriana]
Length=140

 Score =   273 bits (697),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVA  VNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAGPVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_009614473.1| PREDICTED: 60S ribosomal protein L23-like isoform X1 [Nicotiana 
tomentosiformis]
Length=140

 Score =   272 bits (696),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M KRGRGGSAGNKFRMSLGLPVAATVNCADNTGA+NLYIISVKGIKGRLNRLP ACV DM
Sbjct  1    MPKRGRGGSAGNKFRMSLGLPVAATVNCADNTGARNLYIISVKGIKGRLNRLPPACVVDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_004152000.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
Length=140

 Score =   272 bits (695),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKV+PAVI RQ  PW RKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVLPAVIARQSNPWHRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            IGKECADLWPRIASAANAI
Sbjct  121  IGKECADLWPRIASAANAI  139



>ref|XP_001754766.1| predicted protein [Physcomitrella patens]
 ref|XP_001765143.1| predicted protein [Physcomitrella patens]
 ref|XP_001769430.1| predicted protein [Physcomitrella patens]
 ref|XP_001780511.1| predicted protein [Physcomitrella patens]
 gb|EDQ54712.1| predicted protein [Physcomitrella patens]
 gb|EDQ65799.1| predicted protein [Physcomitrella patens]
 gb|EDQ70138.1| predicted protein [Physcomitrella patens]
 gb|EDQ80220.1| predicted protein [Physcomitrella patens]
Length=140

 Score =   271 bits (693),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+GNKFRMSLGLPV A VNCADNTGAKNLY+ISVKG+KGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGNKFRMSLGLPVGAVVNCADNTGAKNLYVISVKGVKGRLNRLPAAAVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>gb|AAB70426.1| Strong similarity to 60S ribosomal protein L17 (gb|X01694). EST 
gb|AA042332 comes from this gene [Arabidopsis thaliana]
Length=157

 Score =   271 bits (694),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT
Sbjct  22   GRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  81

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE
Sbjct  82   VKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  141

Query  420  CADLWPRIASAANAIV  467
            CADLWPRIASAANAIV
Sbjct  142  CADLWPRIASAANAIV  157



>gb|ABY56104.1| ribosomal protein [Cucumis sativus]
Length=161

 Score =   271 bits (694),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/135 (99%), Positives = 135/135 (100%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT
Sbjct  26   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  85

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKPDLRKKV+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE
Sbjct  86   VKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  145

Query  420  CADLWPRIASAANAI  464
            CADLWPRIASAANAI
Sbjct  146  CADLWPRIASAANAI  160



>ref|XP_010521796.1| PREDICTED: 60S ribosomal protein L23-like isoform X1 [Tarenaya 
hassleriana]
Length=151

 Score =   270 bits (691),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT
Sbjct  16   GRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  75

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKPDLRKKV+PAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGPIGKE
Sbjct  76   VKKGKPDLRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGPIGKE  135

Query  420  CADLWPRIASAANAIV  467
            CADLWPRIASAANAIV
Sbjct  136  CADLWPRIASAANAIV  151



>ref|XP_001763615.1| predicted protein [Physcomitrella patens]
 gb|EDQ71505.1| predicted protein [Physcomitrella patens]
Length=140

 Score =   270 bits (690),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPV A VNCADNTGAKNLY+ISVKG+KGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGASGNKFRMSLGLPVGAVVNCADNTGAKNLYVISVKGVKGRLNRLPAAAVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_001755040.1| predicted protein [Physcomitrella patens]
 gb|EDQ79984.1| predicted protein [Physcomitrella patens]
Length=140

 Score =   268 bits (684),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+GNKFRMSLGLPV A VNCADNTGAKNLY+ISVKG+KGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGNKFRMSLGLPVGAVVNCADNTGAKNLYVISVKGVKGRLNRLPAAAVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKD VFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDCVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>gb|AAC32130.1| 60S ribosomal protein L17 [Picea mariana]
Length=133

 Score =   266 bits (680),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/133 (98%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = +3

Query  69   GSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK  248
            GSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLP+ACVGDMVMATVKK
Sbjct  1    GSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPAACVGDMVMATVKK  60

Query  249  GKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECAD  428
            GKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGPIGKECAD
Sbjct  61   GKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGPIGKECAD  120

Query  429  LWPRIASAANAIV  467
            LWPRIASAANAIV
Sbjct  121  LWPRIASAANAIV  133



>ref|XP_002963106.1| hypothetical protein SELMODRAFT_165708 [Selaginella moellendorffii]
 ref|XP_002980218.1| hypothetical protein SELMODRAFT_228682 [Selaginella moellendorffii]
 gb|EFJ18478.1| hypothetical protein SELMODRAFT_228682 [Selaginella moellendorffii]
 gb|EFJ36569.1| hypothetical protein SELMODRAFT_165708 [Selaginella moellendorffii]
Length=140

 Score =   265 bits (677),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKR RG ++GNKFRMSLGLPV A VNCADNTGAKNLYIISVKG+KGRLNRLP+A +GDM
Sbjct  1    MSKRARGAASGNKFRMSLGLPVGAVVNCADNTGAKNLYIISVKGVKGRLNRLPAAAIGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKP+RRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPYRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_009124996.1| PREDICTED: 60S ribosomal protein L23-like [Brassica rapa]
Length=140

 Score =   264 bits (675),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRL RL SACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLYRLSSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMA VKKGKPDLRKKV+P VIVRQR+PWRRK GVFMYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMANVKKGKPDLRKKVLPDVIVRQREPWRRKYGVFMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  121  IGKECADLWPRIASAANAIV  140



>ref|XP_001763682.1| predicted protein [Physcomitrella patens]
 gb|EDQ71572.1| predicted protein, partial [Physcomitrella patens]
Length=136

 Score =   262 bits (670),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGG++GNKFRMSLGLPV A VNCADNTGAKNLY+ISVKG+KGRLNRLP+A VGDMVMAT
Sbjct  1    GRGGASGNKFRMSLGLPVGAVVNCADNTGAKNLYVISVKGVKGRLNRLPAAAVGDMVMAT  60

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE
Sbjct  61   VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  120

Query  420  CADLWPRIASAANAIV  467
            CADLWPRIASAANAIV
Sbjct  121  CADLWPRIASAANAIV  136



>ref|XP_010556919.1| PREDICTED: 60S ribosomal protein L23-like isoform X1 [Tarenaya 
hassleriana]
Length=180

 Score =   261 bits (667),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 140/180 (78%), Gaps = 40/180 (22%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMK-------  386
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMK       
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGINQSES  120

Query  387  ---------------------------------GSAITGPIGKECADLWPRIASAANAIV  467
                                             GSAITGPIGKECADLWPRIASAANAIV
Sbjct  121  YKTLRSVSLSSVLVIIWQLFLHKSMKYPIFHLTGSAITGPIGKECADLWPRIASAANAIV  180



>sp|Q9XEK8.1|RL23_TORRU RecName: Full=60S ribosomal protein L23; AltName: Full=L17 [Syntrichia 
ruralis]
 gb|AAD23966.1|AF108726_1 ribosomal protein L17 [Syntrichia ruralis]
Length=139

 Score =   257 bits (657),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 133/140 (95%), Gaps = 1/140 (1%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+GNKFRMSLGLPV A VNCADNTGAKNLY+IS  G++GRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGNKFRMSLGLPVGAVVNCADNTGAKNLYVIS-SGVRGRLNRLPAAAVGDM  59

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEM  SAITGP
Sbjct  60   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMNPSAITGP  119

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  120  IGKECADLWPRIASAANAIV  139



>gb|KHN02473.1| 60S ribosomal protein L23 [Glycine soja]
Length=131

 Score =   255 bits (652),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 131/140 (94%), Gaps = 9/140 (6%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKK         RKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKK---------RKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  111

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  112  IGKECADLWPRIASAANAIV  131



>gb|EXX60184.1| ribosomal 60S subunit protein L23B [Rhizophagus irregularis DAOM 
197198w]
Length=140

 Score =   255 bits (652),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRM+LGLPV A +NCADN+GAKNLY+ISVKGI GRLNRLP+A VGDM
Sbjct  1    MSKRGRGGASGNKFRMTLGLPVGAVMNCADNSGAKNLYVISVKGIHGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAV++RQRKPWRRKDGVF+YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVVIRQRKPWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKECADLWPRIAS++  +V
Sbjct  121  VGKECADLWPRIASSSGTVV  140



>gb|EMT07675.1| 60S ribosomal protein L23 [Aegilops tauschii]
Length=125

 Score =   252 bits (644),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA
Sbjct  61   VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  120

Query  453  ANAIV  467
            ANAIV
Sbjct  121  ANAIV  125



>gb|ACF81716.1| unknown [Zea mays]
 gb|ADR71278.1| 60S ribosomal protein L23C [Hevea brasiliensis]
Length=125

 Score =   251 bits (642),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/125 (99%), Positives = 125/125 (100%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            VMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA
Sbjct  61   VMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  120

Query  453  ANAIV  467
            ANAIV
Sbjct  121  ANAIV  125



>ref|NP_001189805.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gb|AEE74077.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
Length=125

 Score =   251 bits (642),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/125 (99%), Positives = 125/125 (100%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            V+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA
Sbjct  61   VLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  120

Query  453  ANAIV  467
            ANAIV
Sbjct  121  ANAIV  125



>gb|EYU32582.1| hypothetical protein MIMGU_mgv1a015942mg [Erythranthe guttata]
Length=125

 Score =   251 bits (641),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/125 (99%), Positives = 125/125 (100%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKP+LRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPELRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA
Sbjct  61   VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  120

Query  453  ANAIV  467
            ANAIV
Sbjct  121  ANAIV  125



>ref|XP_009773907.1| PREDICTED: 60S ribosomal protein L23-like isoform X3 [Nicotiana 
sylvestris]
Length=125

 Score =   251 bits (641),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/125 (99%), Positives = 125/125 (100%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAK+LYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKSLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA
Sbjct  61   VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  120

Query  453  ANAIV  467
            ANAIV
Sbjct  121  ANAIV  125



>ref|XP_010942115.1| PREDICTED: 60S ribosomal protein L23-like [Elaeis guineensis]
Length=125

 Score =   251 bits (640),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 125/125 (100%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            VMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRI+SA
Sbjct  61   VMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRISSA  120

Query  453  ANAIV  467
            ANAIV
Sbjct  121  ANAIV  125



>ref|XP_006857497.1| hypothetical protein AMTR_s00067p00206470 [Amborella trichopoda]
 gb|ERN18964.1| hypothetical protein AMTR_s00067p00206470 [Amborella trichopoda]
Length=125

 Score =   251 bits (640),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA
Sbjct  61   VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  120

Query  453  ANAIV  467
            AN I+
Sbjct  121  ANTII  125



>ref|XP_005651156.1| ribosomal protein L14b/L23e [Coccomyxa subellipsoidea C-169]
 gb|EIE26612.1| ribosomal protein L14b/L23e [Coccomyxa subellipsoidea C-169]
Length=141

 Score =   251 bits (641),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            SKRGRGG+AGNKFRMSLGLPV A +NCADNTGAKNLY+ISV G   RLNRLPSA  GDMV
Sbjct  3    SKRGRGGAAGNKFRMSLGLPVGAILNCADNTGAKNLYVISVVGWGARLNRLPSAACGDMV  62

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            MATVKKGKPDLRKKVMPAV+VRQRKPWRRKDGVF+YFEDNAGVIVNPKGEMKGSAITGP+
Sbjct  63   MATVKKGKPDLRKKVMPAVVVRQRKPWRRKDGVFIYFEDNAGVIVNPKGEMKGSAITGPV  122

Query  411  GKECADLWPRIASAANAIV  467
             KECADLWPRIASAAN+IV
Sbjct  123  AKECADLWPRIASAANSIV  141



>gb|KHG17588.1| 60S ribosomal L23 -like protein [Gossypium arboreum]
 gb|KJB28524.1| hypothetical protein B456_005G053300 [Gossypium raimondii]
 gb|KJB38360.1| hypothetical protein B456_006G251500 [Gossypium raimondii]
 gb|KJB72437.1| hypothetical protein B456_011G178500 [Gossypium raimondii]
 gb|KJB72438.1| hypothetical protein B456_011G178500 [Gossypium raimondii]
Length=125

 Score =   250 bits (639),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 125/125 (100%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            V+PAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA
Sbjct  61   VLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  120

Query  453  ANAIV  467
            ANAIV
Sbjct  121  ANAIV  125



>gb|KGN46379.1| hypothetical protein Csa_6G088070 [Cucumis sativus]
Length=125

 Score =   250 bits (638),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            V+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA
Sbjct  61   VLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  120

Query  453  ANAI  464
            ANAI
Sbjct  121  ANAI  124



>ref|XP_003625360.1| 60S ribosomal protein L23 [Medicago truncatula]
 gb|AES81578.1| 60S ribosomal L23-like protein [Medicago truncatula]
Length=125

 Score =   248 bits (634),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/125 (98%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSAC GDMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACAGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            V+PAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI KECADLWPRIASA
Sbjct  61   VLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIAKECADLWPRIASA  120

Query  453  ANAIV  467
            ANAIV
Sbjct  121  ANAIV  125



>gb|ACG32297.1| 60S ribosomal protein L23 [Zea mays]
Length=126

 Score =   248 bits (632),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKE  419
            IGKE
Sbjct  121  IGKE  124



>ref|XP_006824374.1| PREDICTED: 60S ribosomal protein L23-like [Saccoglossus kowalevskii]
Length=140

 Score =   246 bits (629),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A VNCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVVNCADNTGAKNLYIISVKGIKGRLNRLPAAAVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAVI+RQRKP+RRK+G+ +YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVIIRQRKPYRRKEGIVLYFEDNAGVIVNQKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_009614475.1| PREDICTED: 60S ribosomal protein L23-like isoform X3 [Nicotiana 
tomentosiformis]
Length=125

 Score =   246 bits (628),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/125 (98%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            MSLGLPVAATVNCADNTGA+NLYIISVKGIKGRLNRLP ACV DMVMATVKKGKPDLRKK
Sbjct  1    MSLGLPVAATVNCADNTGARNLYIISVKGIKGRLNRLPPACVVDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA
Sbjct  61   VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  120

Query  453  ANAIV  467
            ANAIV
Sbjct  121  ANAIV  125



>ref|XP_002908532.1| 60S ribosomal protein L23 [Phytophthora infestans T30-4]
 gb|AAY43411.1| ribosomal protein L23 [Phytophthora infestans]
 gb|EEY61615.1| 60S ribosomal protein L23 [Phytophthora infestans T30-4]
Length=141

 Score =   246 bits (629),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            +KRGRGG++GNKFRM+LGLPV A +NCADN+GAKNLYII+V GIKGRLNRLP+A VGDMV
Sbjct  3    TKRGRGGASGNKFRMTLGLPVGAVMNCADNSGAKNLYIIAVCGIKGRLNRLPAAGVGDMV  62

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            +ATVKKGKPDLRKKVMPAV++RQRK WRRKDGVF+YFEDNAGVIVNPKGEMKGSAITGP+
Sbjct  63   LATVKKGKPDLRKKVMPAVVIRQRKSWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPV  122

Query  411  GKECADLWPRIASAANAIV  467
            GKECADLWPRIAS A +IV
Sbjct  123  GKECADLWPRIASNAGSIV  141



>ref|XP_004318392.1| PREDICTED: 60S ribosomal protein L23 [Tursiops truncatus]
Length=166

 Score =   247 bits (631),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  3    PLTLVVSFWRAEGFTMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGI  182
            PL+L+  F     F MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGI
Sbjct  13   PLSLL-PFCHFPAFKMSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGI  71

Query  183  KGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVI  362
            KGRLNRLP+A VGDMVMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVI
Sbjct  72   KGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVI  131

Query  363  VNPKGEMKGSAITGPIGKECADLWPRIASAANAI  464
            VN KGEMKGSAITGP+ KECADLWPRIAS A +I
Sbjct  132  VNNKGEMKGSAITGPVAKECADLWPRIASNAGSI  165



>ref|XP_008890949.1| 60S ribosomal protein L23 [Phytophthora parasitica INRA-310]
 ref|XP_009523977.1| hypothetical protein PHYSODRAFT_285581 [Phytophthora sojae]
 gb|EGZ21260.1| hypothetical protein PHYSODRAFT_285581 [Phytophthora sojae]
 gb|ETI56118.1| 60S ribosomal protein L23 [Phytophthora parasitica P1569]
 gb|ETK95909.1| 60S ribosomal protein L23 [Phytophthora parasitica]
 gb|ETL49289.1| 60S ribosomal protein L23 [Phytophthora parasitica]
 gb|ETM02341.1| 60S ribosomal protein L23 [Phytophthora parasitica]
 gb|ETM55582.1| 60S ribosomal protein L23 [Phytophthora parasitica]
 gb|ETN24943.1| 60S ribosomal protein L23 [Phytophthora parasitica INRA-310]
 gb|ETO84851.1| 60S ribosomal protein L23 [Phytophthora parasitica P1976]
 gb|ETP25912.1| 60S ribosomal protein L23 [Phytophthora parasitica CJ01A1]
 gb|ETP53915.1| 60S ribosomal protein L23 [Phytophthora parasitica P10297]
Length=141

 Score =   246 bits (629),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            +KRGRGG++GNKFRM+LGLPV A +NCADN+GAKNLYII+V GIKGRLNRLP+A VGDMV
Sbjct  3    TKRGRGGASGNKFRMTLGLPVGAVMNCADNSGAKNLYIIAVCGIKGRLNRLPAAGVGDMV  62

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            +ATVKKGKPDLRKKVMPAV++RQRK WRRKDGVF+YFEDNAGVIVNPKGEMKGSAITGP+
Sbjct  63   LATVKKGKPDLRKKVMPAVVIRQRKAWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPV  122

Query  411  GKECADLWPRIASAANAIV  467
            GKECADLWPRIAS A +IV
Sbjct  123  GKECADLWPRIASNAGSIV  141



>ref|XP_004282758.1| PREDICTED: 60S ribosomal protein L23 [Orcinus orca]
Length=166

 Score =   247 bits (631),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  3    PLTLVVSFWRAEGFTMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGI  182
            PL+ V+ F     F MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGI
Sbjct  13   PLS-VLPFCHFPAFKMSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGI  71

Query  183  KGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVI  362
            KGRLNRLP+A VGDMVMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVI
Sbjct  72   KGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVI  131

Query  363  VNPKGEMKGSAITGPIGKECADLWPRIASAANAI  464
            VN KGEMKGSAITGP+ KECADLWPRIAS A +I
Sbjct  132  VNNKGEMKGSAITGPVAKECADLWPRIASNAGSI  165



>ref|XP_008011089.1| PREDICTED: 60S ribosomal protein L23 [Chlorocebus sabaeus]
Length=222

 Score =   249 bits (635),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +3

Query  24   FWRAEGFTMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRL  203
            F+    F MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRL
Sbjct  75   FFFFPAFKMSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRL  134

Query  204  PSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEM  383
            P+A VGDMVMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEM
Sbjct  135  PAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEM  194

Query  384  KGSAITGPIGKECADLWPRIASAANAI  464
            KGSAITGP+ KECADLWPRIAS A +I
Sbjct  195  KGSAITGPVAKECADLWPRIASNAGSI  221



>ref|XP_005584045.1| PREDICTED: 60S ribosomal protein L23 isoform X1 [Macaca fascicularis]
Length=222

 Score =   249 bits (635),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +3

Query  24   FWRAEGFTMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRL  203
            F+    F MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRL
Sbjct  75   FFFFPAFKMSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRL  134

Query  204  PSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEM  383
            P+A VGDMVMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEM
Sbjct  135  PAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEM  194

Query  384  KGSAITGPIGKECADLWPRIASAANAI  464
            KGSAITGP+ KECADLWPRIAS A +I
Sbjct  195  KGSAITGPVAKECADLWPRIASNAGSI  221



>gb|AGH70171.1| 60S ribosomal protein L23 [Placozoa sp. H4]
Length=140

 Score =   246 bits (627),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G+KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNR+PSA +GD+
Sbjct  1    MSKRGRGGSSGSKFRISLGLPVGAVMNCADNTGAKNLYIISVKGIKGRLNRMPSAGIGDL  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKVMPAV+VRQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VLATVKKGKPELRKKVMPAVVVRQRKPYRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>emb|CCA20856.1| 60S ribosomal protein L23 putative [Albugo laibachii Nc14]
Length=141

 Score =   245 bits (626),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            SKRGRGG++GNK RM+LGLPVAA  NCADN+GA+NLYII+V GIKGRLNRLP+A VGDMV
Sbjct  3    SKRGRGGASGNKLRMALGLPVAAVANCADNSGARNLYIIAVCGIKGRLNRLPAAGVGDMV  62

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            +ATVKKGKPDLRKKVMPAVI+RQRK WRR+DGVF+YFEDNAGVIVNPKGEMKGSAITGP+
Sbjct  63   LATVKKGKPDLRKKVMPAVIIRQRKSWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGPV  122

Query  411  GKECADLWPRIASAANAIV  467
            GKECADLWPRIAS A +IV
Sbjct  123  GKECADLWPRIASNAGSIV  141



>ref|NP_957026.1| 60S ribosomal protein L23 [Danio rerio]
 ref|XP_003964316.1| PREDICTED: 60S ribosomal protein L23-like [Takifugu rubripes]
 sp|Q6PC14.1|RL23_DANRE RecName: Full=60S ribosomal protein L23 [Danio rerio]
 gb|AAH59509.1| Zgc:73149 [Danio rerio]
 emb|CAG05967.1| unnamed protein product, partial [Tetraodon nigroviridis]
 gb|AAT94068.1| ribosomal protein L23 [Sparus aurata]
 gb|AAH49038.2| Zgc:73149 [Danio rerio]
Length=140

 Score =   245 bits (625),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLPSA VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPSAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|KDO43340.1| hypothetical protein CISIN_1g032476mg [Citrus sinensis]
Length=126

 Score =   244 bits (624),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 126/140 (90%), Gaps = 14/140 (10%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFE              GSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFE--------------GSAITGP  106

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  107  IGKECADLWPRIASAANAIV  126



>ref|NP_001154037.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
 gb|ACN10046.1| 60S ribosomal protein L23 [Salmo salar]
 gb|ACN12393.1| 60S ribosomal protein L23 [Salmo salar]
 gb|ACO07624.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
 gb|ACO08267.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
 gb|ACO08725.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
 emb|CDQ72967.1| unnamed protein product [Oncorhynchus mykiss]
Length=140

 Score =   244 bits (622),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|NP_000969.1| 60S ribosomal protein L23 [Homo sapiens]
 ref|NP_075029.1| 60S ribosomal protein L23 [Mus musculus]
 ref|NP_001007600.1| 60S ribosomal protein L23 [Rattus norvegicus]
 ref|NP_001011231.1| ribosomal protein L23 [Xenopus (Silurana) tropicalis]
 ref|NP_001123427.1| 60S ribosomal protein L23 [Sus scrofa]
 ref|NP_001187049.1| 60S ribosomal protein L23 [Ictalurus punctatus]
 ref|NP_001253138.1| 60S ribosomal protein L23 [Macaca mulatta]
 ref|NP_001291852.1| ribosomal protein L23 [Ailuropoda melanoleuca]
 ref|XP_511444.2| PREDICTED: 60S ribosomal protein L23 [Pan troglodytes]
 ref|XP_001366590.1| PREDICTED: 60S ribosomal protein L23 [Monodelphis domestica]
 ref|XP_002748553.1| PREDICTED: 60S ribosomal protein L23 [Callithrix jacchus]
 ref|XP_003222586.1| PREDICTED: 60S ribosomal protein L23 [Anolis carolinensis]
 ref|XP_003278259.1| PREDICTED: 60S ribosomal protein L23 isoform 1 [Nomascus leucogenys]
 ref|XP_003278265.1| PREDICTED: 60S ribosomal protein L23 isoform 7 [Nomascus leucogenys]
 ref|XP_003362441.1| PREDICTED: 60S ribosomal protein L23 [Equus caballus]
 ref|XP_003414729.1| PREDICTED: 60S ribosomal protein L23 [Loxodonta africana]
 ref|XP_001509789.2| PREDICTED: 60S ribosomal protein L23 [Ornithorhynchus anatinus]
 ref|XP_003446442.1| PREDICTED: 60S ribosomal protein L23-like [Oreochromis niloticus]
 ref|XP_003466955.1| PREDICTED: 60S ribosomal protein L23 [Cavia porcellus]
 ref|XP_003499624.1| PREDICTED: 60S ribosomal protein L23 [Cricetulus griseus]
 ref|XP_418122.3| PREDICTED: 60S ribosomal protein L23 isoformX2 [Gallus gallus]
 ref|XP_003688806.1| PREDICTED: 60S ribosomal protein L23 [Mus musculus]
 ref|XP_003689266.1| PREDICTED: 60S ribosomal protein L23 isoform X2 [Mus musculus]
 ref|XP_003768323.1| PREDICTED: 60S ribosomal protein L23 [Sarcophilus harrisii]
 ref|XP_003786480.1| PREDICTED: 60S ribosomal protein L23 [Otolemur garnettii]
 ref|XP_003809888.1| PREDICTED: 60S ribosomal protein L23 [Pan paniscus]
 ref|XP_003892299.1| PREDICTED: 60S ribosomal protein L23 [Papio anubis]
 ref|XP_003912963.1| PREDICTED: 60S ribosomal protein L23 [Papio anubis]
 ref|XP_003996814.1| PREDICTED: 60S ribosomal protein L23 [Felis catus]
 ref|XP_004012877.1| PREDICTED: 60S ribosomal protein L23 [Ovis aries]
 ref|XP_004041890.1| PREDICTED: 60S ribosomal protein L23 [Gorilla gorilla gorilla]
 ref|XP_004086478.1| PREDICTED: 60S ribosomal protein L23 [Oryzias latipes]
 ref|XP_004378071.1| PREDICTED: 60S ribosomal protein L23 [Trichechus manatus latirostris]
 ref|XP_004395126.1| PREDICTED: 60S ribosomal protein L23 [Odobenus rosmarus divergens]
 ref|XP_004434646.1| PREDICTED: 60S ribosomal protein L23 [Ceratotherium simum simum]
 ref|XP_004454995.1| PREDICTED: 60S ribosomal protein L23 isoform 2 [Dasypus novemcinctus]
 ref|XP_004568658.1| PREDICTED: 60S ribosomal protein L23-like isoform X2 [Maylandia 
zebra]
 ref|XP_004591186.1| PREDICTED: 60S ribosomal protein L23 [Ochotona princeps]
 ref|XP_004608777.1| PREDICTED: 60S ribosomal protein L23 [Sorex araneus]
 ref|XP_004655546.1| PREDICTED: 60S ribosomal protein L23 [Jaculus jaculus]
 ref|XP_004707161.1| PREDICTED: 60S ribosomal protein L23 [Echinops telfairi]
 ref|XP_004684321.1| PREDICTED: 60S ribosomal protein L23 [Condylura cristata]
 ref|XP_004764745.1| PREDICTED: 60S ribosomal protein L23 [Mustela putorius furo]
 ref|XP_004799058.1| PREDICTED: 60S ribosomal protein L23 [Mustela putorius furo]
 ref|XP_004895166.1| PREDICTED: 60S ribosomal protein L23 [Heterocephalus glaber]
 ref|XP_004859587.1| PREDICTED: 60S ribosomal protein L23 [Heterocephalus glaber]
 ref|XP_005075973.1| PREDICTED: 60S ribosomal protein L23 [Mesocricetus auratus]
 ref|XP_005140830.1| PREDICTED: 60S ribosomal protein L23 [Melopsittacus undulatus]
 ref|XP_005301894.1| PREDICTED: 60S ribosomal protein L23 [Chrysemys picta bellii]
 ref|XP_005321819.1| PREDICTED: 60S ribosomal protein L23 [Ictidomys tridecemlineatus]
 ref|XP_005394345.1| PREDICTED: 60S ribosomal protein L23 [Chinchilla lanigera]
 ref|XP_005531465.1| PREDICTED: 60S ribosomal protein L23 [Pseudopodoces humilis]
 ref|XP_005508298.1| PREDICTED: 60S ribosomal protein L23 [Columba livia]
 ref|XP_005752845.1| PREDICTED: 60S ribosomal protein L23-like [Pundamilia nyererei]
 ref|XP_005817333.1| PREDICTED: 60S ribosomal protein L23-like [Xiphophorus maculatus]
 ref|XP_005950010.1| PREDICTED: 60S ribosomal protein L23-like [Haplochromis burtoni]
 ref|XP_005898045.1| PREDICTED: 60S ribosomal protein L23 [Bos mutus]
 ref|XP_005964788.1| PREDICTED: 60S ribosomal protein L23 [Pantholops hodgsonii]
 ref|XP_006022629.1| PREDICTED: 60S ribosomal protein L23 [Alligator sinensis]
 ref|XP_006108626.1| PREDICTED: 60S ribosomal protein L23-like [Myotis lucifugus]
 ref|XP_006176435.1| PREDICTED: 60S ribosomal protein L23 [Camelus ferus]
 ref|XP_006214292.1| PREDICTED: 60S ribosomal protein L23 [Vicugna pacos]
 ref|XP_006155929.1| PREDICTED: 60S ribosomal protein L23 [Tupaia chinensis]
 ref|XP_006275052.1| PREDICTED: 60S ribosomal protein L23 [Alligator mississippiensis]
 ref|XP_006638399.1| PREDICTED: 60S ribosomal protein L23-like [Lepisosteus oculatus]
 ref|XP_006806271.1| PREDICTED: 60S ribosomal protein L23-like [Neolamprologus brichardi]
 ref|XP_006774353.1| PREDICTED: 60S ribosomal protein L23 [Myotis davidii]
 ref|XP_006743370.1| PREDICTED: 60S ribosomal protein L23 [Leptonychotes weddellii]
 ref|XP_006889432.1| PREDICTED: 60S ribosomal protein L23 [Elephantulus edwardii]
 ref|XP_006832600.1| PREDICTED: 60S ribosomal protein L23 [Chrysochloris asiatica]
 ref|XP_006924783.1| PREDICTED: 60S ribosomal protein L23 [Pteropus alecto]
 ref|XP_006971922.1| PREDICTED: 60S ribosomal protein L23 [Peromyscus maniculatus 
bairdii]
 ref|XP_007085828.1| PREDICTED: 60S ribosomal protein L23 [Panthera tigris altaica]
 ref|XP_007062013.1| PREDICTED: 60S ribosomal protein L23 [Chelonia mydas]
 ref|XP_007112625.1| PREDICTED: 60S ribosomal protein L23 [Physeter catodon]
 ref|XP_006045943.1| PREDICTED: 60S ribosomal protein L23 [Bubalus bubalis]
 ref|XP_007177585.1| PREDICTED: 60S ribosomal protein L23 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007429902.1| PREDICTED: 60S ribosomal protein L23 [Python bivittatus]
 ref|XP_007465209.1| PREDICTED: 60S ribosomal protein L23 [Lipotes vexillifer]
 ref|XP_007575658.1| PREDICTED: 60S ribosomal protein L23 [Poecilia formosa]
 ref|XP_007544921.1| PREDICTED: 60S ribosomal protein L23 [Poecilia formosa]
 ref|XP_007530989.1| PREDICTED: 60S ribosomal protein L23 [Erinaceus europaeus]
 ref|XP_007615524.1| PREDICTED: 60S ribosomal protein L23 [Cricetulus griseus]
 ref|XP_007940203.1| PREDICTED: 60S ribosomal protein L23 [Orycteropus afer afer]
 ref|XP_008063617.1| PREDICTED: 60S ribosomal protein L23 [Tarsius syrichta]
 ref|XP_008152011.1| PREDICTED: 60S ribosomal protein L23 [Eptesicus fuscus]
 ref|XP_008302910.1| PREDICTED: 60S ribosomal protein L23 [Stegastes partitus]
 ref|XP_008328798.1| PREDICTED: 60S ribosomal protein L23 [Cynoglossus semilaevis]
 ref|XP_008413270.1| PREDICTED: 60S ribosomal protein L23 [Poecilia reticulata]
 ref|XP_008521501.1| PREDICTED: 60S ribosomal protein L23 [Equus przewalskii]
 ref|XP_008687238.1| PREDICTED: 60S ribosomal protein L23 [Ursus maritimus]
 ref|XP_008843500.1| PREDICTED: 60S ribosomal protein L23 [Nannospalax galili]
 ref|XP_009885393.1| PREDICTED: 60S ribosomal protein L23 [Charadrius vociferus]
 ref|XP_010377635.1| PREDICTED: 60S ribosomal protein L23 [Rhinopithecus roxellana]
 ref|XP_010583836.1| PREDICTED: 60S ribosomal protein L23 [Haliaeetus leucocephalus]
 ref|XP_010742852.1| PREDICTED: 60S ribosomal protein L23 [Larimichthys crocea]
 ref|XP_010840991.1| PREDICTED: 60S ribosomal protein L23 [Bison bison bison]
 ref|XP_010844046.1| PREDICTED: 60S ribosomal protein L23 [Bison bison bison]
 ref|XP_010958797.1| PREDICTED: 60S ribosomal protein L23 [Camelus bactrianus]
 ref|XP_010990145.1| PREDICTED: 60S ribosomal protein L23 [Camelus dromedarius]
 ref|XP_011382607.1| PREDICTED: 60S ribosomal protein L23 [Pteropus vampyrus]
 sp|Q90YU5.2|RL23_ICTPU RecName: Full=60S ribosomal protein L23 [Ictalurus punctatus]
 sp|P62831.1|RL23_PIG RecName: Full=60S ribosomal protein L23; AltName: Full=Ribosomal 
protein L17 [Sus scrofa]
 sp|P62832.1|RL23_RAT RecName: Full=60S ribosomal protein L23 [Rattus norvegicus]
 sp|P62829.1|RL23_HUMAN RecName: Full=60S ribosomal protein L23; AltName: Full=60S ribosomal 
protein L17 [Homo sapiens]
 sp|P62830.1|RL23_MOUSE RecName: Full=60S ribosomal protein L23 [Mus musculus]
 sp|Q3T057.2|RL23_BOVIN RecName: Full=60S ribosomal protein L23 [Bos taurus]
 pdb|2ZKR|KK Chain k, Structure Of A Mammalian Ribosomal 60s Subunit Within 
An 80s Complex Obtained By Docking Homology Models Of The 
Rna And Proteins Into An 8.7 A Cryo-em Map
 pdb|3J3B|V Chain V, Structure Of The Human 60s Ribosomal Proteins
 pdb|4CXD|V Chain V, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UPX|V Chain V, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4UQ1|V Chain V, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4W20|V Chain V, Structure Of The Mammalian 60s Ribosomal Subunit (this 
Entry Contains The Large Ribosomal Proteins)
 pdb|4W22|V Chain V, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Large Ribosomal Subunit Proteins)
 pdb|4W25|V Chain V, Structure Of The Idle Mammalian Ribosome-sec61 Complex 
(this Entry Contains The Large Ribosomal Subunit Proteins)
 pdb|4W27|V Chain V, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Large Ribosomal Subunit Proteins)
 gb|AAD42413.1|AF158022_1 ribosomal protein L23 [Mus musculus]
 gb|AAF88071.1|AF287271_1 ribosomal protein L23 [Mus musculus]
 gb|AAK95149.2|AF401577_1 ribosomal protein L23 [Ictalurus punctatus]
 emb|CAA39417.1| HL23 ribosomal protein [Homo sapiens]
 emb|CAA37023.1| ribosomal protein L17 [Homo sapiens]
 emb|CAA41177.1| ribosomal protein L23 [Rattus rattus]
 dbj|BAB27112.1| unnamed protein product [Mus musculus]
 dbj|BAB31373.1| unnamed protein product [Mus musculus]
 gb|AAH10114.1| Ribosomal protein L23 [Homo sapiens]
 dbj|BAB79465.1| ribosomal protein L23 [Homo sapiens]
 gb|AAH25918.1| Ribosomal protein L23 [Mus musculus]
 gb|AAH58500.1| Ribosomal protein L23 [Rattus norvegicus]
 gb|AAH81448.1| Ribosomal protein L23 [Mus musculus]
 gb|AAH87796.1| ribosomal protein L23 [Xenopus (Silurana) tropicalis]
 dbj|BAE29753.1| unnamed protein product [Mus musculus]
 dbj|BAE40102.1| unnamed protein product [Mus musculus]
 gb|AAI04652.1| Ribosomal protein L23 [Homo sapiens]
 gb|AAI06062.1| RPL23 protein [Homo sapiens]
 emb|CAJ82654.1| ribosomal protein L23 [Xenopus (Silurana) tropicalis]
 gb|ABK55650.1| RPL23 [Sus scrofa]
 gb|EAW60540.1| ribosomal protein L23, isoform CRA_b [Homo sapiens]
 gb|EAW60541.1| ribosomal protein L23, isoform CRA_b [Homo sapiens]
 gb|ABM84144.1| ribosomal protein L23 [synthetic construct]
 gb|ABM87546.1| ribosomal protein L23 [synthetic construct]
 gb|EDL16100.1| ribosomal protein L23, isoform CRA_b [Mus musculus]
 gb|EDM05884.1| rCG34264, isoform CRA_b [Rattus norvegicus]
 gb|AAI48015.1| Ribosomal protein L23 [Bos taurus]
 dbj|BAF98673.1| ribosomal protein L23 [Solea senegalensis]
 gb|ACI12870.1| ribosomal protein L23 [Gillichthys mirabilis]
 dbj|BAI46735.1| ribosomal protein L23 [synthetic construct]
 tpg|DAA18580.1| TPA: 60S ribosomal protein L23 [Bos taurus]
 gb|AEA39516.1| ribosomal protein L23 [Ailuropoda melanoleuca]
 gb|AEA39567.1| ribosomal protein L23 [Ailuropoda melanoleuca]
 gb|EGW05282.1| 60S ribosomal protein L23 [Cricetulus griseus]
 gb|EHB09678.1| 60S ribosomal protein L23 [Heterocephalus glaber]
 gb|ELW54871.1| 60S ribosomal protein L23 [Tupaia chinensis]
 gb|EMP33812.1| 60S ribosomal protein L23 [Chelonia mydas]
 gb|AIC50337.1| RPL23, partial [synthetic construct]
Length=140

 Score =   243 bits (621),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_002592201.1| hypothetical protein BRAFLDRAFT_123946 [Branchiostoma floridae]
 gb|AAP14949.1| ribosomal protein L23 [Branchiostoma belcheri tsingtauense]
 gb|EEN48212.1| hypothetical protein BRAFLDRAFT_123946 [Branchiostoma floridae]
Length=140

 Score =   243 bits (621),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SLGLPV A +NCADNTGAKNLYII+VKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGASGAKFRISLGLPVGAVINCADNTGAKNLYIIAVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_005368366.1| PREDICTED: 60S ribosomal protein L23 [Microtus ochrogaster]
Length=140

 Score =   243 bits (620),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMAT+KKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATIKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_006012703.1| PREDICTED: 60S ribosomal protein L23-like isoform X1 [Latimeria 
chalumnae]
 ref|XP_006012704.1| PREDICTED: 60S ribosomal protein L23-like isoform X2 [Latimeria 
chalumnae]
Length=140

 Score =   243 bits (620),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSFRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_004633745.1| PREDICTED: 60S ribosomal protein L23 [Octodon degus]
Length=140

 Score =   243 bits (619),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKLYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|AAH62716.1| Ribosomal protein L23 [Homo sapiens]
 gb|AIC55567.1| RPL23, partial [synthetic construct]
Length=140

 Score =   243 bits (619),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVRPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_010373454.1| PREDICTED: 60S ribosomal protein L23-like [Rhinopithecus roxellana]
Length=140

 Score =   242 bits (618),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSK+GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKQGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|NP_001124779.1| 60S ribosomal protein L23 [Pongo abelii]
 ref|XP_005680785.1| PREDICTED: 60S ribosomal protein L23-like [Capra hircus]
 sp|Q5REU2.1|RL23_PONAB RecName: Full=60S ribosomal protein L23 [Pongo abelii]
 emb|CAH89715.1| hypothetical protein [Pongo abelii]
Length=140

 Score =   242 bits (618),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKG+LNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGQLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|NP_001279708.1| ribosomal protein L23 [Callorhinchus milii]
 gb|AFK10869.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gb|AFM86264.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gb|AFM87585.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gb|AFM87720.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gb|AFM88017.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gb|AFM90623.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gb|AFM90633.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gb|AFM90748.1| 60S ribosomal protein L23 [Callorhinchus milii]
Length=140

 Score =   242 bits (618),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSCGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKAYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_003400755.1| PREDICTED: 60S ribosomal protein L23-like [Bombus terrestris]
Length=140

 Score =   242 bits (618),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAVI+RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVIIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>dbj|BAB28415.1| unnamed protein product [Mus musculus]
Length=140

 Score =   242 bits (618),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGE+KGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEIKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|AAD25102.1| ribosomal protein L17 [Dicentrarchus labrax]
Length=140

 Score =   242 bits (618),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAAINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIV+ KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVSNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_005718380.1| unnamed protein product [Chondrus crispus]
 emb|CDF38487.1| unnamed protein product [Chondrus crispus]
Length=140

 Score =   242 bits (617),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G+KFR+SLGLPVAA +NCADNTGAKNLYIISV  IKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGASGSKFRVSLGLPVAAVMNCADNTGAKNLYIISVTKIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKV PAV++RQRK WRRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VLATVKKGKPELRKKVAPAVVIRQRKSWRRKDGTFLYFEDNAGVIVNIKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECADLWPRIASAA  IV
Sbjct  121  VAKECADLWPRIASAAGTIV  140



>ref|NP_001155385.1| ribosomal protein L23-like [Acyrthosiphon pisum]
 dbj|BAH70612.1| ACYPI000455 [Acyrthosiphon pisum]
Length=140

 Score =   242 bits (617),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNL++I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLFVIAVQGIKGRLNRLPAAASGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|NP_001085921.1| ribosomal protein L23 [Xenopus laevis]
 gb|AAH73541.1| MGC82808 protein [Xenopus laevis]
Length=140

 Score =   242 bits (617),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTG KNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGGKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|ACO07760.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
Length=140

 Score =   242 bits (617),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLY ISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYTISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|AAG13342.1|AF266222_1 ribosomal protein L23 [Gillichthys mirabilis]
Length=140

 Score =   242 bits (617),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVYPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + K+CADLWPRIAS A +I
Sbjct  121  VAKDCADLWPRIASNAGSI  139



>ref|XP_392812.2| PREDICTED: 60S ribosomal protein L23 [Apis mellifera]
 ref|XP_001605069.1| PREDICTED: 60S ribosomal protein L23 [Nasonia vitripennis]
 ref|XP_003697800.1| PREDICTED: 60S ribosomal protein L23-like [Apis florea]
 ref|XP_003702854.1| PREDICTED: 60S ribosomal protein L23-like [Megachile rotundata]
 ref|XP_011149774.1| PREDICTED: 60S ribosomal protein L23 [Harpegnathos saltator]
 ref|XP_011301583.1| PREDICTED: 60S ribosomal protein L23 [Fopius arisanus]
 ref|XP_011503390.1| PREDICTED: 60S ribosomal protein L23 [Ceratosolen solmsi marchali]
 gb|AAX62476.1| ribosomal protein L23 [Lysiphlebus testaceipes]
 gb|ABD98755.1| putative ribosomal protein L17/23 [Graphocephala atropunctata]
Length=140

 Score =   241 bits (616),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>dbj|BAB22203.1| unnamed protein product [Mus musculus]
Length=140

 Score =   241 bits (616),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRL +A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLSAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|AFM88969.1| 60S ribosomal protein L23 [Callorhinchus milii]
Length=140

 Score =   241 bits (616),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSCGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKAYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A  I
Sbjct  121  VAKECADLWPRIASNAGGI  139



>gb|ABV44723.1| 60S ribosomal protein L23-like protein [Phlebotomus papatasi]
Length=140

 Score =   241 bits (616),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V GIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSAGGKFRISLGLPVGAVINCADNTGAKNLYVIAVHGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A+++
Sbjct  121  VAKECADLWPRIASNASSV  139



>ref|XP_005098440.1| PREDICTED: 60S ribosomal protein L23-like isoform X2 [Aplysia 
californica]
Length=140

 Score =   241 bits (615),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR++LGLPV A +NCADNTGAKNLY+I+V GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGGKFRIALGLPVGAVINCADNTGAKNLYVIAVSGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RRKDG+F+YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGIFIYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>dbj|BAN20164.1| ribosomal protein L23 [Riptortus pedestris]
Length=140

 Score =   241 bits (615),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDG+F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGIFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|NP_001030186.1| 60S ribosomal protein L23 [Bos taurus]
 gb|AAI02557.1| Ribosomal protein L23 [Bos taurus]
Length=140

 Score =   241 bits (615),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSK GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKLGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_005861970.1| PREDICTED: 60S ribosomal protein L23 [Myotis brandtii]
Length=140

 Score =   241 bits (615),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN K EMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKEEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|AGM32246.1| 60S ribosomal protein L23 [Coptotermes formosanus]
 gb|KDR07208.1| 60S ribosomal protein L23 [Zootermopsis nevadensis]
Length=140

 Score =   241 bits (615),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+G+KGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGVKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|NP_001134137.1| 60S ribosomal protein L23 [Salmo salar]
 gb|ACI66338.1| 60S ribosomal protein L23 [Salmo salar]
Length=140

 Score =   241 bits (615),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+S GLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISPGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNADSI  139



>ref|XP_005706554.1| 60S ribosomal protein L23e [Galdieria sulphuraria]
 gb|EME30034.1| 60S ribosomal protein L23e [Galdieria sulphuraria]
Length=140

 Score =   241 bits (615),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGR GS G+KFR S+GLPV A +NCADNTGAKNLYIISVKG+K RLNRLP+A VGDM
Sbjct  1    MSKRGRKGSTGSKFRTSVGLPVGALINCADNTGAKNLYIISVKGVKSRLNRLPAASVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKV PAV++RQR+PWRRKDGV +YFEDNAGVIVNPKGEMKGSA+ GP
Sbjct  61   VLATVKKGKPELRKKVTPAVVIRQRRPWRRKDGVILYFEDNAGVIVNPKGEMKGSAVAGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECAD+WPRIASAA+AI
Sbjct  121  VAKECADMWPRIASAASAI  139



>gb|ACO08124.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
Length=140

 Score =   241 bits (614),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M KRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MFKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_008557858.1| PREDICTED: 60S ribosomal protein L23 [Microplitis demolitor]
Length=140

 Score =   241 bits (614),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGTFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_006681055.1| hypothetical protein BATDEDRAFT_26800 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78259.1| hypothetical protein BATDEDRAFT_26800 [Batrachochytrium dendrobatidis 
JAM81]
Length=140

 Score =   241 bits (614),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MS RGR GS G K RM+L LPV A +NCADN+GAKNLYII+VKGIKGRLNRLPSA VGDM
Sbjct  1    MSTRGRSGSTGTKLRMTLALPVGAVINCADNSGAKNLYIIAVKGIKGRLNRLPSAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKPDLRKKV PAV++RQRK WRR+DGVF+YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VLATVKKGKPDLRKKVHPAVVIRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKECAD+WP+IAS+A  +V
Sbjct  121  VGKECADIWPKIASSAGTVV  140



>gb|AAY66949.1| 60S ribosomal protein L23 [Ixodes scapularis]
Length=140

 Score =   241 bits (614),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SLGLPV A +NCADNTGAKNLY+I+V GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGAAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVNGIKGRLNRLPAAGAGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|NP_001037227.1| ribosomal protein L23 [Bombyx mori]
 gb|AAK83857.1|AF395586_1 ribosomal protein L17/23 [Spodoptera frugiperda]
 dbj|BAD26665.1| Ribosomal protein L17/23 [Plutella xylostella]
 gb|AAV34834.1| ribosomal protein L23 [Bombyx mori]
 gb|ACY95310.1| ribosomal protein L23 [Manduca sexta]
 gb|ADT80687.1| ribosomal protein L23 [Euphydryas aurinia]
 gb|AEL28867.1| ribosomal protein L23 [Heliconius melpomene cythera]
 gb|EHJ72748.1| ribosomal protein L23 [Danaus plexippus]
Length=140

 Score =   241 bits (614),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RR+DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_003922660.1| PREDICTED: 60S ribosomal protein L23 [Saimiri boliviensis boliviensis]
Length=140

 Score =   241 bits (614),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGL V A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLLVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_002430176.1| 60S ribosomal protein L23, putative [Pediculus humanus corporis]
 gb|EEB17438.1| 60S ribosomal protein L23, putative [Pediculus humanus corporis]
Length=140

 Score =   240 bits (613),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|NP_001290643.1| ribosomal protein L23 [Esox lucius]
 gb|ACO14338.1| 60S ribosomal protein L23 [Esox lucius]
Length=140

 Score =   240 bits (613),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M KRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MFKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A ++
Sbjct  121  VAKECADLWPRIASNAGSV  139



>ref|XP_002719380.2| PREDICTED: 60S ribosomal protein L23 [Oryctolagus cuniculus]
Length=228

 Score =   243 bits (621),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = +3

Query  3    PLTLVVSFWRAEGFTMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGI  182
            PL L+  F       MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGI
Sbjct  75   PLCLL-PFCAFPASKMSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGI  133

Query  183  KGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVI  362
            KGRLNRLP+A VGDMVMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVI
Sbjct  134  KGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVI  193

Query  363  VNPKGEMKGSAITGPIGKECADLWPRIASAANAI  464
            VN KGEMKGSAITGP+ KECADLWPRIAS A +I
Sbjct  194  VNNKGEMKGSAITGPVAKECADLWPRIASNAGSI  227



>ref|XP_011049408.1| PREDICTED: 60S ribosomal protein L23 [Acromyrmex echinatior]
 ref|XP_011162160.1| PREDICTED: 60S ribosomal protein L23 [Solenopsis invicta]
 ref|XP_011264393.1| PREDICTED: 60S ribosomal protein L23 [Camponotus floridanus]
 gb|EFN62772.1| 60S ribosomal protein L23 [Camponotus floridanus]
Length=140

 Score =   240 bits (613),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>dbj|BAM17763.1| ribosomal protein L23 [Papilio xuthus]
 dbj|BAM18957.1| ribosomal protein L23 [Papilio polytes]
Length=140

 Score =   240 bits (613),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RR+DG+F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGIFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_005693789.1| PREDICTED: 60S ribosomal protein L23 [Capra hircus]
Length=140

 Score =   240 bits (612),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWP IAS A +I
Sbjct  121  VAKECADLWPPIASNAGSI  139



>gb|ACO08568.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
Length=140

 Score =   240 bits (612),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITG 
Sbjct  61   VMATVKKGKPELRKKVRPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITGL  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|AFM87360.1| 60S ribosomal protein L23 [Callorhinchus milii]
Length=140

 Score =   240 bits (612),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSCGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKAYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLW RIAS A +I
Sbjct  121  VAKECADLWSRIASNAGSI  139



>ref|XP_006624709.1| PREDICTED: 60S ribosomal protein L23-like [Apis dorsata]
Length=140

 Score =   240 bits (612),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAG IVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGXIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>gb|ABW04138.1| ribosomal protein L23, partial [Epinephelus coioides]
Length=141

 Score =   240 bits (612),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  54   KRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVM  233
            KRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVM
Sbjct  4    KRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVM  63

Query  234  ATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIG  413
            ATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ 
Sbjct  64   ATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVA  123

Query  414  KECADLWPRIASAANAI  464
            KECADLWPRIAS A +I
Sbjct  124  KECADLWPRIASNAGSI  140



>ref|XP_001650232.1| AAEL015006-PA [Aedes aegypti]
 ref|XP_001663308.1| AAEL013097-PA [Aedes aegypti]
 ref|XP_001663765.1| AAEL013583-PA [Aedes aegypti]
 ref|XP_319443.3| AGAP010252-PA [Anopheles gambiae str. PEST]
 ref|XP_001861351.1| RL23 [Culex quinquefasciatus]
 sp|Q9GNE2.1|RL23_AEDAE RecName: Full=60S ribosomal protein L23; AltName: Full=AeRpL17A; 
AltName: Full=L17A [Aedes aegypti]
 gb|AAG33863.1|AF315596_1 ribosomal protein L17A [Aedes aegypti]
 gb|AAG33864.1|AF315597_1 ribosomal protein L17A [Aedes aegypti]
 gb|AAK94453.1|AF399675_1 ribosomal protein L17A [Aedes aegypti]
 gb|AAL85622.1| ribosomal protein L17A [Aedes aegypti]
 gb|EAT32767.1| AAEL015006-PA [Aedes aegypti]
 gb|EAT34144.1| AAEL013583-PA [Aedes aegypti]
 gb|EAT34697.1| AAEL013097-PA [Aedes aegypti]
 gb|ABM68599.1| RL23 [Aedes aegypti]
 gb|EAA13962.4| AGAP010252-PA [Anopheles gambiae str. PEST]
 gb|EDS35529.1| RL23 [Culex quinquefasciatus]
 gb|KFB45493.1| 60S ribosomal protein L23 [Anopheles sinensis]
Length=140

 Score =   239 bits (611),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V GI+GRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSAGGKFRISLGLPVGAVINCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RR+DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_008011900.1| PREDICTED: 60S ribosomal protein L23 [Chlorocebus sabaeus]
Length=140

 Score =   239 bits (611),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKG+LNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGQLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIA  A +I
Sbjct  121  VAKECADLWPRIAPNAGSI  139



>gb|AFM86359.1| 60S ribosomal protein L23 [Callorhinchus milii]
Length=140

 Score =   239 bits (611),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS G KFR+SLGLPV A +NCADNTGAKNLYIIS KGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSCGAKFRISLGLPVGAVINCADNTGAKNLYIISAKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKAYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANA  461
            + KECADLWPRIAS A +
Sbjct  121  VAKECADLWPRIASNAGS  138



>ref|XP_974360.1| PREDICTED: 60S ribosomal protein L23 [Tribolium castaneum]
 gb|EFA06574.1| hypothetical protein TcasGA2_TC009485 [Tribolium castaneum]
Length=140

 Score =   239 bits (610),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GI GRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIGGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>emb|CAJ17291.1| ribosomal protein L23e [Sphaerius sp. APV-2005]
Length=140

 Score =   239 bits (610),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GI GRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGXKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIGGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|NP_001003100.1| 60S ribosomal protein L23 [Canis lupus familiaris]
 sp|Q9XSU3.1|RL23_CANFA RecName: Full=60S ribosomal protein L23 [Canis lupus familiaris]
 emb|CAB46823.1| Ribosomal protein [Canis lupus familiaris]
Length=140

 Score =   239 bits (610),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPXLRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWP IAS A +I
Sbjct  121  VXKECADLWPXIASNAGSI  139



>gb|ACY71293.1| ribosomal protein L23 [Chrysomela tremula]
Length=140

 Score =   239 bits (609),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SL LPV A +NCADNTGAKNLY+I+V+GI GRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLALPVGAVMNCADNTGAKNLYVIAVQGIGGRLNRLPAAAAGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASTAGSI  139



>ref|XP_009094975.1| PREDICTED: 60S ribosomal protein L23 [Serinus canaria]
Length=153

 Score =   239 bits (610),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  30   RAEGFTMSKR--GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRL  203
            R  G   S R  GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRL
Sbjct  6    RGTGLLHSSRPAGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRL  65

Query  204  PSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEM  383
            P+A VGDMVMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEM
Sbjct  66   PAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEM  125

Query  384  KGSAITGPIGKECADLWPRIASAANAI  464
            KGSAITGP+ KECADLWPRIAS A +I
Sbjct  126  KGSAITGPVAKECADLWPRIASNAGSI  152



>ref|XP_002192767.1| PREDICTED: 60S ribosomal protein L23 [Taeniopygia guttata]
Length=189

 Score =   240 bits (613),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            + K+GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  50   LRKKGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  109

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  110  VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  169

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  170  VAKECADLWPRIASNAGSI  188


 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +3

Query  147  AKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            AKNLYIISVKGIKGRLNRLP+A VGDMVMATVKKGKP+LRKK
Sbjct  12   AKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKK  53



>ref|XP_005177126.1| PREDICTED: 60S ribosomal protein L23 [Musca domestica]
Length=140

 Score =   238 bits (608),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SLGLPV A +NCADNTGAKNLY+I+V GI+GRLNRLP+A VGDM
Sbjct  1    MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RR+DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_006007528.1| PREDICTED: 60S ribosomal protein L23-like [Latimeria chalumnae]
Length=140

 Score =   238 bits (608),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQ K +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQWKSFRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_002719902.1| PREDICTED: 60S ribosomal protein L23-like [Oryctolagus cuniculus]
Length=140

 Score =   238 bits (608),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGL V A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGTKFRISLGLLVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWP+I S A +I
Sbjct  121  VAKECADLWPKIVSNAGSI  139



>ref|XP_011352087.1| PREDICTED: 60S ribosomal protein L23 [Cerapachys biroi]
 gb|EZA62692.1| 60S ribosomal protein L23 [Cerapachys biroi]
Length=140

 Score =   238 bits (607),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ TVKKGKP+LRKKVMPAV++RQRKP+RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVTTVKKGKPELRKKVMPAVVIRQRKPFRRKDGSFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>gb|KFO97478.1| 60S ribosomal protein L23, partial [Calypte anna]
Length=139

 Score =   238 bits (607),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            S+ GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMV
Sbjct  1    SRTGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMV  60

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            MATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+
Sbjct  61   MATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPV  120

Query  411  GKECADLWPRIASAANAI  464
             KECADLWPRIAS A +I
Sbjct  121  AKECADLWPRIASNAGSI  138



>emb|CBN75776.1| conserved unknown protein [Ectocarpus siliculosus]
Length=140

 Score =   238 bits (607),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGR G+ GNK+RM+LGLPVAA +NC DN+GAKNLYIISV GIKGRLNRLPSA VGDM
Sbjct  1    MSKRGRAGAQGNKYRMTLGLPVAAVMNCCDNSGAKNLYIISVCGIKGRLNRLPSAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATV+KGKP+LRKKVMPAV+VRQRK WRRKDGVF+YFEDN GVIVN KGEMKGSAI GP
Sbjct  61   VMATVRKGKPELRKKVMPAVVVRQRKAWRRKDGVFIYFEDNGGVIVNNKGEMKGSAINGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECADLWPRIAS A +IV
Sbjct  121  VAKECADLWPRIASNAGSIV  140



>ref|NP_523813.1| ribosomal protein L23 [Drosophila melanogaster]
 ref|XP_001361886.1| GA17595 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_001960801.1| GF13548 [Drosophila ananassae]
 ref|XP_001976307.1| GG22807 [Drosophila erecta]
 ref|XP_001987213.1| GH21796 [Drosophila grimshawi]
 ref|XP_002005580.1| GI20545 [Drosophila mojavensis]
 ref|XP_002025944.1| GL10129 [Drosophila persimilis]
 ref|XP_002039984.1| GM15964 [Drosophila sechellia]
 ref|XP_002050882.1| GJ22396 [Drosophila virilis]
 ref|XP_002061324.1| GK20786 [Drosophila willistoni]
 ref|XP_002092516.1| RpL23 [Drosophila yakuba]
 ref|XP_002082686.1| GD11716 [Drosophila simulans]
 sp|P48159.2|RL23_DROME RecName: Full=60S ribosomal protein L23; AltName: Full=L17A [Drosophila 
melanogaster]
 pdb|3J39|V Chain V, Structure Of The D. Melanogaster 60s Ribosomal Proteins
 gb|AAF46914.1| ribosomal protein L23 [Drosophila melanogaster]
 gb|EAL26465.1| GA17595 [Drosophila pseudoobscura pseudoobscura]
 gb|EDV37623.1| GF13548 [Drosophila ananassae]
 gb|EDV56707.1| GG22807 [Drosophila erecta]
 gb|EDW02080.1| GH21796 [Drosophila grimshawi]
 gb|EDW09515.1| GI20545 [Drosophila mojavensis]
 gb|EDW32851.1| GL10129 [Drosophila persimilis]
 gb|EDW56849.1| GM15964 [Drosophila sechellia]
 gb|EDW62075.1| GJ22396 [Drosophila virilis]
 gb|EDW72310.1| GK20786 [Drosophila willistoni]
 gb|EDW92228.1| RpL23 [Drosophila yakuba]
 gb|EDX08271.1| GD11716 [Drosophila simulans]
 gb|ACK77617.1| GM15762p [Drosophila melanogaster]
Length=140

 Score =   238 bits (607),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SLGLPV A +NCADNTGAKNLY+I+V GI+GRLNRLP+A VGDM
Sbjct  1    MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RR+DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>gb|ABM55583.1| putative 60S ribosomal protein L23 [Maconellicoccus hirsutus]
Length=140

 Score =   238 bits (606),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A +NCADNTGAKNL++I+V G+KGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLFVIAVHGVKGRLNRLPAAGCGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_006892698.1| PREDICTED: 60S ribosomal protein L23-like [Elephantulus edwardii]
Length=140

 Score =   238 bits (606),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SL LPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLSLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK ++RKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYQRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLW RIAS A +I
Sbjct  121  VAKECADLWLRIASNAGSI  139



>gb|ENN81247.1| hypothetical protein YQE_02341, partial [Dendroctonus ponderosae]
 gb|ERL89572.1| hypothetical protein D910_06937 [Dendroctonus ponderosae]
Length=140

 Score =   238 bits (606),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SL LPV A +NCADNTGAKNLY+I+V+GI GRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLYVIAVQGIGGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   LVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNAKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_006126287.1| PREDICTED: 60S ribosomal protein L23 [Pelodiscus sinensis]
Length=146

 Score =   238 bits (606),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            S +GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMV
Sbjct  8    SFKGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMV  67

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            MATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+
Sbjct  68   MATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPV  127

Query  411  GKECADLWPRIASAANAI  464
             KECADLWPRIAS A +I
Sbjct  128  AKECADLWPRIASNAGSI  145



>ref|XP_007468010.1| PREDICTED: 60S ribosomal protein L23-like [Lipotes vexillifer]
Length=166

 Score =   238 bits (608),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+  KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSAAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK  RRKDGVF+YFEDNAGVIVN K EMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSHRRKDGVFLYFEDNAGVIVNNKVEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>tpe|CAL69069.1| TPA: putative 60S ribosomal protein L23 [Spadella cephaloptera]
Length=140

 Score =   237 bits (604),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SL LPVAA +NCADNTGAKNLYIISV G   RLNRLP+A VGDM
Sbjct  1    MSKRGRGGTSGGKFRISLALPVAAVMNCADNTGAKNLYIISVAGFGSRLNRLPAAAVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV++RQRKP+RRKDGV +YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVTLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_007524549.1| PREDICTED: 60S ribosomal protein L23-like [Erinaceus europaeus]
Length=139

 Score =   237 bits (604),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  57   RGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMA  236
            RGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMA
Sbjct  3    RGRGGSSGTKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMA  62

Query  237  TVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGK  416
            TVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ K
Sbjct  63   TVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAK  122

Query  417  ECADLWPRIASAANAI  464
            ECADLWPRIAS   +I
Sbjct  123  ECADLWPRIASNVGSI  138



>gb|ABV82416.1| TA01212p [Drosophila melanogaster]
Length=140

 Score =   237 bits (604),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SLGLPV A +NCADNTGAKNLY+I+V GI+GRLNRLP+A VGD+
Sbjct  1    MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDL  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RR+DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>gb|AIU94818.1| 60S ribosomal protein [Phragmatopoma lapidosa]
Length=140

 Score =   237 bits (604),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+S+GLPV A +NCADNTGAKNLYII+V GIKGRLNRLP+A  GD+
Sbjct  1    MSKRGRGGSAGGKFRISIGLPVGAVINCADNTGAKNLYIIAVHGIKGRLNRLPAAASGDL  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKVMPAV++RQRK  RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VLATVKKGKPELRKKVMPAVVIRQRKSIRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_005684126.1| PREDICTED: 60S ribosomal protein L23-like [Capra hircus]
Length=140

 Score =   237 bits (604),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRG GGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGHGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKK KP+L KKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKRKPELTKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_010310859.1| PREDICTED: 60S ribosomal protein L23, partial [Balearica regulorum 
gibbericeps]
Length=140

 Score =   237 bits (604),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  5    GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  64

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  65   VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  124

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  125  CADLWPRIASNAGSI  139



>ref|XP_002713585.1| PREDICTED: 60S ribosomal protein L23 [Oryctolagus cuniculus]
Length=140

 Score =   237 bits (604),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KF++SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFQISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGK +LRKKV PAV++RQRK +RRKDGVF+YFEDNA VIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKLELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAEVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_009474121.1| PREDICTED: 60S ribosomal protein L23 [Nipponia nippon]
Length=190

 Score =   238 bits (608),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  55   GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  114

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  115  VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  174

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  175  CADLWPRIASNAGSI  189



>ref|XP_004526407.1| PREDICTED: 60S ribosomal protein L23-like [Ceratitis capitata]
 ref|XP_011192991.1| PREDICTED: 60S ribosomal protein L23 [Bactrocera cucurbitae]
 ref|XP_011202107.1| PREDICTED: 60S ribosomal protein L23 [Bactrocera dorsalis]
Length=140

 Score =   236 bits (603),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SLGLPV A +NCADNTGAKNL++I+V GI+GRLNRLP+A VGDM
Sbjct  1    MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLFVIAVHGIRGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RR+DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>emb|CDW53715.1| large subunit ribosomal protein 23 [Trichuris trichiura]
 gb|KFD49158.1| hypothetical protein M513_09982 [Trichuris suis]
 gb|KFD62170.1| hypothetical protein M514_09982 [Trichuris suis]
 gb|KHJ41107.1| ribosomal protein L14p/L23e [Trichuris suis]
Length=140

 Score =   236 bits (603),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G+KFR+SLGLPV A +NCADNTGAKNLYII+V G++GRLNRLPSA VGDM
Sbjct  1    MSKRGRGGTSGSKFRISLGLPVGAVINCADNTGAKNLYIIAVYGVRGRLNRLPSAAVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+A+VKKGKP+LRKKVM AV++RQRKP+RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VVASVKKGKPELRKKVMQAVVIRQRKPYRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPR+A+ A+++
Sbjct  121  VAKECADLWPRVAANASSV  139



>ref|XP_008503868.1| PREDICTED: 60S ribosomal protein L23, partial [Calypte anna]
Length=137

 Score =   236 bits (602),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  2    GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  61

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  62   VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  121

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  122  CADLWPRIASNAGSI  136



>gb|EFB19935.1| hypothetical protein PANDA_004968 [Ailuropoda melanoleuca]
 gb|EHH24731.1| 60S ribosomal protein L17, partial [Macaca mulatta]
 gb|ELR54764.1| 60S ribosomal protein L23, partial [Bos mutus]
 gb|KFO03452.1| 60S ribosomal protein L23, partial [Balearica regulorum gibbericeps]
 gb|KFO73086.1| 60S ribosomal protein L23, partial [Cuculus canorus]
 gb|KFO89711.1| 60S ribosomal protein L23, partial [Buceros rhinoceros silvestris]
 gb|KFQ51326.1| 60S ribosomal protein L23, partial [Nestor notabilis]
 gb|KFQ66266.1| 60S ribosomal protein L23, partial [Phaethon lepturus]
 gb|KFQ92097.1| 60S ribosomal protein L23, partial [Nipponia nippon]
 gb|KFV84503.1| 60S ribosomal protein L23, partial [Struthio camelus australis]
 gb|KGL94984.1| 60S ribosomal protein L23, partial [Charadrius vociferus]
Length=136

 Score =   236 bits (602),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  1    GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  60

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  61   VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  120

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  121  CADLWPRIASNAGSI  135



>gb|EMC85376.1| 60S ribosomal protein L23, partial [Columba livia]
Length=139

 Score =   236 bits (602),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            S  GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMV
Sbjct  1    SPAGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMV  60

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            MATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+
Sbjct  61   MATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPV  120

Query  411  GKECADLWPRIASAANAI  464
             KECADLWPRIAS A +I
Sbjct  121  AKECADLWPRIASNAGSI  138



>gb|ACH56903.1| 60S ribosomal protein L14/L17/L23 [Simulium vittatum]
Length=140

 Score =   236 bits (602),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SLGLPV A ++CADNTGAKNLY+I+V GI+GRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSAGGKFRISLGLPVGAVIDCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             + TVKKGKP+LRKKVMPAV++RQRKP+RR+DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVVTVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A+++
Sbjct  121  VAKECADLWPRIASNASSV  139



>emb|CDQ88886.1| unnamed protein product, partial [Oncorhynchus mykiss]
Length=148

 Score =   236 bits (602),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  13   GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  72

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  73   VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITGPVAKE  132

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  133  CADLWPRIASNAGSI  147



>gb|KIZ00334.1| 60S ribosomal protein [Monoraphidium neglectum]
 gb|KIZ01126.1| 60S ribosomal protein [Monoraphidium neglectum]
Length=140

 Score =   236 bits (602),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKF M++GLPVAA +NCADNTGAKNLY+ISV G   RLN+LPSA  GDM
Sbjct  1    MSKRGRGGTSGNKFAMAVGLPVAAVMNCADNTGAKNLYVISVCGWGSRLNKLPSASCGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             MA+VKKGKPDLRKKV PAV+VRQRK WRRK+G ++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   FMASVKKGKPDLRKKVTPAVVVRQRKAWRRKEGTYIYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECADLWPRIASAAN+IV
Sbjct  121  VAKECADLWPRIASAANSIV  140



>gb|ABW23177.1| ribosomal protein rpl23 [Arenicola marina]
Length=140

 Score =   236 bits (601),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SL LPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGTAGGKFRISLALPVGAVMNCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKV+PAV++RQRKP RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVIPAVVIRQRKPIRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECADLWPRIAS A++I+
Sbjct  121  VAKECADLWPRIASNASSIL  140



>ref|XP_005232723.1| PREDICTED: 60S ribosomal protein L23, partial [Falco peregrinus]
Length=138

 Score =   236 bits (601),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  3    GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  62

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  63   VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  122

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  123  CADLWPRIASNAGSI  137



>ref|XP_007127753.1| PREDICTED: 60S ribosomal protein L23-like [Physeter catodon]
Length=140

 Score =   236 bits (601),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSK+G GGS+G KFR+SLGLPV A + CADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKQGHGGSSGAKFRISLGLPVGAVITCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK ++RKDG F+YFEDNAGVIVN KGEMKGSA+TGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYQRKDGAFLYFEDNAGVIVNNKGEMKGSAVTGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_005061658.1| PREDICTED: 60S ribosomal protein L23, partial [Ficedula albicollis]
 ref|XP_010281428.1| PREDICTED: 60S ribosomal protein L23, partial [Phaethon lepturus]
Length=140

 Score =   236 bits (601),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  5    GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  64

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  65   VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  124

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  125  CADLWPRIASNAGSI  139



>gb|EFX69895.1| hypothetical protein DAPPUDRAFT_300630 [Daphnia pulex]
Length=140

 Score =   236 bits (601),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SLGLPV A +NCADNTGAKNLY+I+V G+KGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVYGVKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVM AV+VRQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMQAVVVRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS +++I
Sbjct  121  VAKECADLWPRIASNSSSI  139



>ref|XP_004008323.1| PREDICTED: 60S ribosomal protein L23-like [Ovis aries]
Length=222

 Score =   238 bits (608),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRG G S+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLN LP+A VGDM
Sbjct  1    MSKRGHGESSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNSLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+L KKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELSKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|ABG82011.1| putative ribosomal protein L17/23 [Diaphorina citri]
Length=140

 Score =   235 bits (600),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SL LPV A +NCADNTGAKNL++I+V+G+KGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RR+DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>gb|KFH64795.1| 60S ribosomal protein L23 [Mortierella verticillata NRRL 6337]
 gb|KFH66697.1| 60S ribosomal protein L23 [Mortierella verticillata NRRL 6337]
Length=139

 Score =   235 bits (600),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MS +G G ++GNKFRM+LGLPV A +NCADN+GAKNLY+ISVKGI GRLN+LP+  VGDM
Sbjct  1    MSAKG-GAASGNKFRMTLGLPVGAVMNCADNSGAKNLYVISVKGIHGRLNKLPAGGVGDM  59

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAVI+RQRK WRR+DGVF+YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  60   VMATVKKGKPELRKKVMPAVIIRQRKAWRRRDGVFIYFEDNAGVIVNPKGEMKGSAITGP  119

Query  408  IGKECADLWPRIASAANAIV  467
            +GKECADLWPRIAS A  +V
Sbjct  120  VGKECADLWPRIASCAGTVV  139



>ref|XP_003797302.1| PREDICTED: 60S ribosomal protein L23-like [Otolemur garnettii]
Length=140

 Score =   235 bits (600),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGEKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+ RKKV PAV++ QRK +RRKDGVF+YFEDNAGVIVN KG+MKGSAITGP
Sbjct  61   VLATVKKGKPEFRKKVHPAVVIWQRKSYRRKDGVFLYFEDNAGVIVNNKGKMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_003213136.2| PREDICTED: 60S ribosomal protein L23, partial [Meleagris gallopavo]
Length=144

 Score =   235 bits (600),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  9    GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  68

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  69   VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  128

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  129  CADLWPRIASNAGSI  143



>ref|XP_004338344.1| 60S ribosomal protein L23, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR16331.1| 60S ribosomal protein L23, putative [Acanthamoeba castellanii 
str. Neff]
Length=140

 Score =   235 bits (600),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M KRG G + G KFR++LGLPV A VNCADNTGAKNLY+ISVKGI  RLNRLP+A  GDM
Sbjct  1    MPKRGAGATTGAKFRITLGLPVGAVVNCADNTGAKNLYVISVKGIGARLNRLPAAASGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAVI+RQRKP+RR+DGVF+YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVTPAVIIRQRKPFRRQDGVFIYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECADLWPRIAS+A  +V
Sbjct  121  VAKECADLWPRIASSAGTVV  140



>ref|XP_007189021.1| PREDICTED: 60S ribosomal protein L23-like [Balaenoptera acutorostrata 
scammoni]
Length=140

 Score =   235 bits (600),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NC+DNTGAK+LYIISVKG+KGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCSDNTGAKHLYIISVKGVKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV+++QR  +RRKDGVF+YFEDNAGVIVN KGEMKGSAIT P
Sbjct  61   VMATVKKGKPELRKKVHPAVVIQQRNSYRRKDGVFLYFEDNAGVIVNSKGEMKGSAITRP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|EPQ05063.1| 60S ribosomal protein L23, partial [Myotis brandtii]
Length=140

 Score =   235 bits (599),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            +S  GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    LSPTGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN K EMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKEEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_008351954.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L23-like 
[Malus domestica]
Length=137

 Score =   234 bits (598),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 125/140 (89%), Gaps = 3/140 (2%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLG+PVAATVNCADNTGAKNLYII VKGI GRL+RLPSA VGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGIPVAATVNCADNTGAKNLYIIPVKGINGRLSRLPSAYVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATV KGKPDLRKKV+ AVIVRQ KPWRRKDGVFMYFEDNAGVIVN KG  KG   T P
Sbjct  61   VMATVNKGKPDLRKKVLHAVIVRQCKPWRRKDGVFMYFEDNAGVIVNLKGRNKG---TSP  117

Query  408  IGKECADLWPRIASAANAIV  467
            IG ECAD WPRIASAANAIV
Sbjct  118  IGNECADPWPRIASAANAIV  137



>gb|EHH58057.1| 60S ribosomal protein L17, partial [Macaca fascicularis]
Length=136

 Score =   234 bits (598),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  1    GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  60

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  61   VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  120

Query  420  CADLWPRIASAANAI  464
            CADLWP+IAS A +I
Sbjct  121  CADLWPQIASNAGSI  135



>ref|XP_002109491.1| conserved hypothetical protein [Trichoplax adhaerens]
 gb|EDV27657.1| conserved hypothetical protein, partial [Trichoplax adhaerens]
Length=136

 Score =   234 bits (598),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G+KFR+SL LPV A +NCADNTGAKNLY+ISVKGIKGRLNR+PSA +GD+V+AT
Sbjct  1    GRGGSSGSKFRISLALPVGAVMNCADNTGAKNLYVISVKGIKGRLNRMPSAGIGDLVLAT  60

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKVMPAV+VRQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  61   VKKGKPELRKKVMPAVVVRQRKPYRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKE  120

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS + +I
Sbjct  121  CADLWPRIASNSGSI  135



>gb|ABX75501.1| ribosomal protein l23 [Lycosa singoriensis]
Length=140

 Score =   234 bits (598),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG K  +SLG PV A +NCADNTGAKNLYII+V GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGTAGAKLPISLGSPVGAVINCADNTGAKNLYIIAVNGIKGRLNRLPAAGAGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VVATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>gb|AGN29657.1| 60S ribosomal protein L23 [Acartia pacifica]
Length=140

 Score =   234 bits (598),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+ G KFR+SL LPV A +NCADNTGAKNL+I++V GI+GRLNRLP+ACVGDM
Sbjct  1    MSKRGRGGAVGAKFRISLALPVGAIMNCADNTGAKNLFIMAVGGIRGRLNRLPAACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKVMPAV++RQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VLATVKKGKPELRKKVMPAVVIRQRKTFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_010134403.1| PREDICTED: 60S ribosomal protein L23, partial [Buceros rhinoceros 
silvestris]
Length=135

 Score =   234 bits (597),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  63   RGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATV  242
            RGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMATV
Sbjct  1    RGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATV  60

Query  243  KKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKEC  422
            KKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KEC
Sbjct  61   KKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKEC  120

Query  423  ADLWPRIASAANAI  464
            ADLWPRIAS A +I
Sbjct  121  ADLWPRIASNAGSI  134



>ref|XP_009679385.1| PREDICTED: 60S ribosomal protein L23 [Struthio camelus australis]
Length=159

 Score =   235 bits (599),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  42   FTMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVG  221
            F     GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VG
Sbjct  18   FFFKPAGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVG  77

Query  222  DMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAIT  401
            DMVMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAIT
Sbjct  78   DMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAIT  137

Query  402  GPIGKECADLWPRIASAANAI  464
            GP+ KECADLWPRIAS A +I
Sbjct  138  GPVAKECADLWPRIASNAGSI  158



>gb|AAP20205.1| ribosomal protein L17 [Pagrus major]
Length=143

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            SKRGRGGS+G KFR++LGLP  A +NCADNTGAKNLYIISVKGIKGRLNRLPSA VGDMV
Sbjct  5    SKRGRGGSSGAKFRIALGLPGGAVINCADNTGAKNLYIISVKGIKGRLNRLPSAGVGDMV  64

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            MATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+
Sbjct  65   MATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPV  124

Query  411  GKECADLWPRIASAANAI  464
             KECADL PR+AS A +I
Sbjct  125  AKECADLGPRMASNAGSI  142



>gb|KGL72736.1| 60S ribosomal protein L23, partial [Tinamus guttatus]
Length=136

 Score =   234 bits (596),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KF +SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  1    GRGGSSGAKFSISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  60

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  61   VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  120

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  121  CADLWPRIASNAGSI  135



>ref|XP_002839313.1| 60S ribosomal protein L23 [Tuber melanosporum Mel28]
 emb|CAZ83504.1| unnamed protein product [Tuber melanosporum]
Length=140

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M+KRGRGG+AGNK +M+LGLPV A +NC DN+GA+NLYIISVKGI  RLNRLP+A VGDM
Sbjct  1    MAKRGRGGAAGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPWRR DGV++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWRRADGVYLYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKE ADLWPRIAS +  ++
Sbjct  121  VGKEAADLWPRIASNSGVVM  140



>gb|AEE62943.1| unknown [Dendroctonus ponderosae]
Length=140

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SL LPV A +NCADNTGAKNLY+I+V+GI GRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLYVIAVQGIGGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   LVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNAKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADL PRIAS A++I
Sbjct  121  VAKECADLCPRIASNASSI  139



>ref|XP_003389687.1| PREDICTED: 60S ribosomal protein L23 [Amphimedon queenslandica]
Length=140

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKR   GSAG+KFRM+LGLPV A +NCADNTGAKNLYII+VKGIKGRLNRLP+A  GD+
Sbjct  1    MSKRAAKGSAGSKFRMALGLPVGAVINCADNTGAKNLYIIAVKGIKGRLNRLPAAGAGDL  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGS + GP
Sbjct  61   VLATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVFLYFEDNAGVIVNVKGEMKGSTVAGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECAD+WPRIAS A++I
Sbjct  121  VAKECADIWPRIASNASSI  139



>ref|XP_005098439.1| PREDICTED: 60S ribosomal protein L23-like isoform X1 [Aplysia 
californica]
Length=141

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGSAG KFR++LGLPV A +NCADNTGAKNLY+I+V GIKGRLNRLP+A  GDM +AT
Sbjct  6    GRGGSAGGKFRIALGLPVGAVINCADNTGAKNLYVIAVSGIKGRLNRLPAAGSGDMFVAT  65

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKVMPAV++RQRKP+RRKDG+F+YFEDNAGVIVNPKGEMKGSAITGP+ KE
Sbjct  66   VKKGKPELRKKVMPAVVIRQRKPFRRKDGIFIYFEDNAGVIVNPKGEMKGSAITGPVAKE  125

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A++I
Sbjct  126  CADLWPRIASNASSI  140



>ref|XP_002957495.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ41389.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=140

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M+ + +GG++GNKFRM+LGLPVAA +NCADNTGAKNLY+ISV G   RLNRLP+A  GDM
Sbjct  1    MASKRKGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNRLPAAACGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMA+VKKGKPDLRKKV PAV++RQRKP+RRK+GV++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMASVKKGKPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECADLWPRIASAAN+IV
Sbjct  121  VAKECADLWPRIASAANSIV  140



>emb|CAB56830.1| 60S ribosomal protein L17 [Cyanophora paradoxa]
Length=135

 Score =   234 bits (596),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  63   RGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATV  242
            RGG++GNKFRM+LGLPV A VNCADNTGAKNLY+I+VKG+ GRLNRLP+A VGDMVMATV
Sbjct  1    RGGASGNKFRMTLGLPVGAVVNCADNTGAKNLYVIAVKGVHGRLNRLPAATVGDMVMATV  60

Query  243  KKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKEC  422
            KKGKP+LRKKVMPAVI+RQ+    RKDGV+++FEDNAGVIVNPKGEMKGSAITGP+GKEC
Sbjct  61   KKGKPELRKKVMPAVIIRQKNRGARKDGVYIFFEDNAGVIVNPKGEMKGSAITGPVGKEC  120

Query  423  ADLWPRIASAANAIV  467
            ADLWPRIASAA +IV
Sbjct  121  ADLWPRIASAAGSIV  135



>gb|ACD65173.1| putative 60S ribosomal protein RPL23 [Phoronis muelleri]
Length=140

 Score =   233 bits (595),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SLGLPV A +NCADNTGAKNLY+I+V GI+GRLNRLP+A  GD+
Sbjct  1    MSKRGRGGTSGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAAAGDL  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKVMPAV++RQRK  RRKDGVF++FEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VVATVKKGKPELRKKVMPAVVIRQRKSIRRKDGVFLFFEDNAGVIVNVKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>gb|EAZ25517.1| hypothetical protein OsJ_09341 [Oryza sativa Japonica Group]
 gb|AFW64024.1| hypothetical protein ZEAMMB73_988730 [Zea mays]
 gb|AFW74000.1| hypothetical protein ZEAMMB73_103592 [Zea mays]
Length=122

 Score =   233 bits (594),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 122/140 (87%), Gaps = 18/140 (13%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAAT                  GIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAAT------------------GIKGRLNRLPSACVGDM  42

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKGSAITGP
Sbjct  43   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP  102

Query  408  IGKECADLWPRIASAANAIV  467
            IGKECADLWPRIASAANAIV
Sbjct  103  IGKECADLWPRIASAANAIV  122



>dbj|BAE78800.1| ribosomal protein L23 [Pelodiscus sinensis]
Length=136

 Score =   233 bits (595),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 126/139 (91%), Gaps = 4/139 (3%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVI    GEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVI----GEMKGSAITGP  116

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  117  VAKECADLWPRIASNAGSI  135



>gb|KIV93651.1| 60S ribosomal protein L23-A [Exophiala mesophila]
 gb|KIW46826.1| 60S ribosomal protein L23-A [Exophiala oligosperma]
 gb|KIW60955.1| 60S ribosomal protein L23-B [Exophiala xenobiotica]
Length=140

 Score =   233 bits (594),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNK +M+LGLPV A ++CADN+GA+NLYIISVKGI  RLNRLP+A VGDM
Sbjct  1    MSKRGRGGASGNKLKMTLGLPVGAVMSCADNSGARNLYIISVKGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPWRR DG+++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWRRADGIYLYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKE A+LWPRIAS +  ++
Sbjct  121  VGKEAAELWPRIASNSGVVM  140



>ref|XP_005334591.1| PREDICTED: 60S ribosomal protein L23-like [Ictidomys tridecemlineatus]
Length=140

 Score =   233 bits (594),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGL V A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLLVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV P V++RQRK + RKDGVF+YFEDNAGVIVN KGEMKGSAI GP
Sbjct  61   VMATVKKGKPELRKKVHPTVVIRQRKSYGRKDGVFLYFEDNAGVIVNNKGEMKGSAIMGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPR+AS A +I
Sbjct  121  VAKECADLWPRVASNAGSI  139



>emb|CAJ17289.1| ribosomal protein L23e [Biphyllus lunatus]
Length=140

 Score =   233 bits (594),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SL LPV A +N ADNTGAKNLY+I+V+GI GRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLALPVGAVINRADNTGAKNLYVIAVQGIGGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            ++ATVKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_011424740.1| PREDICTED: 60S ribosomal protein L23 [Crassostrea gigas]
Length=140

 Score =   233 bits (593),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SL LPV A +NCADNTGAKNL++I+V GIKGRLNR+P+A  GDM
Sbjct  1    MSKRGRGGSAGGKFRISLALPVGAVINCADNTGAKNLFVIAVSGIKGRLNRMPAAGAGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP RRK+GVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPVRRKNGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VAKECADLWPRIASNASSI  139



>ref|XP_009154822.1| 60S ribosomal protein L23 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54361.1| 60S ribosomal protein L23 [Exophiala dermatitidis NIH/UT8656]
 gb|KIW34507.1| 60S ribosomal protein L23-B [Cladophialophora immunda]
 gb|KIW63599.1| 60S ribosomal protein L23-A [Capronia semiimmersa]
Length=140

 Score =   233 bits (593),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNK +M+LGLPV A ++CADN+GA+NLYIISVKGI  RLNRLP+A VGDM
Sbjct  1    MSKRGRGGASGNKLKMTLGLPVGAVMSCADNSGARNLYIISVKGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPWRR DG+++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIYLYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKE A+LWPRIAS +  ++
Sbjct  121  VGKEAAELWPRIASNSGVVM  140



>gb|ACO57591.1| ribosomal protein L23, partial [Gillichthys seta]
Length=131

 Score =   232 bits (592),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   RGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATV  242
            RGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMATV
Sbjct  1    RGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATV  60

Query  243  KKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKEC  422
            KKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KEC
Sbjct  61   KKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKEC  120

Query  423  ADLWPRIASAA  455
            ADLWPRIAS A
Sbjct  121  ADLWPRIASNA  131



>ref|WP_036770884.1| 50S ribosomal protein L14 [Pontibacillus halophilus]
 ref|XP_001698723.1| ribosomal protein L23, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDO99405.1| ribosomal protein L23 [Chlamydomonas reinhardtii]
Length=140

 Score =   232 bits (592),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M+ + +GG++GNKFRM+LGLPVAA +NCADNTGAKNLY+ISV G   RLN+LP+A  GDM
Sbjct  1    MANKRKGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNKLPAAACGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMA+VKKGKPDLRKKV PAV++RQRKP+RRK+GV++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMASVKKGKPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECADLWPRIASAAN+IV
Sbjct  121  VAKECADLWPRIASAANSIV  140



>ref|XP_008479129.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L23 [Diaphorina 
citri]
Length=140

 Score =   232 bits (592),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAG KFR+SL LPV A +NCADNTGAKNL++I+V+G+KGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVKGRLNRLPAAGSGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRKP+RR+DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPR AS A++I
Sbjct  121  VAKECADLWPRNASNASSI  139



>emb|CCQ18586.1| 60S ribosomal protein L23 [Sycon ciliatum]
Length=140

 Score =   232 bits (592),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG  G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGLGGAKFRVSLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAAVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMAT KKGKP+LRKKV+PAV++RQRK +RRK+G+ +YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATCKKGKPELRKKVLPAVVIRQRKAYRRKNGITLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A ++
Sbjct  121  VAKECADLWPRIASNAPSV  139



>gb|AAH03518.1| Similar to ribosomal protein L23, partial [Homo sapiens]
Length=134

 Score =   232 bits (592),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  66   GGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVK  245
            GGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMATVK
Sbjct  1    GGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVK  60

Query  246  KGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECA  425
            KGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KECA
Sbjct  61   KGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECA  120

Query  426  DLWPRIASAANAI  464
            DLWPRIAS A +I
Sbjct  121  DLWPRIASNAGSI  133



>ref|XP_003252985.1| PREDICTED: 60S ribosomal protein L23-like isoform 1 [Nomascus 
leucogenys]
 ref|XP_004090117.1| PREDICTED: 60S ribosomal protein L23-like isoform 2 [Nomascus 
leucogenys]
Length=142

 Score =   232 bits (592),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 128/141 (91%), Gaps = 2/141 (1%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR+SLGLPV A ++CADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRISLGLPVGAVISCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLR--KKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAIT  401
            VMATVKKGKP+LR  KKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAIT
Sbjct  61   VMATVKKGKPELRKKKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAIT  120

Query  402  GPIGKECADLWPRIASAANAI  464
            GP+ KECADLWP IAS A +I
Sbjct  121  GPVAKECADLWPWIASNAGSI  141



>ref|XP_007184247.1| PREDICTED: uncharacterized protein LOC103006299 [Balaenoptera 
acutorostrata scammoni]
Length=281

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 133/161 (83%), Gaps = 5/161 (3%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M KRGRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKG+KGRLNRLP+A VGDM
Sbjct  1    MPKRGRGGSSGEKFRISLGLPVGAVINCADNTGAKNLYIISVKGVKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGK +LRKKV PAV++RQRK +RRKDGVF+YFEDN GVIVN KG MKGSA+TGP
Sbjct  61   VMATVKKGKQELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNTGVIVNNKGYMKGSAVTGP  120

Query  408  IGKECADLWPRIASAANAIV*NHYLNWVL-----CFSFVWF  515
            + KECADLWPRIAS A +IV +      L     C SFV F
Sbjct  121  VAKECADLWPRIASNAGSIVISLGAFSTLAARERCDSFVMF  161



>gb|EFN77642.1| 60S ribosomal protein L23 [Harpegnathos saltator]
Length=205

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM++AT
Sbjct  70   GRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDMIVAT  129

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKVMPAV++RQRKP+RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  130  VKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKE  189

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A++I
Sbjct  190  CADLWPRIASNASSI  204



>ref|XP_003745601.1| PREDICTED: 60S ribosomal protein L23-like [Metaseiulus occidentalis]
Length=140

 Score =   231 bits (590),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG AG KFR+SLGLPV A +NCADNTGAKNL++I+V GIKGRLNRLP+A  GDM
Sbjct  1    MSKRGRGGQAGAKFRISLGLPVGAVMNCADNTGAKNLFVIAVNGIKGRLNRLPAAGCGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKAFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A++I
Sbjct  121  VSKECADLWPRIASNASSI  139



>gb|AAN05612.1| ribosomal protein L17A [Argopecten irradians]
Length=140

 Score =   231 bits (589),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  54   KRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVM  233
            KRGRGGSAG KFR+SL LPV A +NCADNTGAKNLY+I+VKGIKGRLNR+P+A  GDM++
Sbjct  3    KRGRGGSAGGKFRISLALPVGAVINCADNTGAKNLYVIAVKGIKGRLNRMPAAGAGDMIV  62

Query  234  ATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIG  413
            ATVKKGKP+LRKKVMPAV+VRQRK  RRK+GVF+YFEDNAGVIVN KGEMKGSAITGP+ 
Sbjct  63   ATVKKGKPELRKKVMPAVVVRQRKSVRRKNGVFIYFEDNAGVIVNNKGEMKGSAITGPVA  122

Query  414  KECADLWPRIASAANAI  464
            KECADLWPRIAS A++I
Sbjct  123  KECADLWPRIASNASSI  139



>gb|EYE98017.1| ribosomal protein L14b/L23e [Aspergillus ruber CBS 135680]
Length=140

 Score =   231 bits (589),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AGNK +MSLGLPV A +NC DN+GA+NLYIISVKGI  RLNRLP+A VGDM
Sbjct  1    MSKRGRGGAAGNKLKMSLGLPVGAVLNCCDNSGARNLYIISVKGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPWRR DG+++YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIYLYFEDNAGVIVNAKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKE A+LWPRIAS +  ++
Sbjct  121  VGKEAAELWPRIASNSGVVM  140



>gb|EKV07775.1| Alkaline serine protease [Penicillium digitatum Pd1]
 gb|EKV09336.1| Alkaline serine protease [Penicillium digitatum PHI26]
 emb|CDM33629.1| Ribosomal protein L14b/L23e [Penicillium roqueforti FM164]
 gb|KGO39039.1| Ribosomal protein L14b/L23e [Penicillium expansum]
 gb|KGO40291.1| Ribosomal protein L14b/L23e [Penicillium expansum]
 gb|KGO49611.1| Ribosomal protein L14b/L23e [Penicillium expansum]
 gb|KGO71927.1| Ribosomal protein L14b/L23e [Penicillium italicum]
Length=140

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AGNK +M+LGLPV A +NC DN+GA+NLYIISVKGI  RLNRLP+A VGDM
Sbjct  1    MSKRGRGGAAGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPWRR DG+F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIFLYFEDNAGVIVNAKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKE A+LWPRIAS +  ++
Sbjct  121  VGKEAAELWPRIASNSGVVM  140



>gb|EGI68616.1| 60S ribosomal protein L23 [Acromyrmex echinatior]
Length=153

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            +K  RGGSAG KFR+SLGLPV A +NCADNTGAKNLY+I+V+GIKGRLNRLP+A  GDM+
Sbjct  15   TKTRRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDMI  74

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            +ATVKKGKP+LRKKVMPAV++RQRKP+RRKDG F+YFEDNAGVIVN KGEMKGSAITGP+
Sbjct  75   VATVKKGKPELRKKVMPAVVIRQRKPFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPV  134

Query  411  GKECADLWPRIASAANAI  464
             KECADLWPRIAS A++I
Sbjct  135  AKECADLWPRIASNASSI  152



>gb|KIV87048.1| 60S ribosomal protein L23 [Exophiala sideris]
Length=214

 Score =   233 bits (595),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 130/156 (83%), Gaps = 7/156 (4%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNK +M+LGLPV A ++CADN+GA+NLYIISVKGI  RLNRLP+A VGDM
Sbjct  1    MSKRGRGGASGNKLKMTLGLPVGAVMSCADNSGARNLYIISVKGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPWRR DG+++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWRRSDGIYLYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV*NHYLNWVLCFSFVWF  515
            +GKE A+LWPRIAS       N  + W+       F
Sbjct  121  VGKEAAELWPRIAS-------NSGVGWLFAGELTKF  149



>gb|ACO14635.1| 60S ribosomal protein L23 [Caligus clemensi]
Length=140

 Score =   231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SLGLPV A +NCADNTGAKNLYII+V GI+GRLNRLP+A  GDM
Sbjct  1    MSKRGRGGTAGAKFRISLGLPVGAVINCADNTGAKNLYIIAVGGIRGRLNRLPAAGNGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKV+PAV++RQRK +RRKDG F+YFEDNAGVIVN KGE KGSAITGP
Sbjct  61   VLATVKKGKPELRKKVIPAVVIRQRKTFRRKDGTFLYFEDNAGVIVNNKGETKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIA+ A +I
Sbjct  121  VSKECADLWPRIATLAGSI  139



>ref|XP_002489484.1| 60S ribosomal protein L23 [Komagataella pastoris GS115]
 emb|CAY67203.1| hypothetical protein PAS_chr1-3_0300 [Komagataella pastoris GS115]
 emb|CCA36312.1| 60S ribosomal protein L23 [Komagataella pastoris CBS 7435]
Length=137

 Score =   230 bits (587),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  69   GSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK  248
            G++GNKFRMSLGLPV A +NCADN+GA+NLYI++VKG+  RLNRLP+A VGDMVMATVKK
Sbjct  5    GASGNKFRMSLGLPVGAIINCADNSGARNLYILAVKGVGARLNRLPAASVGDMVMATVKK  64

Query  249  GKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECAD  428
            GKP+LRKKVMPA+++RQ K WRRKDGVF+YFEDNAGVIVNPKGEMKGSAITGP+GKECAD
Sbjct  65   GKPELRKKVMPAIVIRQSKTWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPVGKECAD  124

Query  429  LWPRIASAANAIV  467
            LWPRIAS +  +V
Sbjct  125  LWPRIASNSGVVV  137



>ref|XP_011357841.1| PREDICTED: 60S ribosomal protein L23-like [Pteropus vampyrus]
Length=140

 Score =   230 bits (587),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRG GGS+G KFR+SLGL V A +NCADNTGAKN+YIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGHGGSSGAKFRISLGLLVGAVINCADNTGAKNVYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV+++QRK +RRK GVF+YFEDNAGVIVN KGEMKGS ITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVIQQRKSYRRKGGVFLYFEDNAGVIVNNKGEMKGSGITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPR AS A +I
Sbjct  121  VAKECADLWPRTASNAGSI  139



>ref|XP_010023856.1| PREDICTED: 60S ribosomal protein L23 isoform X2 [Eucalyptus grandis]
Length=129

 Score =   230 bits (586),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKG  389
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKG
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKG  114



>ref|XP_010091793.1| 60S ribosomal protein L23 [Morus notabilis]
 gb|EXB46001.1| 60S ribosomal protein L23 [Morus notabilis]
Length=179

 Score =   231 bits (590),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/123 (93%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  30   RAEGFTMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPS  209
            R E   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPS
Sbjct  42   RGERSRMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPS  101

Query  210  ACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKG  389
            ACVGDMVMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMK 
Sbjct  102  ACVGDMVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKV  161

Query  390  SAI  398
            S +
Sbjct  162  SQL  164



>ref|WP_036844039.1| hypothetical protein, partial [Pontibacillus marinus]
Length=138

 Score =   230 bits (587),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  63   RGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATV  242
            +GG++GNKFRM+LGLPVAA +NCADNTGAKNLY+ISV G   RLN+LP+A  GDMVMA+V
Sbjct  4    KGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNKLPAAACGDMVMASV  63

Query  243  KKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKEC  422
            KKGKPDLRKKV PAV++RQRKP+RRK+GV++YFEDNAGVIVNPKGEMKGSAITGP+ KEC
Sbjct  64   KKGKPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGPVAKEC  123

Query  423  ADLWPRIASAANAIV  467
            ADLWPRIASAAN+IV
Sbjct  124  ADLWPRIASAANSIV  138



>ref|XP_001540679.1| 60S ribosomal protein L23 [Histoplasma capsulatum NAm1]
 ref|XP_002791197.1| 60S ribosomal protein L23 [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EDN08009.1| hypothetical protein HCAG_04519 [Histoplasma capsulatum NAm1]
 gb|EEH10995.1| 60S ribosomal protein L23 [Histoplasma capsulatum G186AR]
 gb|EER43030.1| 60S ribosomal protein L23 [Histoplasma capsulatum H143]
 gb|EGC45962.1| 60S ribosomal protein [Histoplasma capsulatum H88]
Length=140

 Score =   230 bits (587),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AGNK +M+LGLPV A +NC DN+GA+N+YIISVKGI  RLNRLP+A VGDM
Sbjct  1    MSKRGRGGAAGNKLKMTLGLPVGAVMNCCDNSGARNIYIISVKGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPWRR DG+++YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWRRADGIYLYFEDNAGVIVNAKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKE  DLWPRIA+ +  +V
Sbjct  121  IGKEATDLWPRIAANSGVVV  140



>gb|ERE67619.1| 60S ribosomal protein L23-like protein [Cricetulus griseus]
Length=298

 Score =   236 bits (601),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  163  GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  222

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  223  VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  282

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  283  CADLWPRIASNAGSI  297



>ref|XP_010213367.1| PREDICTED: 60S ribosomal protein L23 [Tinamus guttatus]
Length=194

 Score =   232 bits (591),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  57   RGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMA  236
            +GRGGS+G KF +SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMA
Sbjct  58   KGRGGSSGAKFSISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMA  117

Query  237  TVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGK  416
            TVKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ K
Sbjct  118  TVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAK  177

Query  417  ECADLWPRIASAANAI  464
            ECADLWPRIAS A +I
Sbjct  178  ECADLWPRIASNAGSI  193



>ref|XP_007958989.1| PREDICTED: 60S ribosomal protein L23-like [Chlorocebus sabaeus]
Length=140

 Score =   229 bits (585),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M KRG GGS+G KF++SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDM
Sbjct  1    MLKRGCGGSSGAKFQISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKV PAV+VRQ+K +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVHPAVVVRQQKSYRRKDGAFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIA  A  I
Sbjct  121  VAKECADLWPRIAPNAGRI  139



>ref|XP_002562222.1| Pc18g03860 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP94610.1| Pc18g03860 [Penicillium rubens Wisconsin 54-1255]
Length=140

 Score =   229 bits (585),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AGNK +M+LGLP  A +NC DN+GA+NLYIISVKGI  RLNRLP+A VGDM
Sbjct  1    MSKRGRGGAAGNKLKMTLGLPTGAVMNCCDNSGARNLYIISVKGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPWRR DG+F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIFLYFEDNAGVIVNAKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKE A+LWPRIAS +  ++
Sbjct  121  VGKEAAELWPRIASNSGVVM  140



>ref|XP_002626001.1| 60S ribosomal protein L23 [Blastomyces dermatitidis SLH14081]
 gb|EEQ77734.1| alkaline serine protease [Blastomyces dermatitidis SLH14081]
 gb|EEQ86732.1| alkaline serine protease [Blastomyces dermatitidis ER-3]
 gb|EQL27901.1| 60S ribosomal protein L23 [Blastomyces dermatitidis ATCC 26199]
Length=140

 Score =   229 bits (585),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AGNK +M+LGLPV A +NC DN+GA+N+Y+ISVKGI  RLNRLP+A VGDM
Sbjct  1    MSKRGRGGAAGNKLKMTLGLPVGAVMNCCDNSGARNIYVISVKGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPWRR DG+++YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWRRADGIYLYFEDNAGVIVNAKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            IGKE  DLWPRIA+ +  +V
Sbjct  121  IGKEATDLWPRIAANSGVVV  140



>gb|ELU02136.1| hypothetical protein CAPTEDRAFT_172799 [Capitella teleta]
Length=140

 Score =   229 bits (585),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SLGLPV A +NCADNTG KNLY+I+V GI+GRLNRLP+A +GDM
Sbjct  1    MSKRGRGGTSGGKFRISLGLPVGAVMNCADNTGGKNLYVIAVHGIRGRLNRLPAAGMGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +ATVKKGKP+LRKKVMPAV++RQRK  RR DGVF+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVATVKKGKPELRKKVMPAVVIRQRKAIRRIDGVFLYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            +GKECADLWPRIAS A+ I
Sbjct  121  VGKECADLWPRIASNASCI  139



>ref|XP_001636882.1| predicted protein [Nematostella vectensis]
 gb|EDO44819.1| predicted protein, partial [Nematostella vectensis]
Length=136

 Score =   229 bits (584),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGG++G KFR++LGLPV A +NCADNTG KNLYII+VKGIKGRLNRLP+A  GDMV+AT
Sbjct  1    GRGGTSGGKFRIALGLPVGAVINCADNTGGKNLYIIAVKGIKGRLNRLPAAASGDMVLAT  60

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKVMPAV++RQRK +RRK+GVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  61   VKKGKPELRKKVMPAVVIRQRKAYRRKNGVFLYFEDNAGVIVNVKGEMKGSAITGPVAKE  120

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  121  CADLWPRIASNAGSI  135



>gb|AIL48394.1| large subunit ribosomal protein 23, partial [Teratodiplogaster 
sp. 1 VS-2014]
Length=140

 Score =   229 bits (584),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SLGLPV A +NCADNTGAKNL++I+V GIKGRLNRLPSA VGDM
Sbjct  1    MSKRGRGGASGAKFRISLGLPVGAVINCADNTGAKNLFVIAVFGIKGRLNRLPSAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKV+ AV+VRQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVASVKKGKPELRKKVLQAVVVRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|EPX70990.1| 60S ribosomal protein L23 [Schizosaccharomyces octosporus yFS286]
 gb|EPX71393.1| 60S ribosomal protein L23 [Schizosaccharomyces octosporus yFS286]
 gb|EPY50637.1| 60S ribosomal protein L23 [Schizosaccharomyces cryophilus OY26]
 gb|EPY53397.1| 60S ribosomal protein L23 [Schizosaccharomyces cryophilus OY26]
Length=139

 Score =   229 bits (584),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  57   RGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMA  236
            RGRG ++G K+RM+LGLPV A +NCADN+GAKNLYI+SV G   RLNRLP+A  GDM++A
Sbjct  3    RGRGAASGTKYRMTLGLPVQAILNCADNSGAKNLYIVSVFGTGARLNRLPAASCGDMILA  62

Query  237  TVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGK  416
            TVKKGKPDLRKK+MPA++VRQRK WRRKDGVF+YFEDNAGVIVNPKGEMKGSAITGP+ K
Sbjct  63   TVKKGKPDLRKKIMPAIVVRQRKAWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAK  122

Query  417  ECADLWPRIASAANAIV  467
            ECADLWPRIAS A  +V
Sbjct  123  ECADLWPRIASNAGTVV  139



>gb|KJB28525.1| hypothetical protein B456_005G053300 [Gossypium raimondii]
Length=135

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGS  392
            VMATVKKGKPDLRKKV+PAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKG+
Sbjct  61   VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGT  115



>gb|AFW64022.1| hypothetical protein ZEAMMB73_988730 [Zea mays]
Length=134

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/114 (99%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
Sbjct  1    MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKG  389
            VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGV+MYFEDNAGVIVNPKGEMKG
Sbjct  61   VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKG  114



>gb|EXX60185.1| ribosomal 60S subunit protein L23B [Rhizophagus irregularis DAOM 
197198w]
Length=125

 Score =   228 bits (582),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  93   MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKK  272
            M+LGLPV A +NCADN+GAKNLY+ISVKGI GRLNRLP+A VGDMVMATVKKGKPDLRKK
Sbjct  1    MTLGLPVGAVMNCADNSGAKNLYVISVKGIHGRLNRLPAAGVGDMVMATVKKGKPDLRKK  60

Query  273  VMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASA  452
            VMPAV++RQRKPWRRKDGVF+YFEDNAGVIVNPKGEMKGSAITGP+GKECADLWPRIAS+
Sbjct  61   VMPAVVIRQRKPWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPVGKECADLWPRIASS  120

Query  453  ANAIV  467
            +  +V
Sbjct  121  SGTVV  125



>ref|XP_001900778.1| 60S ribosomal protein L23 [Brugia malayi]
 ref|XP_003137029.1| large subunit ribosomal protein 23 [Loa loa]
 gb|EFO27044.1| 60S ribosomal protein L23 [Loa loa]
 gb|EJW89036.1| 60S ribosomal protein L23 [Wuchereria bancrofti]
 emb|CDP99137.1| Protein BM-RPL-23, isoform a [Brugia malayi]
Length=140

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SLGLPV A +NCADNTGAKNL++I+V GIKGRLNRLPSA VGDM
Sbjct  1    MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVIAVYGIKGRLNRLPSAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKV+ AV+VRQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVASVKKGKPELRKKVLQAVVVRQRKQYRRKDGSFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_005850601.1| hypothetical protein CHLNCDRAFT_59578 [Chlorella variabilis]
 gb|EFN58499.1| hypothetical protein CHLNCDRAFT_59578 [Chlorella variabilis]
Length=140

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M+ + +GG  GNKFRM+LGLPVAAT+NCADN+GAKNLY+ISV G   RLNRLP+A  GDM
Sbjct  1    MATKRKGGVGGNKFRMTLGLPVAATMNCADNSGAKNLYVISVHGWGSRLNRLPAAAPGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPA++VRQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAIVVRQRKAFRRKDGTFIYFEDNAGVIVNTKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECADLWPR+A+AAN IV
Sbjct  121  VCKECADLWPRVAAAANTIV  140



>ref|NP_588139.1| 60S ribosomal protein L23 [Schizosaccharomyces pombe 972h-]
 ref|NP_594075.1| 60S ribosomal protein L23 [Schizosaccharomyces pombe 972h-]
 sp|O42867.1|RL23_SCHPO RecName: Full=60S ribosomal protein L23 [Schizosaccharomyces 
pombe 972h-]
 emb|CAA15912.1| 60S ribosomal protein L23 [Schizosaccharomyces pombe]
 emb|CAA22864.1| 60S ribosomal protein L23 [Schizosaccharomyces pombe]
Length=139

 Score =   228 bits (582),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  57   RGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMA  236
            RGRG ++G K+RM+LGLPV A +NCADN+GAKNLYI+SV G   RLNRLP+A  GDMV+A
Sbjct  3    RGRGAASGTKYRMTLGLPVQAIMNCADNSGAKNLYIVSVFGTGARLNRLPAASCGDMVLA  62

Query  237  TVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGK  416
            TVKKGKPDLRKK+MPA++VRQRK WRRKDGV++YFEDNAGVIVNPKGEMKGSAITGP+ K
Sbjct  63   TVKKGKPDLRKKIMPAIVVRQRKAWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAK  122

Query  417  ECADLWPRIASAANAIV  467
            ECADLWPRIAS A  +V
Sbjct  123  ECADLWPRIASNAGTVV  139



>emb|CCX32527.1| Similar to 60S ribosomal protein L23-A; acc. no. P0CX41 [Pyronema 
omphalodes CBS 100304]
Length=140

 Score =   228 bits (582),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGR G+AGNK +M+LGLPV A +NC DN+GA+NLYIISV GI  RLNRLP+A VGDM
Sbjct  1    MSKRGRAGAAGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVTGIGARLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LRKKVMPAV+VRQ KPW+R DG ++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct  61   VMATVKKGKPELRKKVMPAVVVRQSKPWKRPDGAYLYFEDNAGVIVNPKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            +GKE ADLWPRIAS +  ++
Sbjct  121  VGKEAADLWPRIASNSGVVM  140



>gb|ERG81802.1| 60s ribosomal protein l23 [Ascaris suum]
Length=140

 Score =   228 bits (582),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SLGLPV A +NCADNTGAKNL++I+V GIKGRLNRLPSA VGDM
Sbjct  1    MSKRGRGGASGAKFRVSLGLPVGAVMNCADNTGAKNLFVIAVYGIKGRLNRLPSAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKV+ AV++RQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVASVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>ref|XP_008756250.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L23-like 
[Rattus norvegicus]
 ref|XP_008765372.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L23-like 
[Rattus norvegicus]
Length=140

 Score =   228 bits (581),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGGS+G KFR SLGLPV A +NC DNTGAKNLYIIS+KGIKGRLNRLP+A VGDM
Sbjct  1    MSKRGRGGSSGAKFRTSLGLPVGAMINCGDNTGAKNLYIISMKGIKGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKP+LR+KV PAV+ RQ K  +RKDGVF+YFEDNAGVIVN KGEM+GSAITGP
Sbjct  61   VMATVKKGKPELREKVHPAVVTRQXKSXQRKDGVFLYFEDNAGVIVNNKGEMEGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIA  A +I
Sbjct  121  VAKECADLWPRIAPNAGSI  139



>ref|XP_001712219.1| rpl23 [Hemiselmis andersenii]
 gb|ABW97894.1| rpl23 [Hemiselmis andersenii]
Length=140

 Score =   228 bits (581),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M KRGRG S GNKFR SLGLPV A +NCADNTGAKNLYII+V  IKGRLNRLP++ +GDM
Sbjct  1    MGKRGRGASVGNKFRTSLGLPVGAIINCADNTGAKNLYIIAVTRIKGRLNRLPASSIGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKV+ A+I+RQ+K WRRKDGVF+ FEDNAG+I NPKGE+KGSAITGP
Sbjct  61   VLATVKKGKPELRKKVLTAIIIRQKKFWRRKDGVFISFEDNAGIIANPKGELKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECA+LWP+IAS AN I+
Sbjct  121  VAKECAELWPKIASTANCII  140



>gb|ERZ95751.1| hypothetical protein GLOINDRAFT_341052 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX60183.1| ribosomal 60S subunit protein L23B [Rhizophagus irregularis DAOM 
197198w]
Length=130

 Score =   228 bits (580),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 124/140 (89%), Gaps = 10/140 (7%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++GNKFRM+LGLPV A +NCADN+GAKNLY+ISVKGI GRLNRLP+A VGDM
Sbjct  1    MSKRGRGGASGNKFRMTLGLPVGAVMNCADNSGAKNLYVISVKGIHGRLNRLPAAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            VMATVKKGKPDLRKKVMPAV++RQRKPWRRKDGVF+YFE          GEMKGSAITGP
Sbjct  61   VMATVKKGKPDLRKKVMPAVVIRQRKPWRRKDGVFLYFE----------GEMKGSAITGP  110

Query  408  IGKECADLWPRIASAANAIV  467
            +GKECADLWPRIAS++  +V
Sbjct  111  VGKECADLWPRIASSSGTVV  130



>dbj|BAJ98222.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|KEQ65670.1| ribosomal protein L14b/L23e [Aureobasidium melanogenum CBS 110374]
 gb|KEQ73021.1| ribosomal protein L14b/L23e [Aureobasidium pullulans var. namibiae 
CBS 147.97]
 gb|KEQ80377.1| ribosomal protein L14b/L23e [Aureobasidium pullulans EXF-150]
 gb|KEQ96438.1| hypothetical protein AUEXF2481DRAFT_3936 [Aureobasidium subglaciale 
EXF-2481]
Length=139

 Score =   228 bits (581),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  57   RGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMA  236
            RGRG ++GNK RM+LGLPV A +NCADN+GA+NLYIISVKGI  RLNRLP+  VGDMVMA
Sbjct  3    RGRGSTSGNKLRMTLGLPVGAVMNCADNSGARNLYIISVKGIGARLNRLPAGGVGDMVMA  62

Query  237  TVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGK  416
            TVKKGKP+LRKKVMPAVIVRQ KPWRR DG+F+YFEDNAGVIVNPKGEMKGSAITGP+GK
Sbjct  63   TVKKGKPELRKKVMPAVIVRQSKPWRRADGMFLYFEDNAGVIVNPKGEMKGSAITGPVGK  122

Query  417  ECADLWPRIASAANAIV  467
            E A+LWPRIAS +  ++
Sbjct  123  EAAELWPRIASNSGVVM  139



>emb|CBK20405.2| Ribosomal protein L14b/L23e [Blastocystis hominis]
 emb|CBK24342.2| Ribosomal protein L14b/L23e [Blastocystis hominis]
Length=141

 Score =   228 bits (581),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  51   SKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMV  230
            +KRGRGG+AGNKF+MSLGLP  A +NCADNTGAKNLY+ISV GI  RLNRLP+A  GDM 
Sbjct  3    AKRGRGGAAGNKFKMSLGLPAGAIMNCADNTGAKNLYVISVYGIGARLNRLPAASAGDMF  62

Query  231  MATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPI  410
            +A+VKKGKP+LRKKVMPAV+VRQRK WRRK+G+F+YFEDNAGVIVNPKGEMKGS ITGP+
Sbjct  63   IASVKKGKPELRKKVMPAVVVRQRKAWRRKNGMFLYFEDNAGVIVNPKGEMKGSGITGPV  122

Query  411  GKECADLWPRIASAANAI  464
             KE ADLWP+IAS+A++I
Sbjct  123  AKEAADLWPKIASSASSI  140



>gb|KHN78547.1| 60S ribosomal protein L23 [Toxocara canis]
 gb|KHN78563.1| 60S ribosomal protein L23 [Toxocara canis]
Length=140

 Score =   228 bits (580),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SLGLPV A +NCADNTGAKNL++I+V GIKGRLNRLPSA VGDM
Sbjct  1    MSKRGRGGASGAKFRVSLGLPVGAVMNCADNTGAKNLFVIAVYGIKGRLNRLPSAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKV+ AV++RQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVASVKKGKPELRKKVLQAVVIRQRKQFRRKDGSFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|AIL48390.1| large subunit ribosomal protein 23, partial [Acrostichus rhynchophori]
Length=140

 Score =   228 bits (580),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G+KFR+SLGLPV A +NCADNTGAKNL++I+V GI+GRLNRLPSA VGDM
Sbjct  1    MSKRGRGGTSGSKFRISLGLPVGAIMNCADNTGAKNLFVIAVYGIRGRLNRLPSAAVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKVM AV++RQRK +RRKDG  +YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVASVKKGKPELRKKVMQAVVIRQRKQFRRKDGTVIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



>gb|ACO10576.1| 60S ribosomal protein L23 [Caligus rogercresseyi]
Length=140

 Score =   227 bits (579),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SLGLPV A +NCADNTGAKNLYII+V GI+GRLNRLP+A  GDM
Sbjct  1    MSKRGRGGAAGAKFRISLGLPVGAVINCADNTGAKNLYIIAVGGIRGRLNRLPAAGNGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            V+ATVKKGKP+LRKKV+PAV++RQRK +RRK G F+YFEDNAGVIVN KGE KGSAITGP
Sbjct  61   VLATVKKGKPELRKKVLPAVVIRQRKTFRRKCGTFLYFEDNAGVIVNSKGETKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIA+ A +I
Sbjct  121  VSKECADLWPRIATLAGSI  139



>gb|AIL48398.1| large subunit ribosomal protein 23, partial [Bunonema sp. VS-2014]
Length=140

 Score =   227 bits (579),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG+AG KFR+SLGLPV A +NCADNTGAKNLY+I+V GI+GRLNRLP+ACVGDM
Sbjct  1    MSKRGRGGTAGAKFRISLGLPVGAVMNCADNTGAKNLYVIAVFGIRGRLNRLPAACVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKV+ AV++RQRK +RRKDG F+YF+DNAGVIVN KGEMKGSAITGP
Sbjct  61   FVASVKKGKPELRKKVLQAVVIRQRKSFRRKDGTFIYFKDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECAD WPRIAS A +I
Sbjct  121  VAKECADAWPRIASNAPSI  139



>ref|XP_011400127.1| 60S ribosomal protein L23 [Auxenochlorella protothecoides]
 gb|KFM27160.1| 60S ribosomal protein L23 [Auxenochlorella protothecoides]
Length=140

 Score =   227 bits (578),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            M+ + +GG  GNKFR++LGLPVAAT+NCADN+G KNLY+ISV G   RLNRLP+A  GDM
Sbjct  1    MATKRKGGVGGNKFRLTLGLPVAATMNCADNSGGKNLYVISVHGWGARLNRLPAAAPGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
            +MAT KKGKPDLRKKVMPA+++RQRK WRRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   IMATCKKGKPDLRKKVMPAIVIRQRKAWRRKDGTFIYFEDNAGVIVNTKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAIV  467
            + KECADLWPR+A+AAN IV
Sbjct  121  VAKECADLWPRVAAAANTIV  140



>gb|AIL48399.1| large subunit ribosomal protein 23, partial [Koerneria sp. 2 
VS-2014]
Length=140

 Score =   227 bits (578),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SL LPV A +NCADNTGAKNL++I+V GIKGRLNRLPSA VGDM
Sbjct  1    MSKRGRGGASGAKFRVSLALPVGAVINCADNTGAKNLFVIAVYGIKGRLNRLPSAAVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKVM AV++RQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVASVKKGKPELRKKVMQAVVIRQRKAFRRKDGSFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS +  I
Sbjct  121  VAKECADLWPRIASNSGTI  139



>gb|KHJ89553.1| ribosomal protein L14p/L23e [Oesophagostomum dentatum]
Length=140

 Score =   227 bits (578),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SLGLPV A +NCADNTGAKNL++I+V GI+GRLNRLPSA VGDM
Sbjct  1    MSKRGRGGASGAKFRISLGLPVGAVINCADNTGAKNLFVIAVYGIRGRLNRLPSAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKV+ AV++RQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVASVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIA+ A +I
Sbjct  121  VAKECADLWPRIAANAGSI  139



>emb|CDJ89872.1| Ribosomal protein L14b L23e domain containing protein, partial 
[Haemonchus contortus]
Length=141

 Score =   227 bits (578),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG++G KFR+SLGLPV A +NCADNTGAKNL++I+V GI+GRLNRLPSA VGDM
Sbjct  2    MSKRGRGGASGAKFRISLGLPVGAVINCADNTGAKNLFVIAVYGIRGRLNRLPSAGVGDM  61

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKV+ AV++RQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  62   FVASVKKGKPELRKKVLQAVVIRQRKSFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP  121

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIA+ A +I
Sbjct  122  VAKECADLWPRIAANAGSI  140



>gb|ELK01583.1| F-box only protein 47 [Pteropus alecto]
Length=467

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  60   GRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMAT  239
            GRGGS+G KFR+SLGLPV A +NCADNTGAKNLYIISVKGIKGRLNRLP+A VGDMVMAT
Sbjct  332  GRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMAT  391

Query  240  VKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKE  419
            VKKGKP+LRKKV PAV++RQRK +RRKDGVF+YFEDNAGVIVN KGEMKGSAITGP+ KE
Sbjct  392  VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKE  451

Query  420  CADLWPRIASAANAI  464
            CADLWPRIAS A +I
Sbjct  452  CADLWPRIASNAGSI  466



>ref|XP_007182335.1| PREDICTED: 60S ribosomal protein L23-like [Balaenoptera acutorostrata 
scammoni]
Length=153

 Score =   227 bits (579),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +3

Query  42   FTMSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVG  221
            F MSK+GRGGS+G KFR+SLGL V A +NCAD+TGAKNLYIISVKGI GRLNRLP+A VG
Sbjct  11   FKMSKQGRGGSSGAKFRISLGLLVGAVINCADDTGAKNLYIISVKGINGRLNRLPAAGVG  70

Query  222  DMVM-ATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAI  398
            DMVM ATVKKGKP+LRKKV P V++RQRK +RRK GVF+YFEDNAGVIVN KGEMKGSAI
Sbjct  71   DMVMMATVKKGKPELRKKVHPVVVIRQRKSYRRKGGVFLYFEDNAGVIVNNKGEMKGSAI  130

Query  399  TGPIGKECADLWPRIASAANA  461
            TGP+ KECADLWPRIAS A +
Sbjct  131  TGPVAKECADLWPRIASNAGS  151



>gb|AIL48389.1| large subunit ribosomal protein 23, partial [Sachsia zurstrasseni]
 gb|AIL48392.1| large subunit ribosomal protein 23, partial [Paroigolaimella 
micrura]
Length=140

 Score =   226 bits (577),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  48   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM  227
            MSKRGRGG AG KFR+SLGLPV A +NCADNTGAKNL++I+V GI+GRLNRLP+A VGDM
Sbjct  1    MSKRGRGGQAGAKFRISLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPTAGVGDM  60

Query  228  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP  407
             +A+VKKGKP+LRKKV+ AV++RQRK +RRKDG F+YFEDNAGVIVN KGEMKGSAITGP
Sbjct  61   FVASVKKGKPELRKKVLQAVVIRQRKQYRRKDGSFIYFEDNAGVIVNNKGEMKGSAITGP  120

Query  408  IGKECADLWPRIASAANAI  464
            + KECADLWPRIAS A +I
Sbjct  121  VAKECADLWPRIASNAGSI  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325