BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H18

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46302.1|  cysteine proteinase precursor                          278   2e-89   Ipomoea nil [qian niu]
gb|AAQ81938.1|  cysteine proteinase precursor                           265   3e-84   Ipomoea batatas [batate]
gb|KJB29613.1|  hypothetical protein B456_005G110200                    221   2e-69   Gossypium raimondii
gb|KJB29612.1|  hypothetical protein B456_005G110200                    221   3e-68   Gossypium raimondii
ref|XP_007017672.1|  Papain family cysteine protease                    222   2e-67   
gb|KJB29611.1|  hypothetical protein B456_005G110200                    221   2e-67   Gossypium raimondii
gb|KHG15062.1|  Cysteinease RD19a -like protein                         217   1e-65   Gossypium arboreum [tree cotton]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            214   1e-64   Populus euphratica
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                213   5e-64   Erythranthe guttata [common monkey flower]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             212   5e-64   
emb|CDP07452.1|  unnamed protein product                                211   2e-63   Coffea canephora [robusta coffee]
gb|ABK96580.1|  unknown                                                 210   3e-63   Populus trichocarpa x Populus deltoides
gb|ABK94801.1|  unknown                                                 210   4e-63   Populus trichocarpa [western balsam poplar]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    210   4e-63   Gossypium raimondii
dbj|BAJ53178.1|  JHL18I08.12                                            209   6e-63   Jatropha curcas
gb|KDO84721.1|  hypothetical protein CISIN_1g017548mg                   207   1e-62   Citrus sinensis [apfelsine]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   206   9e-62   Citrus sinensis [apfelsine]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            206   9e-62   Citrus sinensis [apfelsine]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            206   1e-61   Nicotiana tomentosiformis
gb|AIB06025.1|  CP3                                                     206   2e-61   Hevea brasiliensis [jebe]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             204   7e-61   Citrus clementina [clementine]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 204   1e-60   Solanum melongena [aubergine]
gb|AAK07731.1|  CPR2-like cysteine proteinase                           203   1e-60   Nicotiana tabacum [American tobacco]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          203   1e-60   Nelumbo nucifera [Indian lotus]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 202   2e-60   Malus domestica [apple tree]
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 202   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          202   3e-60   Nelumbo nucifera [Indian lotus]
gb|EPS65881.1|  cysteine proteinase                                     201   4e-60   Genlisea aurea
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             202   4e-60   
gb|AAZ32411.1|  cysteine proteinase glycinain type                      201   6e-60   Nicotiana benthamiana
emb|CDY34441.1|  BnaC01g21920D                                          202   6e-60   Brassica napus [oilseed rape]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            201   7e-60   Nicotiana sylvestris
ref|XP_002510469.1|  cysteine protease, putative                        201   1e-59   Ricinus communis
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            201   1e-59   Brassica rapa
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          201   1e-59   Sesamum indicum [beniseed]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    200   2e-59   Nicotiana tabacum [American tobacco]
dbj|BAG16515.1|  putative cysteine proteinase                           200   2e-59   Capsicum chinense [bonnet pepper]
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            200   3e-59   Solanum tuberosum [potatoes]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     199   5e-59   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     199   6e-59   Ipomoea batatas [batate]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            199   1e-58   Sesamum indicum [beniseed]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 198   1e-58   
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          197   3e-58   Nicotiana sylvestris
emb|CAA78403.1|  pre-pro-cysteine proteinase                            197   4e-58   Solanum lycopersicum
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             197   4e-58   Prunus persica
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    197   5e-58   Ipomoea batatas [batate]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    197   5e-58   Nicotiana tabacum [American tobacco]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    196   1e-57   Ipomoea batatas [batate]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     195   2e-57   Glycine max [soybeans]
emb|CDP20652.1|  unnamed protein product                                196   2e-57   Coffea canephora [robusta coffee]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               196   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            195   2e-57   Prunus mume [ume]
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          195   3e-57   Nicotiana tomentosiformis
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         195   3e-57   Jatropha curcas
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            194   4e-57   Fragaria vesca subsp. vesca
gb|KHN22211.1|  Cysteine proteinase 15A                                 194   6e-57   Glycine soja [wild soybean]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               193   1e-56   Vitis vinifera
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    193   1e-56   Ipomoea batatas [batate]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                193   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          193   2e-56   Eucalyptus grandis [rose gum]
ref|XP_010105270.1|  Cysteine proteinase 15A                            193   2e-56   Morus notabilis
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            192   4e-56   Glycine max [soybeans]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            192   4e-56   Populus euphratica
gb|KHN45894.1|  Cysteine proteinase RD19a                               192   4e-56   Glycine soja [wild soybean]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 192   5e-56   Vitis vinifera
gb|AEQ94105.1|  putative drought-inducible cysteine proteinase          186   6e-56   Elaeis guineensis
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            191   7e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             191   8e-56   Arabidopsis lyrata subsp. lyrata
gb|ACM80348.1|  cysteine proteinase                                     191   1e-55   Solanum lycopersicum
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  190   2e-55   Phaseolus vulgaris [French bean]
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                191   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               190   2e-55   Solanum lycopersicum
ref|XP_010436538.1|  PREDICTED: cysteine proteinase 15A-like            186   2e-55   
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            190   2e-55   Camelina sativa [gold-of-pleasure]
ref|NP_567489.1|  papain family cysteine protease                       190   3e-55   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD10859.1|  cysteine protease                                      189   3e-55   Tripolium pannonicum [sea starwort]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             189   3e-55   Eutrema salsugineum [saltwater cress]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             189   4e-55   Phaseolus vulgaris [French bean]
gb|AAK27969.1|AF242373_1  cysteine protease                             188   9e-55   Ipomoea batatas [batate]
gb|AEQ94152.1|  drought-inducible cysteine proteinase                   185   1e-54   Elaeis guineensis
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          188   1e-54   Cucumis sativus [cucumbers]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    188   1e-54   Sesamum indicum [beniseed]
ref|XP_007160703.1|  hypothetical protein PHAVU_001G009900g             186   1e-54   Phaseolus vulgaris [French bean]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             188   1e-54   Prunus persica
ref|NP_001267989.1|  cysteine protease precursor                        188   2e-54   Vitis vinifera
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          187   2e-54   Cicer arietinum [garbanzo]
ref|XP_003606999.1|  Cysteine proteinase                                183   2e-54   
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             187   2e-54   Capsella rubella
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               187   3e-54   Prunus mume [ume]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          187   4e-54   Solanum tuberosum [potatoes]
emb|CAB17075.1|  cysteine proteinase precursor                          186   4e-54   Phaseolus vulgaris [French bean]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               187   5e-54   Arabis alpina [alpine rockcress]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       186   5e-54   Fragaria vesca subsp. vesca
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          186   6e-54   Cucumis melo [Oriental melon]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 186   7e-54   Vitis vinifera
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             186   1e-53   Phaseolus vulgaris [French bean]
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              186   1e-53   Elaeis guineensis
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              185   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          184   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            184   3e-53   Glycine max [soybeans]
dbj|BAF03553.1|  cysteine proteinase CP2                                184   4e-53   Phaseolus vulgaris [French bean]
gb|ACX54787.2|  cysteine protease                                       184   5e-53   Arachis diogoi
gb|ACK57563.1|  cysteine protease-like protein                          184   5e-53   Arachis hypogaea [goober]
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          184   5e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS70818.1|  cysteine proteinase                                     183   6e-53   Genlisea aurea
ref|XP_003606998.1|  Cysteine proteinase                                183   7e-53   Medicago truncatula
gb|AIB06024.1|  CP2                                                     183   8e-53   Hevea brasiliensis [jebe]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               183   8e-53   
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     183   1e-52   Cicer arietinum [garbanzo]
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              183   1e-52   Phoenix dactylifera
dbj|BAA92495.1|  cysteine protease                                      182   1e-52   Vigna mungo [urad dal]
gb|ABQ10201.1|  cysteine protease Cp3                                   182   2e-52   Actinidia deliciosa [Chinese gooseberry]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              181   4e-52   Phoenix dactylifera
gb|ACI04578.1|  cysteine protease-like protein                          180   5e-52   Robinia pseudoacacia [black locust]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          181   5e-52   Cucumis sativus [cucumbers]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          181   5e-52   Sorghum bicolor [broomcorn]
emb|CAA82995.1|  cysteine proteinase                                    181   5e-52   Vicia sativa [spring vetch]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               181   7e-52   Pyrus x bretschneideri [bai li]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              181   7e-52   Elaeis guineensis
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             180   1e-51   Phaseolus vulgaris [French bean]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          180   1e-51   Eucalyptus grandis [rose gum]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 181   2e-51   
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          179   2e-51   Populus euphratica
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          179   2e-51   Cucumis melo [Oriental melon]
ref|NP_001046828.1|  Os02g0469600                                       179   3e-51   
gb|AFK47617.1|  unknown                                                 176   3e-51   Medicago truncatula
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 179   3e-51   Sandersonia aurantiaca [Chinese-lantern lily]
gb|ACF86683.1|  unknown                                                 179   4e-51   Zea mays [maize]
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 179   4e-51   
ref|XP_007042077.1|  Papain family cysteine protease                    179   4e-51   
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              179   6e-51   Setaria italica
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   178   6e-51   Citrus sinensis [apfelsine]
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               179   6e-51   Cucumis sativus [cucumbers]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          179   7e-51   
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          179   7e-51   Cucumis melo [Oriental melon]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    178   8e-51   
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       178   1e-50   Eucalyptus grandis [rose gum]
gb|KHG24064.1|  Cysteinease RD19a -like protein                         178   1e-50   Gossypium arboreum [tree cotton]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          178   1e-50   Citrus sinensis [apfelsine]
gb|AAB67878.1|  pre-pro-cysteine proteinase                             177   1e-50   Vicia faba [broad bean]
gb|AAO11786.1|  pre-pro cysteine proteinase                             177   1e-50   Vicia faba [broad bean]
gb|AAN60308.1|  unknown                                                 172   2e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDY09707.1|  BnaC07g33540D                                          177   2e-50   Brassica napus [oilseed rape]
gb|KJB32561.1|  hypothetical protein B456_005G247000                    177   2e-50   Gossypium raimondii
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    176   4e-50   Zea mays [maize]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    176   4e-50   Pisum sativum [garden pea]
ref|XP_003589348.1|  Cysteine proteinase                                176   5e-50   Medicago truncatula
emb|CDX90537.1|  BnaA03g42440D                                          175   9e-50   
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               175   9e-50   Vitis vinifera
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          175   9e-50   Glycine max [soybeans]
gb|KHN25410.1|  Cysteine proteinase RD19a                               175   1e-49   Glycine soja [wild soybean]
gb|KJB79049.1|  hypothetical protein B456_013G033800                    171   1e-49   Gossypium raimondii
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       175   1e-49   Tarenaya hassleriana [spider flower]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    174   2e-49   Arabis alpina [alpine rockcress]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             175   2e-49   Citrus clementina [clementine]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          174   2e-49   
dbj|BAF98584.1|  CM0216.500.nc                                          174   2e-49   Lotus japonicus
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         174   3e-49   Lotus japonicus
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              174   3e-49   Brachypodium distachyon [annual false brome]
gb|KJB79050.1|  hypothetical protein B456_013G033800                    171   4e-49   Gossypium raimondii
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          175   5e-49   
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             174   5e-49   Eutrema salsugineum [saltwater cress]
ref|XP_002512963.1|  cysteine protease, putative                        174   5e-49   Ricinus communis
gb|KJB79048.1|  hypothetical protein B456_013G033800                    170   5e-49   Gossypium raimondii
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          175   6e-49   
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          173   8e-49   Brassica rapa
emb|CDY41960.1|  BnaA01g05320D                                          172   9e-49   Brassica napus [oilseed rape]
gb|ABF46642.1|  papain-like cysteine proteinase                         172   1e-48   Pachysandra terminalis
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         172   1e-48   Lotus japonicus
gb|AAM65162.1|  cysteine proteinase RD19A                               172   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568052.1|  cysteine proteinase RD19a                             172   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             172   1e-48   
gb|KHG15253.1|  Cysteinease RD19a -like protein                         172   2e-48   Gossypium arboreum [tree cotton]
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          171   2e-48   Glycine max [soybeans]
dbj|BAC41322.1|  hypothetical protein                                   171   3e-48   Lotus japonicus
gb|KJB79047.1|  hypothetical protein B456_013G033800                    171   4e-48   Gossypium raimondii
gb|KJB07487.1|  hypothetical protein B456_001G026600                    171   5e-48   Gossypium raimondii
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               170   7e-48   Brassica rapa
gb|AJA74415.1|  cysteine protease                                       170   9e-48   Cicer arietinum [garbanzo]
emb|CAE54306.1|  putative papain-like cysteine proteinase               170   1e-47   Gossypium hirsutum [American cotton]
emb|CDY71205.1|  BnaCnng71840D                                          170   1e-47   Brassica napus [oilseed rape]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             169   1e-47   Capsella rubella
dbj|BAF98585.1|  CM0216.510.nc                                          169   2e-47   Lotus japonicus
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             169   2e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          169   2e-47   Camelina sativa [gold-of-pleasure]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       169   3e-47   Brassica oleracea
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 169   3e-47   
gb|ABK92536.1|  unknown                                                 169   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               168   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               168   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          168   7e-47   Brassica rapa
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              167   8e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN39817.1|  Cysteine proteinase RD19a                               166   1e-46   Glycine soja [wild soybean]
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            167   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               167   2e-46   Populus euphratica
ref|NP_565512.1|  Papain family cysteine protease                       166   2e-46   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43619.1|  putative cysteine proteinase                           166   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              167   3e-46   Setaria italica
gb|AAX19661.1|  cysteine proteinase                                     166   3e-46   Populus tomentosa [Chinese white poplar]
emb|CAQ00101.1|  papain-like cysteine proteinase                        166   3e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       166   4e-46   Brassica rapa
emb|CDP08018.1|  unnamed protein product                                161   4e-46   Coffea canephora [robusta coffee]
gb|EMT16425.1|  Cysteine proteinase 1                                   166   6e-46   
emb|CDY15894.1|  BnaA04g12170D                                          165   6e-46   Brassica napus [oilseed rape]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              165   9e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAD40319.2|  OSJNBb0054B09.3                                        164   2e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EMT10192.1|  Cysteine proteinase 1                                   164   2e-45   
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               164   4e-45   Beta vulgaris subsp. vulgaris [field beet]
gb|AAW21813.1|  cysteine protease                                       161   2e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              160   8e-44   Brachypodium distachyon [annual false brome]
gb|AES89347.2|  papain family cysteine protease                         151   5e-41   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                                151   6e-41   
gb|AAN57719.1|  cysteine proteinase precursor                           145   6e-41   Solanum melongena [aubergine]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             152   6e-41   Eutrema salsugineum [saltwater cress]
gb|EMS64962.1|  Cysteine proteinase 1                                   150   1e-40   Triticum urartu
ref|XP_003607110.1|  Cysteine proteinase                                150   1e-40   Medicago truncatula
emb|CDX99593.1|  BnaC04g33500D                                          150   2e-40   
gb|KEH30505.1|  papain family cysteine protease                         149   3e-40   Medicago truncatula
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          150   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             146   5e-39   
gb|ABK21238.1|  unknown                                                 146   9e-39   Picea sitchensis
gb|ABK24688.1|  unknown                                                 146   9e-39   Picea sitchensis
emb|CAA52403.1|  putative thiol protease                                143   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              144   7e-38   
gb|ACN40679.1|  unknown                                                 144   8e-38   Picea sitchensis
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              142   4e-37   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       136   4e-35   Brassica rapa
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 133   8e-34   Tarenaya hassleriana [spider flower]
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg             132   2e-33   Eutrema salsugineum [saltwater cress]
gb|ABK24153.1|  unknown                                                 132   3e-33   Picea sitchensis
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 131   6e-33   Prunus mume [ume]
emb|CAB41090.1|  cysteine proteinase precursor-like protein             129   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567010.5|  Papain family cysteine protease                       129   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       128   5e-32   Brassica rapa
emb|CDX73424.1|  BnaC08g25790D                                          128   5e-32   
gb|AAB16996.1|  thiol protease isoform B                                127   6e-32   Glycine max [soybeans]
emb|CDY56961.1|  BnaA09g55030D                                          127   9e-32   Brassica napus [oilseed rape]
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    127   9e-32   Arabis alpina [alpine rockcress]
gb|EEE60725.1|  hypothetical protein OsJ_14236                          127   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EMS53996.1|  Cysteine proteinase 1                                   127   1e-31   Triticum urartu
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             127   1e-31   Prunus persica
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             126   3e-31   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A                 126   3e-31   Cucumis melo [Oriental melon]
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                   125   5e-31   Eucalyptus grandis [rose gum]
ref|XP_001781954.1|  predicted protein                                  125   5e-31   
ref|XP_007010012.1|  Papain family cysteine protease                    125   1e-30   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg             124   1e-30   Citrus clementina [clementine]
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       124   2e-30   Elaeis guineensis
ref|XP_010103534.1|  putative cysteine proteinase A494                  123   3e-30   Morus notabilis
gb|AAR92156.1|  putative cysteine protease 3                            122   4e-30   Iris x hollandica [Dutch iris]
gb|KEH43476.1|  papain family cysteine protease                         123   5e-30   Medicago truncatula
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            123   5e-30   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            123   6e-30   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A                 123   6e-30   Vitis vinifera
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             122   8e-30   Capsella rubella
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like            122   9e-30   Solanum tuberosum [potatoes]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            122   1e-29   Cicer arietinum [garbanzo]
gb|KJB73490.1|  hypothetical protein B456_011G235500                    122   1e-29   Gossypium raimondii
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A                 121   2e-29   Solanum lycopersicum
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            121   3e-29   Camelina sativa [gold-of-pleasure]
gb|KDP30486.1|  hypothetical protein JCGZ_16165                         121   3e-29   Jatropha curcas
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       120   4e-29   Phoenix dactylifera
gb|KHG08355.1|  Cysteinease 1                                           120   5e-29   Gossypium arboreum [tree cotton]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 120   5e-29   
ref|XP_001761980.1|  predicted protein                                  120   5e-29   
ref|XP_002533377.1|  cysteine protease, putative                        120   6e-29   Ricinus communis
ref|NP_001236888.1|  cysteine proteinase precursor                      119   9e-29   Glycine max [soybeans]
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800          119   1e-28   
emb|CDO99795.1|  unnamed protein product                                119   1e-28   Coffea canephora [robusta coffee]
gb|ADE76932.1|  unknown                                                 119   1e-28   Picea sitchensis
gb|AEQ54770.1|  cysteine proteinase CP1                                 119   1e-28   Coffea canephora [robusta coffee]
gb|KJB60399.1|  hypothetical protein B456_009G303700                    114   1e-28   Gossypium raimondii
emb|CAB16316.1|  cysteine proteinase precursor                          118   2e-28   Vicia sativa [spring vetch]
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A                 118   2e-28   Populus euphratica
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 118   3e-28   Nelumbo nucifera [Indian lotus]
emb|CAB17077.1|  cysteine proteinase precursor                          118   3e-28   Phaseolus vulgaris [French bean]
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g             117   4e-28   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 117   4e-28   Nicotiana sylvestris
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             118   4e-28   Phaseolus vulgaris [French bean]
emb|CAN64491.1|  hypothetical protein VITISV_015725                     117   5e-28   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                117   6e-28   
gb|EPS63354.1|  hypothetical protein M569_11429                         116   1e-27   
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056             115   3e-27   
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 114   5e-27   
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661              113   1e-26   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A                 113   1e-26   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A                 113   2e-26   
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              108   8e-25   
emb|CDY14798.1|  BnaC04g47950D                                          103   9e-25   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A                 108   1e-24   
gb|EAY93546.1|  hypothetical protein OsI_15336                          107   2e-24   
emb|CCC48260.1|  cysteine peptidase precursor, fragment                 104   2e-24   
gb|KDO48246.1|  hypothetical protein CISIN_1g037577mg                   102   5e-24   
emb|CCD21595.1|  hypothetical protein, conserved in T. vivax            104   7e-24   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956             104   2e-23   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           103   3e-23   
emb|CCC48263.1|  cysteine peptidase precursor, fragment                 102   3e-23   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         103   6e-23   
emb|CAF92720.1|  unnamed protein product                              99.4    6e-23   
emb|CCC48256.1|  cysteine peptidase precursor                           103   7e-23   
emb|CCC48258.1|  cysteine peptidase precursor                           103   8e-23   
ref|XP_003970181.1|  PREDICTED: cathepsin F-like                        103   8e-23   
emb|CCC48259.1|  cysteine peptidase precursor, fragment                 103   8e-23   
emb|CCD21670.1|  cysteine peptidase (CP), putative                      102   9e-23   
gb|KHN25481.1|  Cysteine proteinase 15A                                 100   1e-22   
gb|EEC82027.1|  hypothetical protein OsI_25996                          105   1e-22   
emb|CCC48265.1|  cysteine peptidase precursor, fragment                 102   2e-22   
emb|CCC48262.1|  cysteine peptidase, Clan CA, family C1,Cathepsin...    101   2e-22   
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          100   2e-22   
ref|XP_006294682.1|  hypothetical protein CARUB_v10023719mg           97.1    2e-22   
gb|EEE67161.1|  hypothetical protein OsJ_24244                          100   3e-22   
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          101   3e-22   
ref|NP_001059639.1|  Os07g0480900                                       101   4e-22   
emb|CDQ83896.1|  unnamed protein product                                100   4e-22   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   100   7e-22   
ref|XP_005916689.1|  PREDICTED: cathepsin F-like                        100   7e-22   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660               100   8e-22   
gb|ACN56478.1|  cathepsin F                                             100   1e-21   
ref|XP_007568468.1|  PREDICTED: cathepsin W                             100   1e-21   
gb|ACC86111.1|  cathepsin F                                             100   1e-21   
ref|XP_003451852.1|  PREDICTED: cathepsin F-like                        100   2e-21   
emb|CCD20093.1|  cysteine peptidase precursor                         99.8    2e-21   
ref|XP_004563245.1|  PREDICTED: cathepsin F-like                        100   2e-21   
gb|ACN10907.1|  Cathepsin F precursor                                 99.8    3e-21   
emb|CCD14732.1|  unnamed protein product                              99.4    3e-21   
ref|XP_005811173.1|  PREDICTED: cathepsin F-like                      99.4    3e-21   
emb|CCD11724.1|  unnamed protein product                              98.6    3e-21   
emb|CCD15484.1|  unnamed protein product                              99.0    3e-21   
ref|XP_008418047.1|  PREDICTED: cathepsin F-like                      99.4    3e-21   
emb|CDY13816.1|  BnaA09g43180D                                        97.4    4e-21   
emb|CAA81061.1|  cysteine proteinase                                  99.0    4e-21   
emb|CCD11889.1|  unnamed protein product                              99.0    4e-21   
emb|CCD12272.1|  unnamed protein product                              98.6    5e-21   
gb|AAA18215.1|  cysteine protease precursor                           98.6    6e-21   
emb|CCD13687.1|  unnamed protein product                              98.6    1e-20   
gb|AFA34858.1|  cathepsin L-like protein                              97.8    1e-20   
ref|XP_006782128.1|  PREDICTED: cathepsin F-like                      97.4    2e-20   
dbj|BAK03623.1|  predicted protein                                    94.4    2e-20   
ref|XP_005305555.1|  PREDICTED: cathepsin F                           95.9    2e-20   
ref|NP_001106423.1|  cathepsin F precursor                            97.1    2e-20   
ref|XP_002672864.1|  predicted protein                                95.9    2e-20   
ref|XP_008780344.1|  PREDICTED: cysteine proteinase 15A-like          94.0    2e-20   
ref|XP_010597319.1|  PREDICTED: cathepsin F                           96.7    2e-20   
emb|CAQ00102.1|  papain-like cysteine proteinase                      95.9    3e-20   
emb|CDW75439.1|  cathepsin l                                          95.5    3e-20   
ref|XP_820178.1|  cruzipain precursor                                 93.2    3e-20   
gb|AAB01769.1|  cysteine proteinase homolog                           95.5    3e-20   
ref|XP_010754224.1|  PREDICTED: cathepsin F                           96.7    3e-20   
gb|EKG00105.1|  cysteine peptidase, putative,cysteine peptidase, ...  95.1    4e-20   
ref|XP_006129733.1|  PREDICTED: cathepsin F-like                      95.1    4e-20   
ref|NP_001133678.1|  Cathepsin F precursor                            96.3    4e-20   
ref|XP_007518834.1|  PREDICTED: cathepsin F                           95.9    5e-20   
ref|XP_010896687.1|  PREDICTED: cathepsin F                           96.3    5e-20   
emb|CCD16236.1|  unnamed protein product                              95.9    5e-20   
emb|CAE47501.1|  cathepsin L-like proteinase                          94.7    5e-20   
ref|XP_004383745.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      96.3    6e-20   
ref|XP_004713618.1|  PREDICTED: cathepsin F                           94.4    6e-20   
gb|AAB41118.1|  cruzipain                                             94.7    6e-20   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site             95.1    6e-20   
ref|XP_006171430.1|  PREDICTED: cathepsin F                           95.1    9e-20   
gb|AAA30270.1|  cysteine proteinase                                   92.4    1e-19   
ref|XP_002674919.1|  predicted protein                                94.0    1e-19   
gb|EKG02025.1|  cysteine peptidase, putative,cysteine peptidase, ...  93.6    1e-19   
emb|CCD16903.1|  unnamed protein product                              94.4    2e-19   
ref|XP_007461994.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      95.1    2e-19   
gb|EKF27064.1|  cysteine peptidase                                    92.0    2e-19   
gb|ELV09527.1|  Cathepsin F                                           95.5    2e-19   
ref|XP_006044419.1|  PREDICTED: cathepsin F isoform X2                94.4    2e-19   
ref|NP_001068884.1|  cathepsin F precursor                            94.4    2e-19   
ref|XP_003774144.1|  PREDICTED: cathepsin F                           94.0    3e-19   
ref|XP_006179549.1|  PREDICTED: cathepsin F                           92.8    3e-19   
ref|XP_007942912.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      94.4    3e-19   
ref|XP_008280430.1|  PREDICTED: cathepsin W isoform X2                94.0    3e-19   
ref|XP_005699988.1|  PREDICTED: cathepsin F isoform X3                92.4    3e-19   
ref|XP_006937669.1|  PREDICTED: cathepsin F                           94.0    3e-19   
ref|XP_006044418.1|  PREDICTED: cathepsin F isoform X1                94.0    3e-19   
gb|AAC37213.1|  cysteine proteinase                                   94.0    3e-19   
ref|XP_010765827.1|  PREDICTED: cathepsin W                           94.4    3e-19   
ref|XP_005903598.1|  PREDICTED: cathepsin F isoform X1                94.0    3e-19   
ref|XP_006210811.1|  PREDICTED: cathepsin F                           92.8    4e-19   
ref|XP_008280429.1|  PREDICTED: cathepsin W isoform X1                94.0    4e-19   
ref|XP_004368288.1|  cysteine proteinase precursor, putative          92.4    4e-19   
ref|XP_004463677.1|  PREDICTED: cathepsin F                           91.7    5e-19   
ref|XP_004596891.1|  PREDICTED: cathepsin F                           93.2    5e-19   
ref|XP_005699987.1|  PREDICTED: cathepsin F isoform X2                92.0    5e-19   
emb|CCD14094.1|  unnamed protein product                              91.7    6e-19   
ref|XP_007171073.1|  PREDICTED: cathepsin F isoform X1                91.7    6e-19   
ref|XP_011367226.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      93.2    7e-19   
ref|XP_005699986.1|  PREDICTED: cathepsin F isoform X1                91.7    7e-19   
ref|XP_004618609.1|  PREDICTED: cathepsin F                           91.7    7e-19   
ref|XP_008577225.1|  PREDICTED: cathepsin F                           93.6    7e-19   
gb|AAB41119.1|  cruzipain                                             92.8    8e-19   
gb|ELK13294.1|  Cathepsin F                                           92.8    8e-19   
pdb|4PI4|A  Chain A, Crystal Structure Analysis Of Cruzain Bound ...  91.3    9e-19   
emb|CBK21708.2|  unnamed protein product                              91.3    9e-19   
ref|XP_007092117.1|  PREDICTED: cathepsin F                           92.0    9e-19   
ref|XP_005968922.1|  PREDICTED: cathepsin F                           92.0    9e-19   
ref|XP_803044.1|  cysteine peptidase                                  92.4    1e-18   
ref|XP_004393930.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      92.8    1e-18   
ref|XP_010954979.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      92.8    1e-18   
ref|XP_005654721.1|  PREDICTED: cathepsin F-like isoform X2           92.4    1e-18   
gb|AAP06190.1|  similar to GenBank Accession Number U07345 prepro...  91.3    1e-18   
gb|AFA34855.1|  cathepsin L-like protein                              92.4    1e-18   
ref|XP_006911111.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      92.4    1e-18   
gb|ABQ23965.1|  cathepsin F                                           90.1    1e-18   
ref|XP_005631485.1|  PREDICTED: cathepsin F isoform X1                92.0    1e-18   
emb|CCD15012.1|  unnamed protein product                              91.3    1e-18   
ref|XP_003122543.2|  PREDICTED: cathepsin F isoform X1                92.4    1e-18   
gb|AAA79287.1|  rangelipain                                           90.1    1e-18   
emb|CAG46481.1|  CTSF                                                 90.9    1e-18   
emb|CCD14279.1|  unnamed protein product                              90.9    1e-18   
gb|AAC78838.1|  cathepsin F                                           90.5    1e-18   
emb|CBH11597.1|  cysteine peptidase precursor, (fragment)             89.4    1e-18   
emb|CCD11725.1|  unnamed protein product                              90.9    1e-18   
pir||T46294  hypothetical protein DKFZp434F0610.1 - human (fragment)  90.5    1e-18
ref|XP_004019753.1|  PREDICTED: cathepsin F isoform 1                 92.0    2e-18   
gb|AIC36736.1|  cathepsin F                                           92.0    2e-18   
ref|XP_533219.4|  PREDICTED: cathepsin F isoform X2                   92.0    2e-18   
ref|XP_004019754.1|  PREDICTED: cathepsin F isoform 2                 92.0    2e-18   
ref|XP_002755611.1|  PREDICTED: cathepsin F                           92.0    2e-18   
ref|XP_007445075.1|  PREDICTED: cathepsin F-like                      90.1    2e-18   
gb|AAC78839.1|  cathepsin F                                           90.1    2e-18   
gb|AAM44058.1|AF510740_1  cathepsin L1                                90.1    2e-18   
emb|CBH11594.1|  cysteine peptidase precursor, (fragment)             89.4    2e-18   
gb|AAF75546.1|  cruzipain                                             91.7    2e-18   
gb|AFA34856.1|  cathepsin L-like protein                              91.7    2e-18   
ref|XP_820174.1|  cysteine peptidase                                  91.7    2e-18   
ref|XP_005598385.1|  PREDICTED: cathepsin F                           90.9    2e-18   
emb|CDW82799.1|  cathepsin l                                          90.1    2e-18   
ref|XP_008707386.1|  PREDICTED: cathepsin F                           90.5    2e-18   
gb|EAW74547.1|  cathepsin F, isoform CRA_a                            90.5    2e-18   
ref|XP_004656783.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      91.7    2e-18   
emb|CCD17026.1|  unnamed protein product                              91.3    3e-18   
emb|CDQ79130.1|  unnamed protein product                              91.3    3e-18   
emb|CCD11596.1|  unnamed protein product                              90.9    3e-18   
gb|AAG35358.1|AF314930_1  cruzipain                                   91.3    3e-18   
sp|P25779.1|CYSP_TRYCR  RecName: Full=Cruzipain; AltName: Full=Cr...  91.3    3e-18   
ref|XP_010346669.1|  PREDICTED: cathepsin F isoform X2                89.7    3e-18   
ref|XP_818579.1|  cruzipain precursor                                 90.9    3e-18   
emb|CCD15016.1|  unnamed protein product                              89.7    3e-18   
gb|AAG35357.1|AF314929_1  cruzipain                                   90.9    3e-18   
ref|XP_006893341.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      91.3    3e-18   
gb|AFA34857.1|  cathepsin L-like protein                              90.9    3e-18   
ref|XP_818578.1|  cysteine peptidase                                  90.9    4e-18   
ref|XP_805951.1|  cysteine peptidase                                  90.5    4e-18   
emb|CCD12886.1|  unnamed protein product                              89.7    4e-18   
ref|XP_008952375.1|  PREDICTED: cathepsin F                           89.7    4e-18   
ref|XP_821954.1|  cysteine peptidase                                  89.4    4e-18   
ref|XP_004695908.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      90.9    4e-18   
gb|AAW25775.1|  SJCHGC00511 protein                                   90.5    4e-18   
ref|XP_004278023.1|  PREDICTED: cathepsin F isoform 2                 90.9    4e-18   
emb|CCD11901.1|  unnamed protein product                              89.4    4e-18   
gb|AAD24589.1|AF139913_1  cysteine protease                           90.5    4e-18   
gb|AAL96762.1|AC104496_8  Tcc1l8.8                                    90.9    5e-18   
ref|XP_004317592.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      90.9    5e-18   
gb|AAY81943.1|  cysteine protease 5                                   89.0    5e-18   
ref|XP_007115106.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      90.9    5e-18   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  92.0    5e-18   
ref|XP_003937801.1|  PREDICTED: cathepsin F isoform X1                89.4    5e-18   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      90.1    5e-18   
ref|XP_007972284.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      90.9    5e-18   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  91.3    6e-18   
ref|XP_001781010.1|  predicted protein                                90.1    6e-18   
ref|XP_004278022.1|  PREDICTED: cathepsin F isoform 1                 90.5    6e-18   
ref|XP_008531628.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      90.5    6e-18   
gb|EHH56046.1|  Cathepsin F                                           89.4    6e-18   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     91.7    7e-18   
gb|ESL05803.1|  cysteine peptidase B                                  90.1    7e-18   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      90.1    7e-18   
gb|ESL05789.1|  cysteine peptidase B                                  90.1    7e-18   
gb|AGN32942.1|  cysteine peptidase                                    90.1    7e-18   
gb|AAF13146.1|AF136279_1  cathepsin F precursor                       90.1    7e-18   
gb|ESL06275.1|  cysteine peptidase B                                  90.1    8e-18   
gb|AGN32955.1|  cysteine peptidase                                    90.1    8e-18   
gb|AAV38405.1|  cathepsin F                                           90.1    8e-18   
ref|NP_003784.2|  cathepsin F precursor                               90.1    8e-18   
gb|ESL11420.1|  cysteine peptidase B                                  90.1    8e-18   
ref|XP_008048262.1|  PREDICTED: cathepsin F                           89.4    8e-18   
ref|XP_011478802.1|  PREDICTED: cathepsin F isoform X1                90.1    9e-18   
ref|XP_004073613.1|  PREDICTED: cathepsin F isoform X2                89.7    9e-18   
emb|CAX69889.1|  Temporarily Assigned Gene name                       89.7    1e-17   
ref|XP_008271777.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      89.7    1e-17   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  90.9    1e-17   
prf||2117247B  Cys protease:ISOTYPE=2                                 89.7    1e-17
ref|XP_004051670.1|  PREDICTED: cathepsin F                           90.1    1e-17   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  90.9    1e-17   
ref|XP_009421804.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      89.7    1e-17   
gb|AAA79289.1|  rangelipain                                           87.4    1e-17   
gb|ELK24293.1|  Cathepsin F                                           88.6    1e-17   
emb|CCD77197.1|  cathepsin F (C01 family)                             89.0    1e-17   
gb|EHH22649.1|  Cathepsin F                                           89.4    1e-17   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  90.1    1e-17   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  90.1    2e-17   
sp|Q26534.1|CATL_SCHMA  RecName: Full=Cathepsin L; AltName: Full=...  87.4    2e-17   
gb|AAF75547.1|  cruzipain                                             89.0    2e-17   
ref|XP_011233805.1|  PREDICTED: cathepsin F                           90.1    2e-17   
gb|AAR09988.1|  similar to Drosophila melanogaster CG12163            86.7    2e-17   
ref|XP_003777749.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      89.0    2e-17   
ref|XP_009183845.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      89.0    2e-17   
emb|CCD77198.1|  cathepsin F (C01 family)                             89.0    2e-17   



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/164 (100%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  207
            MDRFSLLSLLILALTAACVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT
Sbjct  1    MDRFSLLSLLILALTAACVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  60

Query  208  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrkl  387
            QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFLGIRKSSSGKRKL
Sbjct  61   QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFLGIRKSSSGKRKL  120

Query  388  klPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            KLPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF
Sbjct  121  KLPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  164



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  207
            MDRFSL SLLI ALTAACVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT
Sbjct  1    MDRFSLPSLLIHALTAACVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  60

Query  208  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgi--rksssgkr  381
            QEEHDYRLSVFKANLRRAKRHQ+LDPSAVHGVTKFSDLTPKEFRRT+LGI    SS  K 
Sbjct  61   QEEHDYRLSVFKANLRRAKRHQMLDPSAVHGVTKFSDLTPKEFRRTYLGIRKSSSSKQKL  120

Query  382  klklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            KLKLPADAHAAEILPTSDLP DF+WRDYGAVTGVKDQG CGSCWSF
Sbjct  121  KLKLPADAHAAEILPTSDLPFDFEWRDYGAVTGVKDQGLCGSCWSF  166



>gb|KJB29613.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=207

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 123/150 (82%), Gaps = 12/150 (8%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDG-----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            V +D DPLIRQVVSDG      DD LLNA+HHFTLFKSKYGK+YA+QEEHDYRL VFKAN
Sbjct  23   VNSDGDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKSKYGKTYASQEEHDYRLGVFKAN  82

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            LRRAKRHQLLDPSAVHGVTKFSDLTP EFRR +        G + LKLPADA  A ILPT
Sbjct  83   LRRAKRHQLLDPSAVHGVTKFSDLTPSEFRRQY-------LGLKPLKLPADAQKAPILPT  135

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
             +LP DFDWRD+GAVTGVKDQGSCGSCWSF
Sbjct  136  DNLPDDFDWRDHGAVTGVKDQGSCGSCWSF  165



>gb|KJB29612.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=301

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 123/150 (82%), Gaps = 12/150 (8%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDG-----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            V +D DPLIRQVVSDG      DD LLNA+HHFTLFKSKYGK+YA+QEEHDYRL VFKAN
Sbjct  23   VNSDGDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKSKYGKTYASQEEHDYRLGVFKAN  82

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            LRRAKRHQLLDPSAVHGVTKFSDLTP EFRR +        G + LKLPADA  A ILPT
Sbjct  83   LRRAKRHQLLDPSAVHGVTKFSDLTPSEFRRQY-------LGLKPLKLPADAQKAPILPT  135

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
             +LP DFDWRD+GAVTGVKDQGSCGSCWSF
Sbjct  136  DNLPDDFDWRDHGAVTGVKDQGSCGSCWSF  165



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 11/146 (8%)
 Frame = +1

Query  94   DEDPLIRQVVSDG----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            ++DPLIRQVVS+G     DD LLNA+HHFTLFKSKYGK+YATQEEHDYRL VFKANLRRA
Sbjct  58   EDDPLIRQVVSNGAGEDSDDHLLNAEHHFTLFKSKYGKTYATQEEHDYRLGVFKANLRRA  117

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
            KRHQLLDP+AVHGVTKFSDLTP EFRR F        G R LKLPADA  A ILPT+DLP
Sbjct  118  KRHQLLDPTAVHGVTKFSDLTPSEFRRQF-------LGLRPLKLPADAQKAPILPTNDLP  170

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
            +DFDWRD+GAVTGVKDQGSCGSCWSF
Sbjct  171  TDFDWRDHGAVTGVKDQGSCGSCWSF  196



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 123/150 (82%), Gaps = 12/150 (8%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDG-----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            V +D DPLIRQVVSDG      DD LLNA+HHFTLFKSKYGK+YA+QEEHDYRL VFKAN
Sbjct  23   VNSDGDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKSKYGKTYASQEEHDYRLGVFKAN  82

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            LRRAKRHQLLDPSAVHGVTKFSDLTP EFRR +        G + LKLPADA  A ILPT
Sbjct  83   LRRAKRHQLLDPSAVHGVTKFSDLTPSEFRRQY-------LGLKPLKLPADAQKAPILPT  135

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
             +LP DFDWRD+GAVTGVKDQGSCGSCWSF
Sbjct  136  DNLPDDFDWRDHGAVTGVKDQGSCGSCWSF  165



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 123/150 (82%), Gaps = 12/150 (8%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDG-----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            V +D+DPLIRQVVSDG      DD LLNA+HHFTLFKSKYGK+YA+QEEHDYRL VFKAN
Sbjct  23   VNSDDDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKSKYGKTYASQEEHDYRLGVFKAN  82

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            LRRAKRHQ+LDPSAVHGVTKFSDLTP EFRR +        G + LKLPADA  A ILPT
Sbjct  83   LRRAKRHQVLDPSAVHGVTKFSDLTPSEFRRQY-------LGLKPLKLPADAQKAPILPT  135

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
             +LP DFDWRD+ AVTGVKDQGSCGSCWSF
Sbjct  136  DNLPDDFDWRDHDAVTGVKDQGSCGSCWSF  165



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 122/141 (87%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +DPLIRQVVSDGEDD LLNA+HHFT FKSK+GK+YATQEEHDYR  VFKANLRRAK+HQ+
Sbjct  29   DDPLIRQVVSDGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQM  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DP+A HGVTKFSDLTPKEFRR F         KR+L+LP DA+ A ILPT+DLP+DFDW
Sbjct  88   IDPTAAHGVTKFSDLTPKEFRRQF------LGLKRRLQLPTDANKAPILPTTDLPTDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VKDQGSCGSCWSF
Sbjct  142  RDHGAVTEVKDQGSCGSCWSF  162



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 122/143 (85%), Gaps = 7/143 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGED--DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            +DPLIRQVVSDG D  D LL+ADHHF+LFK+KYGKSYATQEEHDYR SVFKANLRR+KRH
Sbjct  31   DDPLIRQVVSDGADAVDQLLHADHHFSLFKTKYGKSYATQEEHDYRFSVFKANLRRSKRH  90

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q+LDPSAVHGVTKFSDLTP+EF +++         ++KLKLP D + A +LPT DLP+DF
Sbjct  91   QILDPSAVHGVTKFSDLTPEEFEKSY-----LGLRQKKLKLPVDENKAAVLPTEDLPTDF  145

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVT VKDQGSCGSCWSF
Sbjct  146  DWRDHGAVTAVKDQGSCGSCWSF  168



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +DPLIRQVVSDGEDD LLNA+HHFT FKSK+GK+YATQEEHDYR  VFKANLRRAK+HQ+
Sbjct  29   DDPLIRQVVSDGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQM  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DP+A HG+TKFSDLTPKEFRR F         KR L+LP DA+ A ILPT+DLP+D+DW
Sbjct  88   IDPTAAHGITKFSDLTPKEFRRQF------LGLKRWLRLPTDANKAPILPTTDLPTDYDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VKDQGSCGSCWSF
Sbjct  142  RDHGAVTEVKDQGSCGSCWSF  162



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 5/143 (3%)
 Frame = +1

Query  97   EDPLIRQVV-SDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            +DPLIRQVV SDG+D D LLNADHHF+LFK+KYGK+Y+TQEEHD+R SVFKANLRRAKRH
Sbjct  35   DDPLIRQVVTSDGDDADPLLNADHHFSLFKTKYGKTYSTQEEHDHRFSVFKANLRRAKRH  94

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            QLLDPSAVHGVTKFSDLTP EFRR        +  KR+L+LPADA+ A ILPT+DLP+DF
Sbjct  95   QLLDPSAVHGVTKFSDLTPSEFRRNH---LGLNKHKRRLRLPADANKAPILPTTDLPADF  151

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVT VKDQGSCGSCWSF
Sbjct  152  DWRDHGAVTPVKDQGSCGSCWSF  174



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +DPLI QVVSDGEDD LLNA+HHFT FKSK+GK+YATQEEHDYR  VFKANLRRAK+HQ+
Sbjct  29   DDPLIIQVVSDGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQM  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DP+A HGVTKFSDLTPKEFRR F         KR+L+LP DA+ A ILPT+DLP+D+DW
Sbjct  88   IDPTAAHGVTKFSDLTPKEFRRQF------LGLKRRLRLPTDANKAPILPTTDLPTDYDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VKDQGSCGSCWSF
Sbjct  142  RDHGAVTEVKDQGSCGSCWSF  162



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +DPLI QVVSDGEDD LLNA+HHFT FKSK+GK+YATQEEHDYR  VFKANLRRAK+HQ+
Sbjct  29   DDPLIIQVVSDGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQM  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DP+A HGVTKFSDLTPKEFRR F         KR+L+LP DA+ A ILPT+DLP+D+DW
Sbjct  88   IDPTAAHGVTKFSDLTPKEFRRQF------LGLKRRLRLPTDANKAPILPTTDLPTDYDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VKDQGSCGSCWSF
Sbjct  142  RDHGAVTEVKDQGSCGSCWSF  162



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 121/150 (81%), Gaps = 12/150 (8%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDG---ED--DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            V +++ PLIRQV SDG   ED  D LLNA+HHFTLFKSK+GK+YAT+EEHDYRL VFKAN
Sbjct  23   VISNDGPLIRQVASDGVAEEDFVDQLLNAEHHFTLFKSKFGKTYATKEEHDYRLGVFKAN  82

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            +RRAKRHQLLDP+A HGVTKFSDLTP EFRR F        G + LKLPADA  A ILPT
Sbjct  83   MRRAKRHQLLDPTAFHGVTKFSDLTPSEFRRQF-------LGLKPLKLPADAQKAPILPT  135

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
             DLP DFDWRD GAVTGVKDQGSCGSCWSF
Sbjct  136  DDLPDDFDWRDQGAVTGVKDQGSCGSCWSF  165



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   209 bits (533),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +DPLIRQVV DG+ D LLNA+HHFT FK+K+GK+YATQEEHDYR  +FKANLRRA++HQ+
Sbjct  29   DDPLIRQVVPDGDQDHLLNAEHHFTTFKAKFGKTYATQEEHDYRFKLFKANLRRARKHQM  88

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DP+AVHGVT FSDLTP+EFRR +        G R+L+LPADAH A ILPT+DLP+DFDW
Sbjct  89   MDPTAVHGVTMFSDLTPREFRRQY-------LGLRRLRLPADAHEAPILPTNDLPTDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QGSCGSCWSF
Sbjct  142  RDHGAVTNVKNQGSCGSCWSF  162



>gb|KDO84721.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=300

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 9/145 (6%)
 Frame = +1

Query  94   DEDPLIRQVV-SDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            D+D +IRQVV SDGE  +D LLNA+HHF+LFKSK+ K+YATQEEHDYR  VFKANLRRAK
Sbjct  26   DDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAK  85

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            R QLLDP+AVHGVTKFSDLTP EFRR F          R+L+LPADA  A ILPT+DLP+
Sbjct  86   RRQLLDPTAVHGVTKFSDLTPSEFRRQF------LGLNRRLRLPADAQKAPILPTNDLPT  139

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD+GAVTGVKDQG+CGSCWSF
Sbjct  140  DFDWRDHGAVTGVKDQGACGSCWSF  164



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   206 bits (525),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 9/145 (6%)
 Frame = +1

Query  94   DEDPLIRQVV-SDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            D+D +IRQVV SDGE  +D LLNA+HHF+LFKSK+ K+YATQEEHDYR  VFKANLRRAK
Sbjct  26   DDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAK  85

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            R QLLDP+AVHGVTKFSDLTP EFRR F          R+L+LPADA  A ILPT+DLP+
Sbjct  86   RRQLLDPTAVHGVTKFSDLTPSEFRRQF------LGLNRRLRLPADAQKAPILPTNDLPT  139

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD+GAVTGVKDQG+CGSCWSF
Sbjct  140  DFDWRDHGAVTGVKDQGACGSCWSF  164



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   206 bits (525),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 9/145 (6%)
 Frame = +1

Query  94   DEDPLIRQVV-SDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            D+D +IRQVV SDGE  +D LLNA+HHF+LFKSK+ K+YATQEEHDYR  VFKANLRRAK
Sbjct  26   DDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAK  85

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            R QLLDP+AVHGVTKFSDLTP EFRR F          R+L+LPADA  A ILPT+DLP+
Sbjct  86   RRQLLDPTAVHGVTKFSDLTPSEFRRQF------LGLNRRLRLPADAQKAPILPTNDLPT  139

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD+GAVTGVKDQG+CGSCWSF
Sbjct  140  DFDWRDHGAVTGVKDQGACGSCWSF  164



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 131/164 (80%), Gaps = 7/164 (4%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  207
            M+R  LLSLL   L ++ +  +DEDPLIRQVVS+ +D  LLNA+HHF+LFKSK+GK YA+
Sbjct  1    MERLFLLSLLAFVLFSSAIAFSDEDPLIRQVVSETDDSHLLNAEHHFSLFKSKFGKIYAS  60

Query  208  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrkl  387
            +EEHD+R  VFKANLRRA+RHQLLDPSA HG+TKFSDLTP EFRRT+LG+ K        
Sbjct  61   EEEHDHRFKVFKANLRRARRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPKL---  117

Query  388  klPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                +A  A ILPTSDLP+DFDWRD+GAVTGVK+QGSCGSCWSF
Sbjct  118  ----NAEKAPILPTSDLPADFDWRDHGAVTGVKNQGSCGSCWSF  157



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 8/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDPLIRQVV +  D  LLNA+HHFT FKSK+GK+YATQEEHD+R  VFKANLRRA++HQ+
Sbjct  29   EDPLIRQVVPEAVDH-LLNAEHHFTTFKSKFGKNYATQEEHDHRFKVFKANLRRARKHQM  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSAVHGVTKFSDLTP+EFRR +        G ++L+LPADAH A ILPT+DLPSDFDW
Sbjct  88   MDPSAVHGVTKFSDLTPREFRRQY-------LGLKRLRLPADAHEAPILPTNDLPSDFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VKDQG+CGSCWSF
Sbjct  141  RDKGAVTNVKDQGACGSCWSF  161



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   204 bits (519),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 120/144 (83%), Gaps = 9/144 (6%)
 Frame = +1

Query  97   EDPLIRQVV-SDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
            +D +IRQVV SDGE  +D LLNA+HHF+LFKSK+ K+YATQEEHDYR  VFKANLRRAKR
Sbjct  27   DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKR  86

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
             QLLDP+AVHGVTKFSDLTP EFRR F          R+L+LPADA  A ILPT+DLP+D
Sbjct  87   RQLLDPTAVHGVTKFSDLTPSEFRRQF------LGLNRRLRLPADAQKAPILPTNDLPTD  140

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWRD+GAVTGVKDQG+CGSCWSF
Sbjct  141  FDWRDHGAVTGVKDQGACGSCWSF  164



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 7/164 (4%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  207
            MDR  LLSLL  AL ++ +  +D+DPLIRQVVS+ +D+ +LNA+HHF+LFKSKYGK YA+
Sbjct  1    MDRLFLLSLLAFALFSSAIAFSDDDPLIRQVVSETDDNHMLNAEHHFSLFKSKYGKIYAS  60

Query  208  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrkl  387
            QEEHD+RL VFKANLRRA+RHQLLDP+A HG+T+FSDLTP EFRRT+LG+ K        
Sbjct  61   QEEHDHRLKVFKANLRRARRHQLLDPTAEHGITQFSDLTPSEFRRTYLGLHKPRPKL---  117

Query  388  klPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                +A  A ILPTSDLP DFDWR+ GAVTGVK+QGSCGSCWSF
Sbjct  118  ----NAQKAPILPTSDLPEDFDWREKGAVTGVKNQGSCGSCWSF  157



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 130/164 (79%), Gaps = 7/164 (4%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  207
            M+R  LLSLL   L ++ +  +DEDPLIRQVVS+ +D  LLNA+HHF+LFKSK+GK YA+
Sbjct  1    MERLFLLSLLAFVLFSSAIAFSDEDPLIRQVVSETDDSHLLNAEHHFSLFKSKFGKIYAS  60

Query  208  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrkl  387
            +EEHD+R  VFKAN RRA+RHQLLDPSA HG+TKFSDLTP EFRRT+LG+ K        
Sbjct  61   EEEHDHRFKVFKANRRRARRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPKL---  117

Query  388  klPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                +A  A ILPTSDLP+DFDWRD+GAVTGVK+QGSCGSCWSF
Sbjct  118  ----NAEKAPILPTSDLPADFDWRDHGAVTGVKNQGSCGSCWSF  157



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 8/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            ED LIRQVV+  +DD L+NA+HHFT FKSK+GKSYAT+EEH YRL VFKANLRRA+RHQ 
Sbjct  32   EDLLIRQVVAH-DDDLLMNAEHHFTNFKSKFGKSYATREEHAYRLGVFKANLRRARRHQK  90

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSAVHG+T+FSDLTP EFRRT+        G ++L++PADAH A ILPT+DLP+DFDW
Sbjct  91   LDPSAVHGITQFSDLTPAEFRRTY-------LGLKRLRIPADAHKAPILPTNDLPTDFDW  143

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QGSCGSCWSF
Sbjct  144  RDHGAVTAVKNQGSCGSCWSF  164



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 119/145 (82%), Gaps = 6/145 (4%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V  D DPLI+QVVS+ +DD LL+A+ HF+ FK+ +GK+YATQEEHDYR  VFKANLRRAK
Sbjct  23   VPNDVDPLIQQVVSESDDDQLLHAERHFSSFKATFGKTYATQEEHDYRFGVFKANLRRAK  82

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDP+AVHGVTKFSDLTPKEFRR F         KR+L+LPADA+ A ILPT DLP+
Sbjct  83   RHQALDPTAVHGVTKFSDLTPKEFRRNF------LGLKRRLRLPADANKAPILPTGDLPA  136

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD GAVT VKDQGSCGSCW+F
Sbjct  137  DFDWRDKGAVTPVKDQGSCGSCWAF  161



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 6/145 (4%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V  D DPLI+QVVS+ +DD LL+A+ HF+ FK+ +GK+YATQEE+DYR  VFKANLRRAK
Sbjct  24   VPIDVDPLIQQVVSESDDDQLLHAERHFSSFKATFGKAYATQEEYDYRFGVFKANLRRAK  83

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDP+AVHGVTKFSDLTPKEFRR F         KR+L+LPADA+ A ILPTSDLP+
Sbjct  84   RHQALDPTAVHGVTKFSDLTPKEFRRNF------LGLKRRLRLPADANKAPILPTSDLPA  137

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD GAVT VKDQGSCGSCW+F
Sbjct  138  DFDWRDKGAVTPVKDQGSCGSCWAF  162



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 116/141 (82%), Gaps = 8/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDPLIRQVVSD +DD LLNA+HHF  FK K+GKSYAT EEH YRL VFKANLRRA+RHQ 
Sbjct  33   EDPLIRQVVSD-DDDLLLNAEHHFNNFKRKFGKSYATPEEHAYRLGVFKANLRRARRHQK  91

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSAVHGVT+FSDLTP EFRR++        G + LKLP DAH A ILPT+DLP+DFDW
Sbjct  92   LDPSAVHGVTQFSDLTPAEFRRSY-------LGLKPLKLPVDAHNAPILPTNDLPTDFDW  144

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GA+  VK+QGSCGSCWSF
Sbjct  145  RDHGAIAAVKNQGSCGSCWSF  165



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 117/141 (83%), Gaps = 6/141 (4%)
 Frame = +1

Query  100  DPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            DPLIRQVV   E+ D LLNADHHF+LFKSKYGKSYATQEEHD R SVFKANLRRAK+ QL
Sbjct  1    DPLIRQVVDGVEEIDLLLNADHHFSLFKSKYGKSYATQEEHDRRFSVFKANLRRAKKRQL  60

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSAVHG+TKFSDLTP EF++TF          +++KLP+DA+ A +LPT+DLP +FDW
Sbjct  61   LDPSAVHGITKFSDLTPAEFKKTF-----LGLHTKRVKLPSDANKAPVLPTNDLPENFDW  115

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VKDQGSCGSCW+F
Sbjct  116  REKGAVTAVKDQGSCGSCWTF  136



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +DPLIRQVVS+GED  LLNA+HHFT FKSK+GK+YATQEEHDYR SVFKANL RAK+HQ+
Sbjct  29   DDPLIRQVVSEGEDH-LLNAEHHFTTFKSKFGKNYATQEEHDYRFSVFKANLLRAKKHQI  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DP+A HGVTKFSDLTPKEFRR           KR+L+LP DA+ A ILPT DLP+DFDW
Sbjct  88   MDPTAAHGVTKFSDLTPKEFRRQ------LLGLKRRLRLPTDANKAPILPTGDLPTDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VKDQGSCGSCWSF
Sbjct  142  RDHGAVTSVKDQGSCGSCWSF  162



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 132/166 (80%), Gaps = 9/166 (5%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSY  201
            MDR  LLSLL  AL ++ V  +DEDPLIRQVVS+ E  D  LLNA+HHF+LFKSK+GK Y
Sbjct  1    MDRLFLLSLLAFALFSSAVAFSDEDPLIRQVVSETETDDSHLLNAEHHFSLFKSKFGKIY  60

Query  202  ATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkr  381
            A++EEHD+R  VFKANLRRA+RHQLLDPSA HG+TKFSDLTP EFRRT+LG+ K      
Sbjct  61   ASEEEHDHRFKVFKANLRRARRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPKL-  119

Query  382  klklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                  +A  A ILPTSDLP+D+DWRD+GAVTGVK+QGSCGSCWSF
Sbjct  120  ------NAEKAPILPTSDLPADYDWRDHGAVTGVKNQGSCGSCWSF  159



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 118/141 (84%), Gaps = 6/141 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            ++P+IRQVV +  D+ LLNA+HHF+LFKSKY K+YATQ EHD+R  VFKANLRRA+RHQL
Sbjct  28   DNPIIRQVVPEENDEQLLNAEHHFSLFKSKYDKTYATQAEHDHRFRVFKANLRRARRHQL  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSAVHGVT+FSDLTPKEFRR +         KRKL+LP+DA  A ILPTSDLP+DFDW
Sbjct  88   LDPSAVHGVTQFSDLTPKEFRRKY------LGLKRKLRLPSDAQKAPILPTSDLPTDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QGSCGSCWSF
Sbjct  142  RDQGAVTRVKNQGSCGSCWSF  162



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   201 bits (512),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 132/166 (80%), Gaps = 9/166 (5%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSY  201
            MDR  LLSLL  AL ++ +  +DEDPLIRQVVS+ E  D  LLNA+HHF+LFKSK+GK Y
Sbjct  1    MDRLFLLSLLAFALFSSAIAFSDEDPLIRQVVSETETDDSHLLNAEHHFSLFKSKFGKIY  60

Query  202  ATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkr  381
            A++EEHD+R  VFKANLRRA+RHQLLDPSA HG+TKFSDLTP EFRRT+LG+ K      
Sbjct  61   ASEEEHDHRFKVFKANLRRARRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPKL-  119

Query  382  klklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                  +A  A ILPTSDLP+D+DWRD+GAVTGVK+QGSCGSCWSF
Sbjct  120  ------NAEKAPILPTSDLPADYDWRDHGAVTGVKNQGSCGSCWSF  159



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (83%), Gaps = 8/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +DPLIRQVV D ED  LL+A HHFT FK+K+GK+YATQEEHDYR  VFKANLRRA++HQL
Sbjct  29   DDPLIRQVVPDVED-YLLSAQHHFTAFKAKFGKNYATQEEHDYRFKVFKANLRRAQKHQL  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSAVHGVTKFSDLTP+EFRR +        G +KL+LPADAH A ILPT  +P DFDW
Sbjct  88   MDPSAVHGVTKFSDLTPREFRRQY-------LGLKKLRLPADAHEAPILPTDGIPEDFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QGSCGSCWSF
Sbjct  141  RDHGAVTNVKNQGSCGSCWSF  161



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (83%), Gaps = 6/141 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            ++P+IRQVV +  D+ LLNA+HHF+LFKSKY K+YATQ EHD+R  VFKANLRRA+RHQL
Sbjct  28   DNPIIRQVVPEENDEQLLNAEHHFSLFKSKYQKTYATQAEHDHRFRVFKANLRRARRHQL  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSAVHGVT+FSDLTPKEFRR +         KRKL+LP DA  A ILPTSDLP+DFDW
Sbjct  88   LDPSAVHGVTQFSDLTPKEFRRKY------LGLKRKLRLPNDAQKAPILPTSDLPTDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QGSCGSCWSF
Sbjct  142  RDKGAVTPVKNQGSCGSCWSF  162



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 121/151 (80%), Gaps = 12/151 (8%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGE------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
            V  ++D LIRQVV  G+      +++L+NADHHFT+FK K+GK YATQEEHDYR SVFKA
Sbjct  30   VAGNDDLLIRQVVDHGDGGGAVDENSLVNADHHFTIFKRKFGKVYATQEEHDYRFSVFKA  89

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            NLRRA+RHQ LDP+AVHGVT+FSDLTP+EFRR F          R+L+LP+DAH A ILP
Sbjct  90   NLRRARRHQKLDPAAVHGVTQFSDLTPREFRRQF------LGLNRRLRLPSDAHKAPILP  143

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            T+DLP DFDWRD+GAVT VK+QGSCGSCWSF
Sbjct  144  TNDLPMDFDWRDHGAVTPVKNQGSCGSCWSF  174



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 130/164 (79%), Gaps = 7/164 (4%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  207
            M+R  LLSLL   L ++ +  +DEDPLIRQVVS+ +D  LLNA+HHF+LFKSK+GK YA+
Sbjct  1    MERLFLLSLLAFVLFSSAIAFSDEDPLIRQVVSETDDSHLLNAEHHFSLFKSKFGKIYAS  60

Query  208  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrkl  387
            +EEHD+R  VFKANLRRA+ +QLLDPSA HG+TKFSDLTP EFRRT+LG+ K        
Sbjct  61   EEEHDHRFKVFKANLRRARLNQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPKL---  117

Query  388  klPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                +A  A ILPTSDLP+DFDWRD+GAVTGVK+QGSCGSCWSF
Sbjct  118  ----NAEKAPILPTSDLPADFDWRDHGAVTGVKNQGSCGSCWSF  157



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 117/145 (81%), Gaps = 9/145 (6%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDA--LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +DEDPLIRQV S+ +D+   LLNA+HHF+LFKSK+GK YATQEEHD+RL VFKANLRRA+
Sbjct  23   SDEDPLIRQVTSESDDNNNHLLNAEHHFSLFKSKFGKIYATQEEHDHRLKVFKANLRRAR  82

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQLLDP+A HG+TKFSDLTP EFRRT+LG+ K        K P       ILPTSDLP 
Sbjct  83   RHQLLDPTAEHGITKFSDLTPSEFRRTYLGLHKPKPKLSTTKAP-------ILPTSDLPE  135

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWR+ GAVTGVK+QGSCGSCWSF
Sbjct  136  DFDWREKGAVTGVKNQGSCGSCWSF  160



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 133/165 (81%), Gaps = 7/165 (4%)
 Frame = +1

Query  25   PMDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYA  204
            PMDR  LLSLL LAL ++ +  +D+DPLIRQVVS+ +D+ +LNA+HHF+LFK K+GK YA
Sbjct  13   PMDRLFLLSLLALALFSSAIAFSDDDPLIRQVVSENDDNHMLNAEHHFSLFKVKFGKIYA  72

Query  205  TQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrk  384
            +QEEHD+RL VFKANLRRA+RHQLLDPSA HG+T+FSDLTP EFRRT+LG+ K       
Sbjct  73   SQEEHDHRLKVFKANLRRARRHQLLDPSAEHGITQFSDLTPSEFRRTYLGLNKPRPNL--  130

Query  385  lklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                 +A  A ILPT+DLP+DFDWR+ GAVT VK+QGSCGSCWSF
Sbjct  131  -----NAEKAPILPTTDLPADFDWREKGAVTDVKNQGSCGSCWSF  170



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV DG+ D LLNADHHFT+FK ++GK+YA+ EEHDYRLSVFKAN+RRAKRHQ 
Sbjct  29   DDVLIRQVVGDGDGD-LLNADHHFTVFKRRFGKAYASDEEHDYRLSVFKANMRRAKRHQE  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHGVT+FSDLTP EFRR F          R+LK PADA  A ILPT +LPSDFDW
Sbjct  88   LDPAAVHGVTQFSDLTPTEFRRKF------LGLNRRLKFPADAKTAPILPTDELPSDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QG+CGSCWSF
Sbjct  142  RDHGAVTPVKNQGTCGSCWSF  162



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   199 bits (506),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV DG+ D LLNADHHFT+FK ++GK+YA+ EEHDYRLSVFKAN+RRAKRHQ 
Sbjct  29   DDILIRQVVGDGDGD-LLNADHHFTVFKRRFGKAYASDEEHDYRLSVFKANMRRAKRHQE  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHGVT+FSDLTP EFRR F          R+LK PADA  A ILPT +LPSDFDW
Sbjct  88   LDPAAVHGVTQFSDLTPTEFRRKF------LGLNRRLKFPADAKTAPILPTDELPSDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QG+CGSCWSF
Sbjct  142  RDHGAVTPVKNQGTCGSCWSF  162



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 7/148 (5%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGED--DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLR  255
            + +  +DPLIRQVVSD  +  D LL+A+HHF+LFK+KYGK+Y TQEEHDYR SVFK+NLR
Sbjct  25   IEQVSDDPLIRQVVSDSVEAVDQLLHAEHHFSLFKAKYGKTYDTQEEHDYRFSVFKSNLR  84

Query  256  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSD  435
            RAKR+QLLDPSAVHGVT+FSDLTP EF +++         KR+LKLP DAH A  LPT++
Sbjct  85   RAKRNQLLDPSAVHGVTRFSDLTPDEFEKSY-----LGLHKRRLKLPVDAHKAPDLPTNN  139

Query  436  LPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            LP+DFDWRD+GAVT VKDQGSCGSCWSF
Sbjct  140  LPTDFDWRDHGAVTAVKDQGSCGSCWSF  167



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 128/164 (78%), Gaps = 7/164 (4%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  207
            MDR  LLS L  AL ++ +  +D+DPLIRQVVS  +D+ +LNA+HHF+LFK+K+GK YA+
Sbjct  1    MDRLFLLSFLAFALFSSAIAFSDDDPLIRQVVSGNDDNHMLNAEHHFSLFKAKFGKIYAS  60

Query  208  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrkl  387
            QEEHD+RL VFKANL RAKRHQLLDPSA HG+T+FSDLTP EFRRT+LG+ K        
Sbjct  61   QEEHDHRLKVFKANLHRAKRHQLLDPSAEHGITQFSDLTPSEFRRTYLGLNKPRPNL---  117

Query  388  klPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                +A  A ILPT DLPSDFDWR+ GAVT VK+QGSCGSCWSF
Sbjct  118  ----NAEKAPILPTKDLPSDFDWREKGAVTDVKNQGSCGSCWSF  157



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 115/142 (81%), Gaps = 7/142 (5%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            D+D LIRQVV D +DD LLNADHHFT+FK ++GK+YA+ EEH YR SVFKANLRRA RHQ
Sbjct  32   DDDILIRQVVGD-DDDHLLNADHHFTIFKRRFGKTYASDEEHHYRFSVFKANLRRAMRHQ  90

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVT+FSDLTP EFRR F          R+L+LP+DA+ A ILPT DLPS FD
Sbjct  91   KLDPSAVHGVTQFSDLTPAEFRRNF------LGVNRRLRLPSDANKAPILPTEDLPSGFD  144

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD+GAVT VK+QGSCGSCWSF
Sbjct  145  WRDHGAVTSVKNQGSCGSCWSF  166



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 7/146 (5%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            +  +D+DPLIRQVVS  +D+ +LNA+HHF+LFK+K+GK YA+QEEHD+RL VFKANL RA
Sbjct  17   IAFSDDDPLIRQVVSGNDDNHMLNAEHHFSLFKAKFGKIYASQEEHDHRLKVFKANLHRA  76

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
            KRHQLLDPSA HG+T+FSDLTP EFRRT+LG+ K            +A  A ILPT DLP
Sbjct  77   KRHQLLDPSAEHGITQFSDLTPSEFRRTYLGLNKPRPNL-------NAEKAPILPTKDLP  129

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
            SDFDWR+ GAVT VK+QGSCGSCWSF
Sbjct  130  SDFDWREKGAVTDVKNQGSCGSCWSF  155



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 117/146 (80%), Gaps = 7/146 (5%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            V   D DPLI+QVV +  D+ LL+A+ HF+ FK+ +GK+YATQEEHDYR  VFKANLRRA
Sbjct  25   VTPNDADPLIQQVVPEANDNLLLHAERHFSSFKATFGKTYATQEEHDYRFGVFKANLRRA  84

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
            KRHQ LDP+AVHGVTKFSDLTP EFRR F        G ++L+LP+DA+ A ILPT+DLP
Sbjct  85   KRHQGLDPTAVHGVTKFSDLTPSEFRRNF-------LGLKRLRLPSDANKAPILPTNDLP  137

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
            +DFDWRD GAVT VKDQGSCGSCW+F
Sbjct  138  TDFDWRDKGAVTPVKDQGSCGSCWAF  163



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 114/141 (81%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV DG+ D LLNADHHF +FK ++GK+YA+ EEHDYRLSVFKAN+RRAKRHQ 
Sbjct  27   DDILIRQVVGDGDGD-LLNADHHFAVFKRRFGKAYASDEEHDYRLSVFKANMRRAKRHQQ  85

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHGVT+FSDLTP EFRR F          R+LK PADA  A ILPT +LPSDFDW
Sbjct  86   LDPAAVHGVTQFSDLTPTEFRRKF------LGLNRRLKFPADAKTAPILPTDELPSDFDW  139

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QG+CGSCWSF
Sbjct  140  RDRGAVTPVKNQGTCGSCWSF  160



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 9/166 (5%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSY  201
            MDR  LLSL   AL ++ +   DEDPLIRQVVS+ E  D  LLNA+HHF+LFKSK+GK Y
Sbjct  1    MDRLFLLSLPRFALFSSAIAFPDEDPLIRQVVSETETDDSHLLNAEHHFSLFKSKFGKIY  60

Query  202  ATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkr  381
            A++EEHD+R  VFKANLRRA+ +QLLDPSA HG+TKFSDLTP EFRRT+LG+ K      
Sbjct  61   ASEEEHDHRFKVFKANLRRARLNQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPK--  118

Query  382  klklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                  +A  A ILPTSDLP+D+DWRD+GAVTGVK+QGSCGSCWSF
Sbjct  119  -----VNAEKAPILPTSDLPADYDWRDHGAVTGVKNQGSCGSCWSF  159



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 114/141 (81%), Gaps = 8/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV DG D  LLNADHHFT+FK ++GK YA+ EEHDYRLSVFKAN+RRAK+HQ 
Sbjct  28   DDILIRQVVGDGGD--LLNADHHFTVFKRRFGKVYASDEEHDYRLSVFKANMRRAKQHQE  85

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHGVT+FSDLTP EFRR F          R+LK PADA  A ILPT +LPSDFDW
Sbjct  86   LDPAAVHGVTQFSDLTPTEFRRKF------LGLNRRLKFPADAKTAPILPTDELPSDFDW  139

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QG+CGSCWSF
Sbjct  140  RDHGAVTPVKNQGTCGSCWSF  160



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 115/142 (81%), Gaps = 7/142 (5%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ++D LIRQVV D ED  LLNA+HHF+ FK+K+GK+YATQEEHD+R  +FK NL RAK HQ
Sbjct  27   EDDLLIRQVVPDAEDHHLLNAEHHFSAFKTKFGKTYATQEEHDHRFRIFKNNLLRAKSHQ  86

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVT+FSDLTP EFRR F        G + L+LP+DA  A ILPT+DLP+DFD
Sbjct  87   KLDPSAVHGVTRFSDLTPAEFRRQF-------LGLKPLRLPSDAQKAPILPTNDLPTDFD  139

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR++GAVTGVK+QGSCGSCWSF
Sbjct  140  WREHGAVTGVKNQGSCGSCWSF  161



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 118/145 (81%), Gaps = 8/145 (6%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V ++++PLIRQVV  G++D LL ADHHF+LFK K+GKSYA++EEHDYR +VFKAN+RRA 
Sbjct  32   VVSNDNPLIRQVV--GDNDHLLTADHHFSLFKKKFGKSYASKEEHDYRFAVFKANMRRAL  89

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDPSAVHGVTKFSDLTP EFRR F         + +LK PA A+ A ILPT +LP+
Sbjct  90   RHQKLDPSAVHGVTKFSDLTPAEFRRNF------LGLRPRLKFPAHANKAPILPTDNLPT  143

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWR++GAVT VK+QGSCGSCWSF
Sbjct  144  DFDWREHGAVTPVKNQGSCGSCWSF  168



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 118/145 (81%), Gaps = 9/145 (6%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            + A  D  IRQVV +   D LL+A+HHF+LFKSKY KSYATQEEHDYR  +FKANLRR++
Sbjct  30   IDAGFDNPIRQVVPE---DHLLHAEHHFSLFKSKYSKSYATQEEHDYRFRIFKANLRRSR  86

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ+LDPSAVHGVTKFSDLTPKEFRR F         KR+L+LPADA  A+ILPT+DLP+
Sbjct  87   RHQVLDPSAVHGVTKFSDLTPKEFRRQF------LGLKRRLRLPADAQQAQILPTNDLPT  140

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            +FDWRD+GAV  VKDQGSCGSCWSF
Sbjct  141  EFDWRDHGAVAPVKDQGSCGSCWSF  165



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 116/146 (79%), Gaps = 7/146 (5%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            V   D DPLI QVV +  D+ LL+A+ HF+ FK+ +G++YATQEEHDYR  VFKANLRRA
Sbjct  24   VTPNDADPLIEQVVPEANDNLLLHAERHFSSFKATFGRTYATQEEHDYRFGVFKANLRRA  83

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
            KRHQ LDP+AVHGVTKFSDLTP EFRR F        G ++L+LP+DA+ A ILPT+DLP
Sbjct  84   KRHQGLDPTAVHGVTKFSDLTPSEFRRNF-------LGLKRLRLPSDANKAPILPTNDLP  136

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
            +DFDWRD GAVT VKDQGSCGSCW+F
Sbjct  137  TDFDWRDKGAVTPVKDQGSCGSCWAF  162



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 7/143 (5%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
             D+  LIRQV+ + +DD LLN DHHFT+FK ++GK+YA+ EEH YRLSVFKANLRRA RH
Sbjct  30   GDDGILIRQVIGN-DDDHLLNVDHHFTIFKKRFGKTYASDEEHHYRLSVFKANLRRAMRH  88

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSAVHGVT+FSDLTP EFRR F          R+L+LP+DA+ A +LPT DLPSDF
Sbjct  89   QKLDPSAVHGVTQFSDLTPAEFRRKF------LGVNRRLRLPSDANKAPVLPTEDLPSDF  142

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVT VK+QGSCGSCWSF
Sbjct  143  DWRDHGAVTPVKNQGSCGSCWSF  165



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 114/142 (80%), Gaps = 8/142 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDA-LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLIRQVV DG  +A +L+A+HHF+LFK K+GKSYA+QEEH+YR  VF+ANLRRA RHQ
Sbjct  31   EDPLIRQVVDDGRGEAHVLSAEHHFSLFKKKFGKSYASQEEHNYRFKVFQANLRRAARHQ  90

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA HGVT+FSDLTP EF++ F        G R L+LP DAH A ILPT+DLP DFD
Sbjct  91   KLDPSASHGVTQFSDLTPAEFKKQF-------LGLRSLRLPKDAHQAPILPTNDLPEDFD  143

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VK+QGSCGSCWSF
Sbjct  144  WREKGAVTNVKNQGSCGSCWSF  165



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 6/141 (4%)
 Frame = +1

Query  100  DPLIRQVV-SDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            DPLIRQVV    EDD LL+A+ HF+ FK+ +GKSYA+QEEHDYR  VFKANLRRAKRHQ 
Sbjct  27   DPLIRQVVPGAAEDDELLHAERHFSNFKATFGKSYASQEEHDYRFGVFKANLRRAKRHQG  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHGVTKFSDLTPKEFRR F         KR+L+LPADA+ A ILPT+DLP++FDW
Sbjct  87   LDPTAVHGVTKFSDLTPKEFRRNF-----LGLKKRRLRLPADANKAPILPTNDLPTEFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VKDQG+CGSCWSF
Sbjct  142  REKGAVTPVKDQGACGSCWSF  162



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   194 bits (492),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 7/142 (5%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ++D LIRQVV D ED  LLNA+HHF+ FK+K+GK+YATQEEHD+R  +FK NL RAK HQ
Sbjct  27   EDDLLIRQVVPDAEDHHLLNAEHHFSAFKTKFGKTYATQEEHDHRFRIFKNNLLRAKSHQ  86

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVT+FSDL P EFRR F        G + L+LP+DA  A ILPT+DLP+DFD
Sbjct  87   KLDPSAVHGVTRFSDLNPAEFRRQF-------LGLKPLRLPSDAQKAPILPTNDLPTDFD  139

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR++GAVTGVK+QGSCGSCWSF
Sbjct  140  WREHGAVTGVKNQGSCGSCWSF  161



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 9/138 (7%)
 Frame = +1

Query  106  LIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDP  285
            LIRQVV +G+D  LL+A+H F LFK+K+GK+Y+T EEHDYR SVF+ANLRRA+RHQLLDP
Sbjct  34   LIRQVVPEGDD--LLSAEHQFGLFKAKFGKTYSTVEEHDYRFSVFEANLRRARRHQLLDP  91

Query  286  SAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDY  465
            SAVHGVT+FSDLTP EFRR +        G + L+LPADA  A ILPT+DLP+DFDWRD+
Sbjct  92   SAVHGVTRFSDLTPDEFRRDY-------LGLKPLRLPADAQKAPILPTNDLPTDFDWRDH  144

Query  466  GAVTGVKDQGSCGSCWSF  519
            GAVT VKDQGSCGSCWSF
Sbjct  145  GAVTPVKDQGSCGSCWSF  162



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 113/141 (80%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV DG+ D LLNADHHFT+FK ++GK+YA+ EEHDYRLSVFKAN+RRAKRHQ 
Sbjct  29   DDILIRQVVGDGDGD-LLNADHHFTVFKRRFGKAYASDEEHDYRLSVFKANMRRAKRHQE  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHGVT+FSD TP EFRR F          R+LK PADA  A ILPT +LPSDFDW
Sbjct  88   LDPAAVHGVTQFSDSTPTEFRRKF------LGLNRRLKFPADAKTAPILPTDELPSDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QG+CG CWSF
Sbjct  142  RDRGAVTPVKNQGTCGLCWSF  162



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 117/146 (80%), Gaps = 11/146 (8%)
 Frame = +1

Query  97   EDPLIRQVVSDGE-----DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            +D LIRQVV  GE     +++LLNADHHF  FK K+GK+YATQEEHDYR SVF+AN+RRA
Sbjct  35   DDLLIRQVVDHGEGGAVDENSLLNADHHFAAFKRKFGKAYATQEEHDYRFSVFEANMRRA  94

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
             RHQ +DPSAVHGVT+FSDLTP+EFR+ F          R+L+LP+DA  A ILPT+DLP
Sbjct  95   VRHQKIDPSAVHGVTQFSDLTPREFRQQF------LGVNRRLRLPSDAQKAPILPTNDLP  148

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
            +DFDWRD+GAVT VK+QG+CGSCWSF
Sbjct  149  TDFDWRDHGAVTEVKNQGTCGSCWSF  174



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 114/142 (80%), Gaps = 8/142 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLIRQVVS G DD L L A+ HF  FK ++GK+YAT EEHDYRL VFKANLRRA+ HQ
Sbjct  30   EDPLIRQVVSSGGDDDLALGAERHFVDFKLRFGKAYATPEEHDYRLGVFKANLRRARLHQ  89

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVTKFSDLTP+EFRR F        G ++L+LP DA+ A +LPT DLP++FD
Sbjct  90   KLDPSAVHGVTKFSDLTPEEFRRQF-------LGLKRLRLPTDANKAPVLPTDDLPTEFD  142

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD GAVTGVKDQG+CGSCWSF
Sbjct  143  WRDRGAVTGVKDQGACGSCWSF  164



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 116/142 (82%), Gaps = 8/142 (6%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            D+D LIRQVVS G DD LL+A+HHF+ FK+++GK+Y T+EEHDYR  VFKANLRRAK HQ
Sbjct  29   DDDLLIRQVVSAG-DDQLLSAEHHFSSFKARFGKAYETEEEHDYRFEVFKANLRRAKTHQ  87

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDP+AVHGVTKFSDLTP EFR+ F        G ++L+LPAD   A ILPT+DLP+DFD
Sbjct  88   KLDPNAVHGVTKFSDLTPGEFRKKF-------LGLKRLRLPADTQKAPILPTNDLPADFD  140

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD+GAVT VKDQGSCGSCWSF
Sbjct  141  WRDHGAVTLVKDQGSCGSCWSF  162



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 113/143 (79%), Gaps = 8/143 (6%)
 Frame = +1

Query  94   DEDPL-IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            DED L IRQVV D ED  LLNA+HHF+ FK+K+ K+YATQEEHD+R  +FK NL RAK H
Sbjct  26   DEDNLLIRQVVPDAEDHHLLNAEHHFSAFKTKFAKTYATQEEHDHRFRIFKNNLLRAKSH  85

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSAVHGVT+FSDLTP EFR  F        G + L+LP+DA  A ILPTSDLP+DF
Sbjct  86   QKLDPSAVHGVTRFSDLTPSEFRGQF-------LGLKPLRLPSDAQKAPILPTSDLPTDF  138

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVTGVK+QGSCGSCWSF
Sbjct  139  DWRDHGAVTGVKNQGSCGSCWSF  161



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 115/141 (82%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +DPLIRQVVSDGED  LLNA+HHFT FKSK+GK+YATQEEHD+R SVFK NL  AK+HQ+
Sbjct  29   DDPLIRQVVSDGEDH-LLNAEHHFTTFKSKFGKNYATQEEHDFRFSVFKDNLLLAKKHQM  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DP+A HGVTKFSDLTP++  R F         KR+L+LP DA+ A ILPT DLP++FDW
Sbjct  88   MDPTAAHGVTKFSDLTPRDSPRQF------LGLKRRLRLPTDANKAPILPTGDLPTNFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VKDQGSCGSCWSF
Sbjct  142  RDQGAVTKVKDQGSCGSCWSF  162



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 113/143 (79%), Gaps = 8/143 (6%)
 Frame = +1

Query  94   DEDPL-IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            DED L IRQVV D ED  LLNA+HHF+ FK+K+ K+YATQEEHD+R  +FK NL RAK H
Sbjct  26   DEDNLLIRQVVPDAEDHHLLNAEHHFSAFKTKFAKTYATQEEHDHRFRIFKNNLLRAKSH  85

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSAVHGVT+FSDLTP EFR  F        G + L+LP+DA  A ILPTSDLP+DF
Sbjct  86   QKLDPSAVHGVTRFSDLTPAEFRGQF-------LGLKPLRLPSDAQKAPILPTSDLPTDF  138

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVTGVK+QGSCGSCWSF
Sbjct  139  DWRDHGAVTGVKNQGSCGSCWSF  161



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 115/141 (82%), Gaps = 9/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            ED LI QVVSDG+D  LLNA++ F  FK+K+GK+YAT EEHD+R +VFKANLRRAKRHQL
Sbjct  35   EDLLIHQVVSDGDD--LLNAEYQFAEFKTKFGKTYATAEEHDHRFNVFKANLRRAKRHQL  92

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HGVT+FSDLTP+EFR+ +        G ++L+LPADA  A ILPT DLP+DFDW
Sbjct  93   LDPSAEHGVTQFSDLTPREFRQNY-------LGLKRLQLPADAQKAPILPTKDLPTDFDW  145

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VKDQG CGSCWSF
Sbjct  146  RDHGAVTAVKDQGYCGSCWSF  166



>gb|AEQ94105.1| putative drought-inducible cysteine proteinase [Elaeis guineensis]
Length=187

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 118/144 (82%), Gaps = 4/144 (3%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
            A++DPLI QVV + ++D L LNA+ HF+ F  ++GKSYA ++EH YR SVFKANLRRA+R
Sbjct  29   AEDDPLIVQVVPESDEDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARR  88

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQ +DP+AVHG+TKFSDLTP EFRRT+LG+R     +R L   A +H A ILPT++LP+D
Sbjct  89   HQKMDPTAVHGITKFSDLTPAEFRRTYLGLRGGRRLRRAL---ASSHEAPILPTNNLPTD  145

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWRD+GAVTGVKDQGSCGSCWSF
Sbjct  146  FDWRDHGAVTGVKDQGSCGSCWSF  169



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 6/140 (4%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            D  IRQVV + E+D LLNA+HHF+LFKSKY K+YATQEEHD+RL VFKANLRRA+R+QLL
Sbjct  26   DNPIRQVVPE-ENDELLNAEHHFSLFKSKYQKTYATQEEHDHRLRVFKANLRRARRNQLL  84

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVT+FSDLTPKEFRR F         +RK +LP D   A ILPT+DLP++FDWR
Sbjct  85   DPSAVHGVTQFSDLTPKEFRRQF-----LGLKRRKFRLPTDTETAPILPTTDLPTEFDWR  139

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            + GAVT VK+QG CGSCWSF
Sbjct  140  EQGAVTPVKNQGMCGSCWSF  159



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +1

Query  109  IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  288
            IRQVV +  D+ LLNA+HHF+LFKSKY K+YATQEEHD+R  VFKANLRRA+R+QLLDPS
Sbjct  36   IRQVVPEENDEHLLNAEHHFSLFKSKYEKTYATQEEHDHRFRVFKANLRRARRNQLLDPS  95

Query  289  AVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYG  468
            AVHGVT+FSDLTPKEFRR F         +R  +LP D   A ILPTSDLP++FDWR+ G
Sbjct  96   AVHGVTQFSDLTPKEFRRKF-----LGLKRRGFRLPTDTQTAPILPTSDLPTEFDWREQG  150

Query  469  AVTGVKDQGSCGSCWSF  519
            AVT VK+QG CGSCWSF
Sbjct  151  AVTPVKNQGMCGSCWSF  167



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 113/143 (79%), Gaps = 7/143 (5%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
             D+D LIRQVV D ED  +LNA+HHFTLFK ++GK+YA+ EEH YR SVFKANLRRA RH
Sbjct  30   GDDDILIRQVVGD-EDHHMLNAEHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMRH  88

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSAVHGVT+FSD+TP EF + F          R+L+ P+DA+ A ILPT DLPSDF
Sbjct  89   QKLDPSAVHGVTQFSDMTPDEFSQKF------LGVNRRLRFPSDANKAPILPTEDLPSDF  142

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWR++GAVT VK+QGSCGSCWSF
Sbjct  143  DWREHGAVTPVKNQGSCGSCWSF  165



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 115/145 (79%), Gaps = 8/145 (6%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +  ++D LIRQVV D E+  LLNA++HF+ FK+K+G++YAT+EEHDYR  +FK NL RAK
Sbjct  25   IDGEDDLLIRQVVPDAEEH-LLNAENHFSAFKTKFGRTYATKEEHDYRFRIFKNNLLRAK  83

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
             HQ LDPSAVHGVTKFSDLTP EF R F        G + L+LP+DA  A ILPTSDLPS
Sbjct  84   SHQKLDPSAVHGVTKFSDLTPAEFSRQF-------LGLKPLRLPSDAQKAPILPTSDLPS  136

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD+GAVTGVK+QGSCGSCWSF
Sbjct  137  DFDWRDHGAVTGVKNQGSCGSCWSF  161



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 115/148 (78%), Gaps = 11/148 (7%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGED-----DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLR  255
              +D +IRQVV  GED     ++LLNADHHF +FK K+GK+Y  + EHDYRLSVFKAN+R
Sbjct  34   GSDDLVIRQVVDHGEDEVVGENSLLNADHHFAIFKRKFGKTYTDKAEHDYRLSVFKANMR  93

Query  256  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSD  435
            RA +HQ +DPSAVHGVT+FSDLTP+EFR  F          R+L+LP+DAH A ILPT+D
Sbjct  94   RAVQHQKIDPSAVHGVTQFSDLTPREFRSRF------LGVNRRLRLPSDAHKAPILPTND  147

Query  436  LPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            LP+DFDWRD GAVT VK+QGSCGSCWSF
Sbjct  148  LPADFDWRDRGAVTAVKNQGSCGSCWSF  175



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 113/143 (79%), Gaps = 7/143 (5%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
             D+D LIRQVV D ED  +LNA+HHFTLFK ++GK+YA+ EEH YR SVFKANLRRA RH
Sbjct  30   GDDDILIRQVVGD-EDHHMLNAEHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMRH  88

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSAVHGVT+FSD+TP EF + F          R+L+ P+DA+ A ILPT DLPSDF
Sbjct  89   QKLDPSAVHGVTQFSDMTPDEFSQKF------LGVNRRLRFPSDANKAPILPTEDLPSDF  142

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWR++GAVT VK+QGSCGSCWSF
Sbjct  143  DWREHGAVTPVKNQGSCGSCWSF  165



>ref|XP_010436538.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=227

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 111/137 (81%), Gaps = 6/137 (4%)
 Frame = +1

Query  109  IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  288
            IRQVV + E+D LLNA+HHF+LFKSKY K+YATQ+EHD+RL VFKANLRRA+R+QLLDPS
Sbjct  29   IRQVVPE-ENDELLNAEHHFSLFKSKYQKTYATQQEHDHRLRVFKANLRRARRNQLLDPS  87

Query  289  AVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYG  468
            AVHGVT+FSDLTPKEF R           +RK +LP D   A ILPT+DLP++FDWR+ G
Sbjct  88   AVHGVTQFSDLTPKEFSRQL-----MGLKRRKFRLPTDTETAPILPTTDLPTEFDWREQG  142

Query  469  AVTGVKDQGSCGSCWSF  519
            AVT VK+QG CGSCWSF
Sbjct  143  AVTPVKNQGMCGSCWSF  159



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 114/140 (81%), Gaps = 6/140 (4%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            D  IRQVV + E+D LLNA+HHF+LFKSKY K+YATQ+EHD+RL VFKANLRRA+R+QLL
Sbjct  26   DNPIRQVVPE-ENDELLNAEHHFSLFKSKYQKTYATQQEHDHRLRVFKANLRRARRNQLL  84

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVT+FSDLTPKEFRR F         +RK +LP D   A ILPT+DLP++FDWR
Sbjct  85   DPSAVHGVTQFSDLTPKEFRRQF-----LGLKRRKFRLPTDTETAPILPTTDLPTEFDWR  139

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            + GAVT VK+QG CGSCWSF
Sbjct  140  EQGAVTPVKNQGMCGSCWSF  159



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 109/137 (80%), Gaps = 5/137 (4%)
 Frame = +1

Query  109  IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  288
            IRQVV +  D+ LLNA+HHFTLFKSKY K+YATQ EHD+R  VFKANLRRA+R+QLLDPS
Sbjct  36   IRQVVPEENDEQLLNAEHHFTLFKSKYEKTYATQVEHDHRFRVFKANLRRARRNQLLDPS  95

Query  289  AVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYG  468
            AVHGVT+FSDLTPKEFRR F         +R  +LP D   A ILPTSDLP++FDWR+ G
Sbjct  96   AVHGVTQFSDLTPKEFRRKF-----LGLKRRGFRLPTDTQTAPILPTSDLPTEFDWREQG  150

Query  469  AVTGVKDQGSCGSCWSF  519
            AVT VK+QG CGSCWSF
Sbjct  151  AVTPVKNQGMCGSCWSF  167



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 11/151 (7%)
 Frame = +1

Query  82   VVRADE-DPLIRQVV----SDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
             V AD  DPLIRQVV    ++ E D LL+ +HHF LFK+K+G++Y T+EEH+YRL+VFK+
Sbjct  17   AVTADSSDPLIRQVVQNDETEIESDPLLDPEHHFKLFKNKFGRTYDTEEEHEYRLTVFKS  76

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            NLRRAKRHQ+LDP+A HGVTKFSDLTP EFR+ +         K KLKLPADA+ A ILP
Sbjct  77   NLRRAKRHQVLDPTAKHGVTKFSDLTPSEFRKKY------LGLKSKLKLPADANKAPILP  130

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            TS+LP DFDWRD GAVT VK+QGSCGSCWSF
Sbjct  131  TSNLPQDFDWRDKGAVTPVKNQGSCGSCWSF  161



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 111/146 (76%), Gaps = 6/146 (4%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            VV    D  IRQVV +  D+ LL A+HHF LFKSKY K+YATQEEHD+R  VFKANLRRA
Sbjct  22   VVDLSFDNPIRQVVPEESDEQLLTAEHHFALFKSKYEKTYATQEEHDHRFRVFKANLRRA  81

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
            KRHQ LDP+AVHGVT+FSDLTPKEFRR +         KR+ +LP D   A ILPTSDLP
Sbjct  82   KRHQALDPTAVHGVTQFSDLTPKEFRRKY------LGLKRRFRLPTDTQQAPILPTSDLP  135

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
            +DFDWR+ GAVT VK+QG CGSCWSF
Sbjct  136  TDFDWREQGAVTPVKNQGMCGSCWSF  161



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 115/145 (79%), Gaps = 8/145 (6%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +  ++D LIRQVV D E+  LLNA++HF+ FK+++G++YAT+EEHDYR  +FK NL RAK
Sbjct  25   IDGEDDLLIRQVVPDAEEH-LLNAENHFSAFKTRFGRTYATKEEHDYRFRIFKNNLLRAK  83

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
             HQ LDPSAVHGVTKFSDLTP EF R F        G + L+LP+DA  A ILPTSDLPS
Sbjct  84   SHQKLDPSAVHGVTKFSDLTPAEFSRQF-------LGLKPLRLPSDAQKAPILPTSDLPS  136

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD+GAVTGVK+QGSCGSCWSF
Sbjct  137  DFDWRDHGAVTGVKNQGSCGSCWSF  161



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   188 bits (478),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 112/141 (79%), Gaps = 8/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV DG D  LLNADHHFT+FK ++GK YA+ EEHDYRLS FKAN+RRAK+HQ 
Sbjct  28   DDILIRQVVGDGGD--LLNADHHFTVFKRRFGKVYASDEEHDYRLSEFKANMRRAKQHQE  85

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHGVT+FSDLTP EFRR F          R+LK PADA  A ILPT +LPSDFDW
Sbjct  86   LDPAAVHGVTQFSDLTPTEFRRKF------LGLNRRLKFPADAKTAPILPTDELPSDFDW  139

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QG+CGSC SF
Sbjct  140  RDHGAVTPVKNQGTCGSCCSF  160



>gb|AEQ94152.1| drought-inducible cysteine proteinase [Elaeis guineensis]
Length=252

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 118/144 (82%), Gaps = 4/144 (3%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
            A++DPLI QVV + ++D L LNA+ HF+ F  ++GKSYA ++EH YR SVFKANLRRA+R
Sbjct  29   AEDDPLIVQVVPESDEDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARR  88

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQ +DP+AVHG+TKFSDLTP EFRRT+LG+R     +R L   A +H A ILPT++LP+D
Sbjct  89   HQKMDPTAVHGITKFSDLTPAEFRRTYLGLRGGRRLRRAL---ASSHEAPILPTNNLPTD  145

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWRD+GAVTGVKDQGSCGSCWSF
Sbjct  146  FDWRDHGAVTGVKDQGSCGSCWSF  169



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 114/151 (75%), Gaps = 12/151 (8%)
 Frame = +1

Query  88   RADEDPLIRQVVSDGE-------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
             +D D +IRQVV DG        DD LL ADHHF++FK K+GKSYA++EEHD+R  VFKA
Sbjct  27   ESDGDFIIRQVVDDGGVNEGSNGDDLLLGADHHFSVFKQKFGKSYASKEEHDHRFRVFKA  86

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            NL+RA+RHQ LDPSA HGVT+FSDLTP EFRR+F          R+L LPADA+ A ILP
Sbjct  87   NLKRAQRHQALDPSATHGVTQFSDLTPSEFRRSF-----LGLRSRRLGLPADANKAPILP  141

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            T  LP+DFDWRD GAV+ VK+QGSCGSCWSF
Sbjct  142  TDGLPTDFDWRDKGAVSEVKNQGSCGSCWSF  172



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 11/150 (7%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGED-----DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            V   +DPLIRQVV  G+D     ++LLNAD+HF +FK K+GKSYA+QEEHDYR SVFKAN
Sbjct  32   VVGSDDPLIRQVVDHGDDEVVDENSLLNADYHFAIFKRKFGKSYASQEEHDYRFSVFKAN  91

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            L  A+RHQ LDPSAVHGVT+FSDLTP+EFR  F          R+L+LP+ A+ A ILPT
Sbjct  92   LHLARRHQKLDPSAVHGVTQFSDLTPREFRHQF------LGINRRLRLPSHANKAPILPT  145

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            +DLP+DFD RD+GAVT VK+QGSCGSCWSF
Sbjct  146  NDLPTDFDXRDHGAVTPVKNQGSCGSCWSF  175



>ref|XP_007160703.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32697.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=292

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 112/142 (79%), Gaps = 8/142 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            +D LIRQVV +GE +D LLNA+HHF+ FK+K+GK+YAT+EEHD+R  VFK+N+RRA+ H 
Sbjct  27   DDILIRQVVPEGEVEDHLLNAEHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARLHA  86

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVTKFSDLTP EF R F        G + L+LPA A  A ILPT++LP DFD
Sbjct  87   QLDPSAVHGVTKFSDLTPAEFHRKF-------LGLKPLRLPAHAQKAPILPTNNLPKDFD  139

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD GAVT VKDQGSCGSCWSF
Sbjct  140  WRDKGAVTNVKDQGSCGSCWSF  161



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 111/143 (78%), Gaps = 10/143 (7%)
 Frame = +1

Query  100  DPLIRQVVSDGED---DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            DPLIRQVV  G+D   D  L A+HHF+LFK ++GKSYA+QEEHDYR  VFKANLRRA RH
Sbjct  25   DPLIRQVVDGGDDHQHDHRLGAEHHFSLFKHQFGKSYASQEEHDYRFEVFKANLRRAARH  84

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q+LDPSA HGVT+FSD+TP EFR++         G R L+LP+DA  A ILPT +LP DF
Sbjct  85   QMLDPSAQHGVTRFSDMTPAEFRKS-------QLGLRGLRLPSDATKAPILPTENLPEDF  137

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD GAVT VK+QGSCGSCWSF
Sbjct  138  DWRDRGAVTAVKNQGSCGSCWSF  160



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 116/150 (77%), Gaps = 14/150 (9%)
 Frame = +1

Query  91   ADEDPLIRQVVSD------GEDDALLNADHH-FTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            +D+D +IRQVV +      GE++ LL ADHH F++FK ++GKSYA+QEEHDYR  VFKAN
Sbjct  30   SDDDIIIRQVVPELGDVEGGEEENLLTADHHHFSIFKRRFGKSYASQEEHDYRFKVFKAN  89

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            LRRA+RHQ LDPSA HGVT+FSDLTP EFR T+        G R LKLP DA  A ILPT
Sbjct  90   LRRARRHQQLDPSATHGVTQFSDLTPAEFRGTY-------LGLRPLKLPHDAQKAPILPT  142

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            +DLP DFDWRD+GAVT VK+QGSCGSCWSF
Sbjct  143  NDLPEDFDWRDHGAVTAVKNQGSCGSCWSF  172



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 113/143 (79%), Gaps = 9/143 (6%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
             +EDPLIRQVV DG     L A+HHF  FK ++GK Y+T++EHDYR +VFKAN+RRAKRH
Sbjct  25   VEEDPLIRQVVDDG--GVRLGAEHHFIEFKHRFGKVYSTKDEHDYRFNVFKANMRRAKRH  82

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            QL+DPSAVHGVT+FSDLTP+EFR +         G R L+LP+DA+ A ILPT +LP+DF
Sbjct  83   QLMDPSAVHGVTRFSDLTPREFRNSV-------LGLRGLRLPSDANTAPILPTDNLPADF  135

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD GAVT VK+QGSCGSCWSF
Sbjct  136  DWRDRGAVTSVKNQGSCGSCWSF  158



>ref|XP_003606999.1| Cysteine proteinase [Medicago truncatula]
Length=210

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 110/141 (78%), Gaps = 9/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDP+IRQVV   E+   L A+HHF LFK K+GK Y++++EHDYR  +FK+NL RAKRHQL
Sbjct  27   EDPIIRQVVD--EEGVRLGAEHHFNLFKHKFGKVYSSKDEHDYRFKIFKSNLNRAKRHQL  84

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSAVHGVT+FSDLTP+EFR++         G R + LP DA+AA ILPT +LP DFDW
Sbjct  85   MDPSAVHGVTRFSDLTPREFRKS-------VLGLRGVGLPKDANAAPILPTDNLPKDFDW  137

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VK+QGSCGSCWSF
Sbjct  138  REKGAVTAVKNQGSCGSCWSF  158



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 112/140 (80%), Gaps = 6/140 (4%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            D  IRQVV + E+D LLNA HHF+LFKSKY K+YATQ+EHD+R  VFKANLRRAKR+QLL
Sbjct  26   DNPIRQVVPE-ENDELLNAAHHFSLFKSKYEKTYATQDEHDHRFRVFKANLRRAKRNQLL  84

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVT+FSDLTPKEFRR F         ++K +LP D   A ILPT+DLP+DFDWR
Sbjct  85   DPSAVHGVTQFSDLTPKEFRRQF-----LGLKRQKFRLPTDTEIAPILPTTDLPTDFDWR  139

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            + GAVT VK+QG CGSCWSF
Sbjct  140  EQGAVTPVKNQGLCGSCWSF  159



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 110/143 (77%), Gaps = 10/143 (7%)
 Frame = +1

Query  100  DPLIRQVVSDGED---DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            DPLIRQVV  G+D   D  L A+HHF+LFK ++GKSYA+QEEHDYR  VFKANLRRA RH
Sbjct  25   DPLIRQVVDGGDDHQHDHRLGAEHHFSLFKHQFGKSYASQEEHDYRFEVFKANLRRAARH  84

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSA HGVT+FSD+TP EFR++         G R L+LPADA  A ILPT +LP DF
Sbjct  85   QRLDPSAQHGVTRFSDMTPAEFRKS-------QLGLRGLRLPADATKAPILPTENLPEDF  137

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD GAVT VK+QGSCGSCWSF
Sbjct  138  DWRDRGAVTAVKNQGSCGSCWSF  160



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 111/143 (78%), Gaps = 7/143 (5%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
             D+D  IRQVV D +D  +LNADHHFTLFK ++GK+YA+ EEH YR SVFKANLRRA  H
Sbjct  30   GDDDIFIRQVVGD-DDHHMLNADHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMSH  88

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSAVHGVT+FSDLTP EF + F          R+L+ P+DA+ A ILPT DLPSDF
Sbjct  89   QKLDPSAVHGVTQFSDLTPDEFSQKF------LGVNRRLRFPSDANKAPILPTEDLPSDF  142

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWR++GAVT VK+QGSCGSCWSF
Sbjct  143  DWREHGAVTPVKNQGSCGSCWSF  165



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 8/142 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            +D LIRQVV +GE +D LLNA+HHF+ FKSK+GK+YAT+EEHD+R  VFK+N+RRA+ H 
Sbjct  27   DDILIRQVVPEGEVEDHLLNAEHHFSTFKSKFGKTYATKEEHDHRFGVFKSNMRRARLHA  86

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVTKFSDLTP EF R F        G + L+LPA A  A ILPT++LP DFD
Sbjct  87   QLDPSAVHGVTKFSDLTPAEFHRKF-------LGLKPLRLPAHAQKAPILPTNNLPKDFD  139

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD GAVT VKDQGSCGSCWSF
Sbjct  140  WRDKGAVTNVKDQGSCGSCWSF  161



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 113/147 (77%), Gaps = 7/147 (5%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSD-GEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            VV    D  IRQVV +   D+ +LNA+ HFTLFKSKY K+YATQEEHDYR  VF+ANLRR
Sbjct  26   VVDGGLDNPIRQVVPELKNDEQILNAELHFTLFKSKYEKTYATQEEHDYRFRVFEANLRR  85

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            AKR+QLLDPSAVHGVT+FSDLTPKEFRR++         KR  +LP D   A ILPTS+L
Sbjct  86   AKRNQLLDPSAVHGVTQFSDLTPKEFRRSY------LGLKRGFRLPTDTKEAPILPTSEL  139

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P+DFDWR+ GAVT VK+QG CGSCWSF
Sbjct  140  PTDFDWREQGAVTPVKNQGMCGSCWSF  166



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 117/159 (74%), Gaps = 22/159 (14%)
 Frame = +1

Query  88   RAD---EDPLIRQVVSDGED------------DALLNADHHFTLFKSKYGKSYATQEEHD  222
            RAD    DPLIRQVV  G++            +A+L A+HHF+LFK K+GKSYA+QEEHD
Sbjct  19   RADVDVSDPLIRQVVDGGDESPHHHHHHDHDGEAMLGAEHHFSLFKRKFGKSYASQEEHD  78

Query  223  YRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPAD  402
            YR SVFK N+RRAKRHQ LDP+A HGVT+FSDLTP EFR++         G R LKLPAD
Sbjct  79   YRFSVFKTNMRRAKRHQRLDPTAQHGVTRFSDLTPAEFRKSH-------LGLRGLKLPAD  131

Query  403  AHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            A+ A ILPT +LP DFDWR+ GAVT VK+QGSCGSCWSF
Sbjct  132  ANTAPILPTENLPEDFDWRERGAVTEVKNQGSCGSCWSF  170



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 113/151 (75%), Gaps = 12/151 (8%)
 Frame = +1

Query  88   RADEDPLIRQVVSDGE-------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
             +D D +IRQVV DG        DD LL A+HHF++FK K+GKSYA++EEHD+R  VFKA
Sbjct  27   ESDGDFIIRQVVDDGGVNGASNGDDLLLGAEHHFSVFKQKFGKSYASKEEHDHRFRVFKA  86

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            NL+RA+RHQ LDPSA HGVT+FSDLTP EFRR+F          R+L LP DA+ A ILP
Sbjct  87   NLKRAQRHQALDPSATHGVTQFSDLTPSEFRRSF-----LGLRSRRLGLPEDANKAPILP  141

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            T  LP+DFDWRD GAVT VK+QGSCGSCWSF
Sbjct  142  TDGLPADFDWRDKGAVTEVKNQGSCGSCWSF  172



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 112/141 (79%), Gaps = 9/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVVS+ +D  LL+A+HHF  FK+++ K+YAT EEHDYR S+FKANLRRAKR+QL
Sbjct  31   DDLLIRQVVSNSDD--LLSAEHHFAAFKARFRKTYATAEEHDYRFSIFKANLRRAKRNQL  88

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSAVHGVT+FSDLTP EFR+ +        G + L+ P D   A ILPT+DLP+DFDW
Sbjct  89   LDPSAVHGVTRFSDLTPAEFRQNY-------LGLKPLRFPIDTQQAPILPTNDLPTDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VKDQG CGSCWSF
Sbjct  142  RDHGAVTAVKDQGECGSCWSF  162



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 112/142 (79%), Gaps = 8/142 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            +D LIRQVV +GE +D LLNA+HHF+ FK+K+GK+YAT+EEHD+R  VFK+N+RRA+ H 
Sbjct  27   DDILIRQVVPEGEVEDHLLNAEHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARLHA  86

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVTKFSDLTP EF R F        G + L+LPA A  A ILPT++LP DFD
Sbjct  87   QLDPSAVHGVTKFSDLTPAEFHRKF-------LGLKPLRLPAHAQKAPILPTNNLPKDFD  139

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD GAVT VKDQGSCGSCWSF
Sbjct  140  WRDKGAVTNVKDQGSCGSCWSF  161



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 118/144 (82%), Gaps = 4/144 (3%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
            A++DPLI QVV + ++D L LNA+ HF+ F  ++GKSYA ++EH YR SVFKANLRRA+R
Sbjct  31   AEDDPLIVQVVPESDEDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARR  90

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQ +DP+AVHG+TKFSDLTP EFRRT+LG+R     +R L   A +H A ILPT++LP+D
Sbjct  91   HQKMDPTAVHGITKFSDLTPAEFRRTYLGLRGGRRLRRAL---ASSHEAPILPTNNLPTD  147

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWRD+GAVTGVKDQGSCGSCWSF
Sbjct  148  FDWRDHGAVTGVKDQGSCGSCWSF  171



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 107/142 (75%), Gaps = 8/142 (6%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            DEDPLI QVV   +D   LNA+ HFT F S++GK+YA +EE  +RL VFKANLRRA RHQ
Sbjct  33   DEDPLILQVVDLEKDGLTLNAEAHFTSFMSRFGKTYADEEERSHRLKVFKANLRRAARHQ  92

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDP+AVHG+TKFSDLTP EFR  +           + + PA +H A ILPT+DLP+DFD
Sbjct  93   RLDPTAVHGITKFSDLTPAEFRSAY--------LGLRRQTPASSHQAPILPTNDLPTDFD  144

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD+GAVTGVK+QGSCGSCWSF
Sbjct  145  WRDHGAVTGVKNQGSCGSCWSF  166



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 111/140 (79%), Gaps = 6/140 (4%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            D  IRQVV + E+  LLNA+HHF+LFKSKY K+YATQEEHD+RL VFKANLRRA+R+QLL
Sbjct  26   DNPIRQVVPE-ENHELLNAEHHFSLFKSKYQKTYATQEEHDHRLRVFKANLRRARRNQLL  84

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVT+FSDLTPKEF R           +RK +LP D   A ILPT+DLP++FDWR
Sbjct  85   DPSAVHGVTQFSDLTPKEFSRQL-----MGLKRRKFRLPTDTETAPILPTTDLPTEFDWR  139

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            + GAVT VK+QG CGSCWSF
Sbjct  140  EQGAVTPVKNQGMCGSCWSF  159



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 111/153 (73%), Gaps = 14/153 (9%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDG-------EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVF  240
            V  A +D LIRQVV D        E+D LLNA+HHF  FK+K+GK YAT+EEHD R  VF
Sbjct  18   VSSAADDILIRQVVPDAVGEAAEKEEDHLLNAEHHFASFKAKFGKKYATKEEHDRRFGVF  77

Query  241  KANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEI  420
            K+NLRRA+ H  LDPSAVHGVTKFSDLTP EFRR F        G + L+LPA+A  A I
Sbjct  78   KSNLRRARLHAKLDPSAVHGVTKFSDLTPAEFRRQF-------LGFKPLRLPANAQKAPI  130

Query  421  LPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            LPT DLP DFDWRD GAVT VKDQG+CGSCWSF
Sbjct  131  LPTKDLPKDFDWRDKGAVTNVKDQGACGSCWSF  163



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 110/139 (79%), Gaps = 8/139 (6%)
 Frame = +1

Query  106  LIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLD  282
            LIRQVV +GE +D LLNA+HHF+ FK+K+GK+YAT+EEHD+R  VFK+N+RRA+ H  LD
Sbjct  30   LIRQVVPEGEVEDHLLNAEHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARLHAQLD  89

Query  283  PSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRD  462
            PSAVHGVTKFSDLTP EF R F        G + L+LPA A  A ILPT++LP DFDWRD
Sbjct  90   PSAVHGVTKFSDLTPAEFHRKF-------LGLKPLRLPAHAQKAPILPTNNLPKDFDWRD  142

Query  463  YGAVTGVKDQGSCGSCWSF  519
             GAVT VKDQGSCGSCWSF
Sbjct  143  KGAVTNVKDQGSCGSCWSF  161



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 112/140 (80%), Gaps = 9/140 (6%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            DPLIRQV +DG D  +LNA+HHFT FK+K+GKSYATQEEHDYR  VF+ANLRRAK H  L
Sbjct  24   DPLIRQV-TDG-DHHMLNAEHHFTTFKTKFGKSYATQEEHDYRFGVFRANLRRAKLHAKL  81

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSA HGVTKFSDLTP+EF+R +        G + L+LP+ A+ A ILPTSDLP +FDWR
Sbjct  82   DPSAEHGVTKFSDLTPEEFKRQY-------LGLKPLRLPSTANKAPILPTSDLPENFDWR  134

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            D GAVT VK+QGSCGSCW+F
Sbjct  135  DKGAVTPVKNQGSCGSCWAF  154



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 8/142 (6%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            D++ LIRQVV DG D+ LLNA+HHF+ FK+K+ K+YAT+EEHDYR  VFK+NL RAK HQ
Sbjct  26   DDNILIRQVVEDG-DEHLLNAEHHFSAFKTKFSKTYATKEEHDYRFGVFKSNLLRAKSHQ  84

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA+HGVTKFSDLTP EFR  F        G + L LP+DAH A ILPT +LP DFD
Sbjct  85   ELDPSAIHGVTKFSDLTPSEFRSQF-------LGLKPLSLPSDAHNAPILPTDNLPKDFD  137

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD+GAVT VK+QG+ GSCWSF
Sbjct  138  WRDHGAVTNVKNQGTGGSCWSF  159



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 10/150 (7%)
 Frame = +1

Query  91   ADEDPLIRQVVSD-------GEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            AD+D LIRQV ++         +D LLNADHHF+LFKSK+ K Y+++EEHD R S+FKAN
Sbjct  23   ADDDLLIRQVTTEDSSSSSSSPNDLLLNADHHFSLFKSKFNKIYSSKEEHDNRFSIFKAN  82

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            LRRA RHQ LDPSAVHGVTKFSDLTP+EFR+ +      + GKRKLKLP+DA+ A +LPT
Sbjct  83   LRRASRHQTLDPSAVHGVTKFSDLTPREFRQKY---LGLNGGKRKLKLPSDANKAPVLPT  139

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
              LP DFDWR++GAVT VKDQG CGSCWSF
Sbjct  140  DSLPEDFDWREHGAVTEVKDQGQCGSCWSF  169



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 110/142 (77%), Gaps = 8/142 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHH-FTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ++PLIRQVV+DG D  LL+ADHH F LFK+ YGK+YATQEEHDYR SVFK NLRRA+  Q
Sbjct  19   DEPLIRQVVTDGID--LLDADHHHFALFKADYGKAYATQEEHDYRFSVFKTNLRRARSRQ  76

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVT FSDLTP EFR ++         KR+LKLP DA  A +LPT  LP DFD
Sbjct  77   QLDPSAVHGVTMFSDLTPDEFRNSY-----LGLRKRRLKLPTDAKQAPLLPTDHLPEDFD  131

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD GAVT VKDQGSCGSCWSF
Sbjct  132  WRDKGAVTAVKDQGSCGSCWSF  153



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 110/141 (78%), Gaps = 9/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDP+IRQVV   E+   L A+HHF LFK K+GK Y++++EHDYR  +FK+NL RAKRHQL
Sbjct  27   EDPIIRQVVD--EEGVRLGAEHHFNLFKHKFGKVYSSKDEHDYRFKIFKSNLNRAKRHQL  84

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSAVHGVT+FSDLTP+EFR++         G R + LP DA+AA ILPT +LP DFDW
Sbjct  85   MDPSAVHGVTRFSDLTPREFRKSV-------LGLRGVGLPKDANAAPILPTDNLPKDFDW  137

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VK+QGSCGSCWSF
Sbjct  138  REKGAVTAVKNQGSCGSCWSF  158



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 115/146 (79%), Gaps = 13/146 (9%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDA-----LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            EDPLIRQVV DG+D++     LL+ +HHF+LFKSK+ KSY +Q+EHDYR  VFKANLRRA
Sbjct  29   EDPLIRQVV-DGQDESSTSPHLLSEEHHFSLFKSKFKKSYTSQQEHDYRFKVFKANLRRA  87

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
             RHQ LDP+A HGVT+FSDLTP EFRR F        G R+L+LP DA+ A ILPT++LP
Sbjct  88   ARHQKLDPTASHGVTQFSDLTPAEFRRQF-------LGLRRLRLPKDANQAPILPTNELP  140

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
             DFDWR+ GAV+ VK+QGSCGSCWSF
Sbjct  141  DDFDWREKGAVSPVKNQGSCGSCWSF  166



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 110/147 (75%), Gaps = 14/147 (10%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDA-------LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            DPLIRQVV  G++         +L A+HHF+LFK KYGKSYA++EEHDYR  VFKANLRR
Sbjct  25   DPLIRQVVDGGDESHHDHDHDHVLGAEHHFSLFKHKYGKSYASKEEHDYRFDVFKANLRR  84

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            A RHQ LDPSA HGVT+FSD+TP EFR++         G R LKLP DA  A ILPT +L
Sbjct  85   AARHQRLDPSAQHGVTRFSDMTPAEFRKS-------QLGLRGLKLPEDATKAPILPTENL  137

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P DFDWR++GAVT VK+QGSCGSCWSF
Sbjct  138  PEDFDWREHGAVTAVKNQGSCGSCWSF  164



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 7/142 (5%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ++D LIRQV +D EDD LLNA+HHFT FKSK+ KSYAT+EEHDYR  VFK+NL++AK HQ
Sbjct  24   NDDFLIRQV-TDHEDDQLLNAEHHFTTFKSKFSKSYATKEEHDYRFGVFKSNLKKAKLHQ  82

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA HGVTKFSDLT  EFRR F         K++L+LPA A  A ILPT++LP DFD
Sbjct  83   KLDPSAEHGVTKFSDLTASEFRRQF------LGLKKRLRLPAHAQKAPILPTNNLPEDFD  136

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VKDQGSCGSCW+F
Sbjct  137  WREKGAVTPVKDQGSCGSCWAF  158



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 4/139 (3%)
 Frame = +1

Query  106  LIRQVVSDG-EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLD  282
            LI QVVS+  ED+ +LNA+ HF+ F  ++GKSYA ++EH YR SVFKANLRRA+RHQ +D
Sbjct  33   LIVQVVSEADEDELMLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRHQKMD  92

Query  283  PSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRD  462
            P+AVHG+TK+SDLTP EFRRTFLG+R     +R L   A +H A ILPT+DLP+DFDWRD
Sbjct  93   PTAVHGITKYSDLTPAEFRRTFLGLRGGRRLRRAL---ASSHEAPILPTNDLPTDFDWRD  149

Query  463  YGAVTGVKDQGSCGSCWSF  519
            +GAVTGVKDQGSCGSCWSF
Sbjct  150  HGAVTGVKDQGSCGSCWSF  168



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 8/139 (6%)
 Frame = +1

Query  106  LIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLD  282
            LIRQVV +GE +D LLNA+HHF+ FK+K+GK+YAT+EEHD+R  VFK+NLRRA+ H  LD
Sbjct  29   LIRQVVPEGEVEDHLLNAEHHFSNFKAKFGKTYATKEEHDHRFGVFKSNLRRARLHAQLD  88

Query  283  PSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRD  462
            PSAVHGVTKFSDLT  EF+R F        G + L LPA+A  A ILPT++LP DFDWRD
Sbjct  89   PSAVHGVTKFSDLTAAEFQRQF-------LGLKPLGLPANAQKAPILPTNNLPKDFDWRD  141

Query  463  YGAVTGVKDQGSCGSCWSF  519
             GAVT VKDQG+CGSCWSF
Sbjct  142  KGAVTNVKDQGACGSCWSF  160



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 110/141 (78%), Gaps = 10/141 (7%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            ED +I+Q+V   + D  L+ADHHF LFK ++GKSYATQE+HDYR SVFK NLRRA+ HQ 
Sbjct  30   EDLVIQQIV---DGDHPLSADHHFRLFKRRFGKSYATQEDHDYRFSVFKTNLRRARHHQR  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSAVHGVT+FSDLTP EFRR          G ++L+ PADA+ A ILPT DLP+DFDW
Sbjct  87   LDPSAVHGVTQFSDLTPAEFRRNH-------LGLKRLRFPADANKAPILPTEDLPADFDW  139

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAV  VK+QGSCGSCWSF
Sbjct  140  RDHGAVASVKNQGSCGSCWSF  160



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 113/143 (79%), Gaps = 4/143 (3%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            D+DPLI QVV D EDD L LN + HF+ F  ++GKSYA ++EH YR SVFKANLRRA+RH
Sbjct  27   DDDPLILQVVPDAEDDELMLNTEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRH  86

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDP+AVHG+TKFSDLTP EFRR +LG+R     +R L   A +H A ILPT+DLP+D 
Sbjct  87   QRLDPTAVHGITKFSDLTPAEFRRNYLGLRGGRRLRRAL---AASHEAPILPTNDLPTDI  143

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVT VKDQGSCGSCWSF
Sbjct  144  DWRDHGAVTAVKDQGSCGSCWSF  166



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 107/140 (76%), Gaps = 8/140 (6%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            D LIRQVV D ED  +LNA+HHF+ FKSK+ K+YAT+EEHDYR  VFK+N+RRAK H  L
Sbjct  1    DLLIRQVVDDNEDH-VLNAEHHFSTFKSKFSKTYATKEEHDYRFGVFKSNVRRAKLHAKL  59

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVTKFSDLTP EFRR F        G + L+LP  A  A ILPT DLP DFDWR
Sbjct  60   DPSAVHGVTKFSDLTPSEFRRQF-------LGLKPLRLPEHAQKAPILPTHDLPEDFDWR  112

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            D GAVT VK+QGSCGSCW+F
Sbjct  113  DKGAVTHVKNQGSCGSCWAF  132



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 107/145 (74%), Gaps = 8/145 (6%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V  +ED LIRQVVS G DD  L A+ HF  FK K+GK+Y T EEHDYR  VFKANLR+AK
Sbjct  32   VSDEEDILIRQVVS-GADDRPLTAEQHFQDFKLKFGKTYTTDEEHDYRFRVFKANLRKAK  90

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDP AVHGVT+FSDLT  EFR  F        G  +L+LPADAH A ILPT +L S
Sbjct  91   RHQKLDPDAVHGVTRFSDLTESEFRENF-------VGLNRLRLPADAHQAPILPTDNLAS  143

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD GAVT VKDQGSCGSCWSF
Sbjct  144  DFDWRDQGAVTPVKDQGSCGSCWSF  168



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   EEH YRLS+FKANLRRA+RHQ
Sbjct  24   EDPLIRQVVPGGDDNELELNAESHFLSFVQRFGKSYKDAEEHAYRLSIFKANLRRARRHQ  83

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
            LLDPSA HGVTKFSDLTP EFRRT+LG+RKS     +    + A+ A +LPT  LP DFD
Sbjct  84   LLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLRELGKS-ANEAPVLPTDGLPDDFD  142

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD+GAVT VK+QGSCGSCWSF
Sbjct  143  WRDHGAVTPVKNQGSCGSCWSF  164



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 109/141 (77%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV D E+D LLNA+HHFT FKSK+ KSYAT+EEHDYR  VFKANL +AK HQ 
Sbjct  21   DDFLIRQVV-DNEEDHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKANLIKAKLHQK  79

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+A HG+TKFSDLT  EFRR F          ++L+LPA A  A ILPT++LP DFDW
Sbjct  80   LDPTAEHGITKFSDLTASEFRRQF------LGLNKRLRLPAHAQKAPILPTTNLPEDFDW  133

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VKDQGSCGSCW+F
Sbjct  134  REKGAVTPVKDQGSCGSCWAF  154



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 109/147 (74%), Gaps = 14/147 (10%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDAL-------LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            DPLIRQVV  G++          L A+HHF+LFK K+GKSYA++EEHDYR  VFKANLRR
Sbjct  25   DPLIRQVVDGGDESHHHHDHDHALGAEHHFSLFKHKFGKSYASKEEHDYRFDVFKANLRR  84

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            A RHQ LDPSA HGVT+FSD+TP EFR++         G R LKLP DA  A ILPT +L
Sbjct  85   AARHQRLDPSAQHGVTRFSDMTPAEFRKS-------QLGLRGLKLPEDATKAPILPTENL  137

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P DFDWR++GAVT VK+QGSCGSCWSF
Sbjct  138  PEDFDWREHGAVTAVKNQGSCGSCWSF  164



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 111/144 (77%), Gaps = 4/144 (3%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
            AD DPLI QVV D EDD L LNA+ HF+ F  ++GKSYA ++EH YR SVFKANL RA+R
Sbjct  28   ADNDPLILQVVPDAEDDELMLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLWRAQR  87

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQ LDP+AVHG+TKFSDLTP EFRR +LG+      +R L   A +H A ILPT+DLP+D
Sbjct  88   HQRLDPTAVHGITKFSDLTPAEFRRNYLGLHGWRRLRRAL---AASHEAPILPTNDLPTD  144

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
             DWRD GAVT VKDQGSCGSCWSF
Sbjct  145  IDWRDSGAVTAVKDQGSCGSCWSF  168



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 108/143 (76%), Gaps = 11/143 (8%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
              ED +IRQVV    D   L A+ HF  FKS++GK+YAT EEHDYR +VFKANLRRA+RH
Sbjct  25   GGEDSMIRQVV----DGVRLGAEEHFLEFKSRFGKAYATPEEHDYRFTVFKANLRRARRH  80

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSAVHGVT+FSDLTP EFR           G R ++LP+DA+ A ILPT D+PSDF
Sbjct  81   QSLDPSAVHGVTRFSDLTPSEFRNKV-------LGLRGVRLPSDANKAPILPTDDIPSDF  133

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVT VK+QGSCGSCWSF
Sbjct  134  DWRDHGAVTPVKNQGSCGSCWSF  156



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 110/144 (76%), Gaps = 8/144 (6%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDA-LLNADH-HFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
            D D LIRQVV     D  L   DH HF+LFK+++GKSYA+QEEHD+R +VF+ANL RA+R
Sbjct  25   DGDALIRQVVDGAAADGDLSTEDHRHFSLFKTRFGKSYASQEEHDHRFAVFRANLHRARR  84

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQ LDPSAVHGVT+FSDLTP EFRR+          +  L+LP DA+ A +LPT DLP D
Sbjct  85   HQELDPSAVHGVTRFSDLTPSEFRRSH------LGIRGGLRLPKDANEAPLLPTDDLPED  138

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWRD+GAVTGVK+QGSCGSCWSF
Sbjct  139  FDWRDHGAVTGVKNQGSCGSCWSF  162



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 106/142 (75%), Gaps = 11/142 (8%)
 Frame = +1

Query  106  LIRQVVSD----GEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            LIRQVV D     E+D LLNA+HHF  FK+K+ K+YAT+EEHD+R  VFK+NLRRA+ H 
Sbjct  54   LIRQVVPDVGEAEEEDNLLNAEHHFASFKAKFAKTYATKEEHDHRFGVFKSNLRRARLHA  113

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVTKFSDLTP EFRR F        G + L+ PA A  A ILPT DLP DFD
Sbjct  114  KLDPSAVHGVTKFSDLTPAEFRRQF-------LGLKPLRFPAHAQKAPILPTKDLPKDFD  166

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD GAVT VKDQG+CGSCWSF
Sbjct  167  WRDKGAVTNVKDQGACGSCWSF  188



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 114/145 (79%), Gaps = 12/145 (8%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +DPLIR+VV DG+D +   LL+A+ HHF+LFKSK+ KSY +QEEHDYR SVFKANLRRA 
Sbjct  27   DDPLIREVV-DGQDASSSNLLSAEQHHFSLFKSKFKKSYGSQEEHDYRFSVFKANLRRAA  85

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDP+A HGVT+FSDLTP EFR+          G R+L+LP DA+ A ILPTSDLP 
Sbjct  86   RHQALDPTASHGVTQFSDLTPAEFRKQV-------LGLRRLRLPKDANEAPILPTSDLPE  138

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD GAV  VK+QGSCGSCWSF
Sbjct  139  DFDWRDKGAVGPVKNQGSCGSCWSF  163



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 105/141 (74%), Gaps = 8/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            ED LIRQVVS G DD LL A+  F  FK K+GK+YAT EEHDYR  VFK NLR+AKRHQ 
Sbjct  36   EDLLIRQVVS-GADDRLLTAEQRFQNFKLKFGKTYATAEEHDYRFRVFKDNLRKAKRHQK  94

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP AVHGVT+FSDLT  EFR  F        G  +L+LPADAH A ILPT +L SDFDW
Sbjct  95   LDPDAVHGVTRFSDLTESEFRENF-------VGLNRLRLPADAHQAPILPTDNLASDFDW  147

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VKDQGSCGSCWSF
Sbjct  148  RDKGAVTPVKDQGSCGSCWSF  168



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 109/146 (75%), Gaps = 2/146 (1%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            V  +E+PLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   +EH YRLSVFKANLRRA
Sbjct  22   VPGEEEPLIRQVVGGGDDNELELNAERHFASFVQRFGKSYRDADEHAYRLSVFKANLRRA  81

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
            +RHQLLDPSA HGVTKFSDLTP EFRR +LG+R S     +      AH A +LPT  LP
Sbjct  82   RRHQLLDPSAEHGVTKFSDLTPAEFRRAYLGLRTSRRAFLRGLG-GSAHEAPVLPTDGLP  140

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
             DFDWRD+GAV  VK+QGSCGSCWSF
Sbjct  141  DDFDWRDHGAVGPVKNQGSCGSCWSF  166



>gb|AFK47617.1| unknown [Medicago truncatula]
Length=241

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 108/141 (77%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV D  +D +LNA+HHFT FKSK+ K+YAT+EEHDYR  VFK+NL +AK HQ 
Sbjct  29   DDLLIRQVV-DTAEDHILNAEHHFTSFKSKFSKNYATKEEHDYRFGVFKSNLIKAKLHQK  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HG+TKFSDLT  EFRR F          ++L+LPA A  A ILPT++LP DFDW
Sbjct  88   LDPSAQHGITKFSDLTASEFRRQF------LGLNKRLRLPAHAQKAPILPTNNLPEDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VKDQGSCGSCW+F
Sbjct  142  REKGAVTPVKDQGSCGSCWAF  162



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 111/141 (79%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDP+IRQVVSD +   LL+A+ HF+ F S+YGKSYA + EH YR SVFK+NLRRA+RHQ 
Sbjct  23   EDPVIRQVVSD-DQQQLLSAEAHFSSFLSRYGKSYADEAEHAYRFSVFKSNLRRARRHQR  81

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHGVT+F+DLTP EFRRT+LG+R+              H A ILPT++LP+DFDW
Sbjct  82   LDPTAVHGVTRFADLTPSEFRRTYLGLRRRPRTA------GSTHDAPILPTNELPADFDW  135

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QGSCGSCWSF
Sbjct  136  RDHGAVTPVKNQGSCGSCWSF  156



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   +EH YRLSVFKANLRRA+RHQ
Sbjct  24   EDPLIRQVVPGGDDNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKANLRRARRHQ  83

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
            LLDPSA HGVTKFSDLTP EFRRT+LG+RKS     +    + AH A +LPT  LP DFD
Sbjct  84   LLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLRELGES-AHEAPVLPTDGLPDDFD  142

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD+GAV  VK+QGSCGSCWSF
Sbjct  143  WRDHGAVGPVKNQGSCGSCWSF  164



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 114/145 (79%), Gaps = 12/145 (8%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +DPLIR+VV DG+D +   LL+A+ HHF+LFKSK+ KSY +QEEHDYR SVFKANLRRA 
Sbjct  27   DDPLIREVV-DGQDASSSNLLSAEQHHFSLFKSKFKKSYGSQEEHDYRFSVFKANLRRAA  85

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDP+A HGVT+FSDLTP EFR+          G R+L+LP DA+ A ILPTSDLP 
Sbjct  86   RHQELDPTASHGVTQFSDLTPAEFRKQV-------LGLRRLRLPKDANEAPILPTSDLPE  138

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD GAV  +K+QGSCGSCWSF
Sbjct  139  DFDWRDKGAVGPIKNQGSCGSCWSF  163



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 113/146 (77%), Gaps = 11/146 (8%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDA---LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            ++ DPLIRQV +DG+D A   LL A+HHF+LFKS++ KSY +QEEHDYR  VF+ NLRRA
Sbjct  53   SEVDPLIRQV-TDGQDGAEPQLLTAEHHFSLFKSRFKKSYGSQEEHDYRFKVFQDNLRRA  111

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
             RHQ LDPSA HGVT+FSDLTP+EFRRT+        G R+L+LP DA  A ILPT +LP
Sbjct  112  ARHQKLDPSASHGVTQFSDLTPREFRRTY-------LGLRRLRLPKDATEAPILPTDNLP  164

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
             DFDW + GAVT VK+QGSCGSCWSF
Sbjct  165  EDFDWSEKGAVTPVKNQGSCGSCWSF  190



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   +EH YRLSVFKANLRRA+RHQ
Sbjct  26   EDPLIRQVVPGGDDNDLELNAESHFLNFVQRFGKSYKDADEHAYRLSVFKANLRRARRHQ  85

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
            LLDPSA HG+TKFSDLTP EFRRT+LG+RKS     +    + AH A +LPT  LP DFD
Sbjct  86   LLDPSAEHGITKFSDLTPAEFRRTYLGLRKSRRALLRELGDS-AHEAPVLPTDGLPEDFD  144

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD+GAV  VK+QGSCGSCWSF
Sbjct  145  WRDHGAVGPVKNQGSCGSCWSF  166



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   178 bits (452),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 112/151 (74%), Gaps = 15/151 (10%)
 Frame = +1

Query  94   DEDPLIRQVVSDGE---------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
            D D LIRQV   G+         ++ LL A+HHF+LFK K+ K+YA+QEEHD+R ++FKA
Sbjct  27   DVDQLIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKA  86

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            NLRRA RHQ LDPSA HG+T+FSDLTP EFRRT+         +RKL+LP DA  A ILP
Sbjct  87   NLRRAARHQKLDPSATHGITQFSDLTPAEFRRTY------LGLRRKLRLPKDADQAPILP  140

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            T+DLP+DFDWR+ GAV  VKDQGSCGSCWSF
Sbjct  141  TNDLPADFDWREKGAVGPVKDQGSCGSCWSF  171



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 7/147 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVV-SDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            V  D DPLIRQVV +DG+ +   L A+HHF+LFK ++GKSYAT+EEHD R  +FKAN+RR
Sbjct  30   VEHDGDPLIRQVVENDGDFNHHALGAEHHFSLFKRRFGKSYATEEEHDRRFKIFKANMRR  89

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            A+RHQ  DPSA+HGVT+FSDLTP EFR+ F           +L+LP D +AA ILPT +L
Sbjct  90   AERHQSFDPSAIHGVTQFSDLTPFEFRKAF-----LGLRGHRLRLPVDTNAAPILPTENL  144

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P DFDWR +G VT VK+QGSCGSCWSF
Sbjct  145  PIDFDWRQHGGVTRVKNQGSCGSCWSF  171



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 7/147 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVV-SDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            V  D DPLIRQVV +DG+ +   L A+HHF+LFK ++GKSYAT+EEHD R  +FKAN+RR
Sbjct  30   VEHDGDPLIRQVVENDGDFNHHALGAEHHFSLFKRRFGKSYATEEEHDRRFKIFKANMRR  89

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            A+RHQ  DPSA+HGVT+FSDLTP EFR+ F           +L+LP D +AA ILPT +L
Sbjct  90   AERHQSFDPSAIHGVTQFSDLTPFEFRKAF-----LGLRGHRLRLPVDTNAAPILPTENL  144

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P DFDWR +G VT VK+QGSCGSCWSF
Sbjct  145  PIDFDWRQHGGVTRVKNQGSCGSCWSF  171



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 7/147 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGED--DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            V+ D DP IRQVV D  D     L A+HHF+LFK ++GKSYAT+EEHD R  +FKAN+RR
Sbjct  28   VQHDRDPFIRQVVEDDGDFNRHALGAEHHFSLFKRRFGKSYATEEEHDRRFKIFKANMRR  87

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            A+RHQ  DPSA+HG+T+FSDLTP EFR+ F           +L+LP D +AA ILPT +L
Sbjct  88   AERHQSFDPSAIHGITQFSDLTPFEFRKAF-----LGLRGHRLRLPVDTNAAPILPTENL  142

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P DFDWR+ GAVT VK+QGSCGSCWSF
Sbjct  143  PIDFDWRERGAVTRVKNQGSCGSCWSF  169



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 7/147 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVV-SDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            V  D DPLIRQVV +DG+ +   L A+HHF+LFK ++GKSYAT+EEHD R  +FKAN+RR
Sbjct  30   VEHDGDPLIRQVVENDGDFNHHALGAEHHFSLFKRRFGKSYATEEEHDRRFKIFKANMRR  89

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            A+RHQ  DPSA+HGVT+FSDLTP EFR+ F           +L+LP D +AA ILPT +L
Sbjct  90   AERHQSFDPSAIHGVTQFSDLTPFEFRKAF-----LGLRGHRLRLPVDTNAAPILPTENL  144

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P DFDWR +G VT VK+QGSCGSCWSF
Sbjct  145  PIDFDWRQHGGVTRVKNQGSCGSCWSF  171



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 110/146 (75%), Gaps = 9/146 (6%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDAL---LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
             D D LIRQVV DG D      L+  HHF+LFK ++G+SY +QEEHDYR  VF+ANLRRA
Sbjct  32   GDGDALIRQVVDDGGDGREGGPLSDHHHFSLFKRRFGRSYGSQEEHDYRFGVFRANLRRA  91

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
            +RHQ LDPSA HGVT+FSDLTP EFRRT          +RK+KLP DA+ A ILPT DLP
Sbjct  92   RRHQKLDPSAAHGVTQFSDLTPSEFRRTH------LGLRRKVKLPKDANEAPILPTQDLP  145

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
             DFDWRD+GAVT VK+QGSCGSCWSF
Sbjct  146  KDFDWRDHGAVTAVKNQGSCGSCWSF  171



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 116/150 (77%), Gaps = 12/150 (8%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGEDDAL----LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            VV ++ DPLIRQV +DG+DD +    L A+HHF+LFK+++ KSY ++EEHDYR  VF+AN
Sbjct  28   VVGSEVDPLIRQV-TDGQDDGVETQPLTAEHHFSLFKARFKKSYGSEEEHDYRFKVFRAN  86

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            LRRA+RHQ LDPSA HGVT+FSDLTP EFR+          G R+L+LP DA+ A ILPT
Sbjct  87   LRRAERHQKLDPSATHGVTQFSDLTPGEFRKR-------FLGLRRLRLPTDANQAPILPT  139

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
             +LP DFDWR+ GAVT VK+QGSCGSCWSF
Sbjct  140  DNLPEDFDWREKGAVTPVKNQGSCGSCWSF  169



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 112/151 (74%), Gaps = 15/151 (10%)
 Frame = +1

Query  94   DEDPLIRQVVSDGE---------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
            D D +IRQV   G+         ++ LL A+HHF+LFK K+ K+YA+QEEHD+R ++FKA
Sbjct  27   DVDQMIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKA  86

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            NLRRA RHQ LDPSA HG+T+FSDLTP EFRRT+         +RKL+LP DA  A ILP
Sbjct  87   NLRRAARHQKLDPSATHGITQFSDLTPAEFRRTY------LGLRRKLRLPKDADQAPILP  140

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            T+DLP+DFDWR+ GAV  VKDQGSCGSCWSF
Sbjct  141  TNDLPADFDWREKGAVGPVKDQGSCGSCWSF  171



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 110/141 (78%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D +IRQVV D E+D LLNA+HHFT FKSK+ KSY+T+EEHDYR  VFK+NL +AK HQ 
Sbjct  26   DDFIIRQVV-DNEEDHLLNAEHHFTSFKSKFSKSYSTKEEHDYRFGVFKSNLIKAKLHQK  84

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+A HG+TKFSDLT  EFRR F         K++L+LPA A  A ILPT++LP DFDW
Sbjct  85   LDPTAEHGITKFSDLTASEFRRQF------LGLKKRLRLPAHAQKAPILPTTNLPEDFDW  138

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VKDQGSCGSCW+F
Sbjct  139  REKGAVTPVKDQGSCGSCWAF  159



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 110/141 (78%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D +IRQVV D E+D LLNA+HHFT FKSK+ KSY+T+EEHDYR  VFK+NL +AK HQ 
Sbjct  26   DDFIIRQVV-DNEEDHLLNAEHHFTSFKSKFSKSYSTKEEHDYRFGVFKSNLIKAKLHQK  84

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+A HG+TKFSDLT  EFRR F         K++L+LPA A  A ILPT++LP DFDW
Sbjct  85   LDPTAEHGITKFSDLTASEFRRQF------LGLKKRLRLPAHAQKAPILPTTNLPEDFDW  138

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VKDQGSCGSCW+F
Sbjct  139  REKGAVTPVKDQGSCGSCWAF  159



>gb|AAN60308.1| unknown [Arabidopsis thaliana]
Length=193

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V   +D +IRQVV  G +  +L ++ HF+LFK K+GK YA+ EEHDYR SVFKANLRRA+
Sbjct  25   VNDGDDLVIRQVVG-GAEPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRAR  83

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDPSA HGVT+FSDLT  EFR+      K    +   KLP DA+ A ILPT +LP 
Sbjct  84   RHQKLDPSATHGVTQFSDLTRSEFRK------KHLGVRSGFKLPKDANKAPILPTENLPE  137

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD+GAVT VK+QGSCGSCWSF
Sbjct  138  DFDWRDHGAVTPVKNQGSCGSCWSF  162



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 6/137 (4%)
 Frame = +1

Query  109  IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  288
            IRQVV +  D+ LLN DH FTLFKSKY K+Y  Q EHD+R  VFKAN+RRA+RHQ LDPS
Sbjct  30   IRQVVKEENDEQLLNLDHQFTLFKSKYEKTYKNQVEHDHRFRVFKANVRRARRHQQLDPS  89

Query  289  AVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYG  468
            AVHGVT+FSD+TPKEF R +         KR+ +LP D   A ILPTS+LP+DFDWR+ G
Sbjct  90   AVHGVTQFSDVTPKEFSRKY------LGLKRRFRLPNDTQKAAILPTSELPTDFDWREKG  143

Query  469  AVTGVKDQGSCGSCWSF  519
            AVT VK+QG CGSCWSF
Sbjct  144  AVTPVKNQGLCGSCWSF  160



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 115/150 (77%), Gaps = 12/150 (8%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGEDDAL----LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            VV ++ DPLIRQV +DG+DD +    L A+HHF+LFK+++ KSY ++EEHDYR  VF+AN
Sbjct  28   VVGSEVDPLIRQV-TDGQDDGVETQPLTAEHHFSLFKARFKKSYGSEEEHDYRFKVFRAN  86

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            LRRA RHQ LDPSA HGVT+FSDLTP EFR+          G R+L+LP DA+ A ILPT
Sbjct  87   LRRAARHQKLDPSATHGVTQFSDLTPGEFRKR-------FLGLRRLRLPKDANQAPILPT  139

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
             +LP DFDWR+ GAVT VK+QGSCGSCWSF
Sbjct  140  DNLPEDFDWREKGAVTPVKNQGSCGSCWSF  169



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 109/142 (77%), Gaps = 2/142 (1%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   +EH YRLSVFK NLRRA+RHQ
Sbjct  24   EDPLIRQVVPGGDDNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKDNLRRARRHQ  83

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
            LLDPSA HGVTKFSDLTP EFRRT+LG+RKS     +    + AH A +LPT  LP DFD
Sbjct  84   LLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLRELGES-AHEAPVLPTDGLPDDFD  142

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD+GAV  VK+QGSCGSCWSF
Sbjct  143  WRDHGAVGPVKNQGSCGSCWSF  164



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 110/142 (77%), Gaps = 7/142 (5%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ++D +IRQVV D E+D LLNA+HHFT FKSK+ KSYAT+EEHDYR  VFK+NL +AK HQ
Sbjct  25   NDDFIIRQVV-DNEEDHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKSNLIKAKLHQ  83

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
              DP+A HG+TKFSDLT  EFRR F         K++L+LPA A  A ILPT++LP DFD
Sbjct  84   NRDPTAEHGITKFSDLTASEFRRQF------LGLKKRLRLPAHAQKAPILPTTNLPEDFD  137

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VKDQGSCGSCW+F
Sbjct  138  WREKGAVTPVKDQGSCGSCWAF  159



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 108/141 (77%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV D  +D +LNA+HHFT FKSK+ K+YAT+EEHDYR  VFK+NL +AK HQ 
Sbjct  29   DDLLIRQVV-DTAEDHILNAEHHFTSFKSKFSKNYATKEEHDYRFGVFKSNLIKAKLHQK  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HG+TKFSDLT  EFRR F          ++L+LPA A  A ILPT++LP DFDW
Sbjct  88   LDPSAQHGITKFSDLTASEFRRQF------LGLNKRLRLPAHAQKAPILPTNNLPEDFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VKDQGSCGSCW+F
Sbjct  142  REKGAVTPVKDQGSCGSCWAF  162



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = +1

Query  109  IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  288
            I+QVV +  D+ LLN DH FTLFKSKY K+Y  Q EHD+R  VFKAN+RRA+RHQ LDPS
Sbjct  30   IKQVVREENDEQLLNLDHQFTLFKSKYEKTYKNQVEHDHRFRVFKANVRRARRHQQLDPS  89

Query  289  AVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYG  468
            AVHGVT+FSD+TPKEF R +         KR+  LP D   A ILPTS+LP+DFDWR+ G
Sbjct  90   AVHGVTQFSDVTPKEFSRKY------LGLKRRFSLPNDTQKAAILPTSELPTDFDWREKG  143

Query  469  AVTGVKDQGSCGSCWSF  519
            AVT VK+QG CGSCWSF
Sbjct  144  AVTPVKNQGLCGSCWSF  160



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 106/138 (77%), Gaps = 9/138 (7%)
 Frame = +1

Query  106  LIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDP  285
            +IRQV S  +D   LNA+ HF  FK+++ K+YAT EEHDYR +VFKANLRRAKRHQLLDP
Sbjct  34   MIRQVESHVDD--FLNAERHFEKFKARFQKTYATPEEHDYRFNVFKANLRRAKRHQLLDP  91

Query  286  SAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDY  465
            SAVHGVT+FSDLTP EFRR +        G   L+ PADA  A ILPT +LP+DFDWR+ 
Sbjct  92   SAVHGVTQFSDLTPAEFRRDY-------LGLNPLRFPADAQQAPILPTDNLPTDFDWREN  144

Query  466  GAVTGVKDQGSCGSCWSF  519
            GAVT VK+QG+CGSCWSF
Sbjct  145  GAVTPVKNQGNCGSCWSF  162



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 107/143 (75%), Gaps = 9/143 (6%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
             +E+PLI QVV  G  D  L A+HHF  FK ++GK+Y +++EHDYR  VFKAN+RRA+RH
Sbjct  27   GNEEPLIMQVVDGG--DVRLGAEHHFLEFKRRFGKAYDSEDEHDYRYKVFKANMRRARRH  84

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSA HGVT+FSDLTP EFR           G R ++LP DA+ A ILPT +LPSDF
Sbjct  85   QSLDPSAAHGVTRFSDLTPSEFRNKV-------LGLRGVRLPLDANKAPILPTDNLPSDF  137

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVT VK+QGSCGSCWSF
Sbjct  138  DWRDHGAVTPVKNQGSCGSCWSF  160



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 107/143 (75%), Gaps = 9/143 (6%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
             +E+PLI QVV  G  D  L A+HHF  FK ++GK+Y +++EHDYR  VFKAN+RRA+RH
Sbjct  27   GNEEPLIMQVVDGG--DVRLGAEHHFLEFKRRFGKAYDSEDEHDYRYKVFKANMRRARRH  84

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSA HGVT+FSDLTP EFR           G R ++LP DA+ A ILPT +LPSDF
Sbjct  85   QSLDPSAAHGVTRFSDLTPSEFRNKV-------LGLRGVRLPLDANKAPILPTDNLPSDF  137

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVT VK+QGSCGSCWSF
Sbjct  138  DWRDHGAVTPVKNQGSCGSCWSF  160



>gb|KJB79049.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
 gb|KJB79051.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=211

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 105/142 (74%), Gaps = 9/142 (6%)
 Frame = +1

Query  100  DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            DPLI QV    +G +  LL A+HHF+LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA HGVT+FSDLTP EFR+ +        G R+L+LP DA  A ILPT +LP DFD
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAY-------LGLRRLRLPKDATEAPILPTDNLPQDFD  146

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VK+QGSCGSCWSF
Sbjct  147  WREKGAVTPVKNQGSCGSCWSF  168



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 105/141 (74%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            ED LIRQVV D     +L+++ HF+LFK K+GK Y ++EEHDYR SVF+ANL RAKRHQ 
Sbjct  28   EDILIRQVV-DETKPKVLSSEDHFSLFKRKFGKVYGSREEHDYRFSVFRANLLRAKRHQK  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HGVT+FSDLTP EFRR F         K   KLP DA+ A ILPT  LP DFDW
Sbjct  87   LDPSAQHGVTQFSDLTPSEFRRRF------LGVKGGFKLPKDANQAPILPTDKLPEDFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QGSCGSCWSF
Sbjct  141  RDHGAVTPVKNQGSCGSCWSF  161



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 104/138 (75%), Gaps = 7/138 (5%)
 Frame = +1

Query  106  LIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDP  285
            +IRQVV DG +  +L ++ HF+LFK K+GK Y + EEHDYRLSVFKANLRRAKRHQ LDP
Sbjct  31   VIRQVV-DGSEPKILTSEDHFSLFKKKFGKVYVSNEEHDYRLSVFKANLRRAKRHQKLDP  89

Query  286  SAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDY  465
            SA+HGVT+FSDLT  EFR+           +   KLP DA+ A ILP  +LP DFDWRD+
Sbjct  90   SAIHGVTQFSDLTRSEFRKMH------LGVRSGFKLPKDANKAPILPVENLPEDFDWRDH  143

Query  466  GAVTGVKDQGSCGSCWSF  519
            GAVT VK+QGSCGSCWSF
Sbjct  144  GAVTPVKNQGSCGSCWSF  161



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 110/151 (73%), Gaps = 15/151 (10%)
 Frame = +1

Query  94   DEDPLIRQVVSDGE---------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
            D D LIRQV   G+         ++ LL A+HHF+LFK K+ K+YA+QEEHD R ++FKA
Sbjct  27   DVDQLIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDRRFTIFKA  86

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            NLRRA R Q LDPSA HGVT+FSDLTP EFRRT+         +RKL+LP DA  A ILP
Sbjct  87   NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTY------LGLRRKLRLPKDADQAPILP  140

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            T+DLP+DFDWR+ GAV  VKDQGSCGSCWSF
Sbjct  141  TNDLPADFDWREKGAVGPVKDQGSCGSCWSF  171



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 110/141 (78%), Gaps = 5/141 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDP+IRQV SD   ++LL A+ HF+LFK K+GK Y+ + EH+YR SVFKAN+ RA+RHQ+
Sbjct  27   EDPIIRQVTSDDAGNSLLGAEGHFSLFKRKFGKEYSNEAEHNYRFSVFKANMARARRHQI  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHGVT+FSDLT +EF+  +LG++      +     ++   A ILPT+DLP+DFDW
Sbjct  87   LDPTAVHGVTQFSDLTEEEFQERYLGLKGKLDFLK-----SNLPEAPILPTNDLPADFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT +K+QGSCGSCWSF
Sbjct  142  RDHGAVTPIKNQGSCGSCWSF  162



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 11/140 (8%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            DP+I QVV    DD  L A+HHF  FK ++GK YAT+EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPMICQVV----DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQLL  82

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVT+FSDLTP EFR +         G R + LP+DA +A ILPT +LP DFDWR
Sbjct  83   DPSAVHGVTRFSDLTPMEFRHSV-------LGLRGVGLPSDADSAPILPTDNLPKDFDWR  135

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            ++GAVT VK+QGSCGSCWSF
Sbjct  136  EHGAVTPVKNQGSCGSCWSF  155



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 11/140 (8%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            DP+I QVV    DD  L A+HHF  FK ++GK YAT+EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPMICQVV----DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQLL  82

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVT+FSDLTP EFR +         G R + LP+DA +A ILPT +LP DFDWR
Sbjct  83   DPSAVHGVTRFSDLTPMEFRHSV-------LGLRGVGLPSDADSAPILPTDNLPKDFDWR  135

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            ++GAVT VK+QGSCGSCWSF
Sbjct  136  EHGAVTPVKNQGSCGSCWSF  155



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 105/144 (73%), Gaps = 2/144 (1%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
             DEDPLIRQVV   + DD  L    HFT F  ++GK+Y   EEH +RLSVFKANLRRA+R
Sbjct  27   GDEDPLIRQVVGGADGDDNDLELSSHFTSFVQRFGKTYKDAEEHAHRLSVFKANLRRARR  86

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQLLDPSA HG+TKFSDLTP EFRRTFLG++ S     +      AH A +LPT  LP D
Sbjct  87   HQLLDPSAEHGITKFSDLTPAEFRRTFLGLKTSRRSFLREIG-GSAHDAPVLPTDGLPDD  145

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWRD+GAV  VK+QGSCGSCWSF
Sbjct  146  FDWRDHGAVGPVKNQGSCGSCWSF  169



>gb|KJB79050.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=285

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 105/142 (74%), Gaps = 9/142 (6%)
 Frame = +1

Query  100  DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            DPLI QV    +G +  LL A+HHF+LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA HGVT+FSDLTP EFR+ +        G R+L+LP DA  A ILPT +LP DFD
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAY-------LGLRRLRLPKDATEAPILPTDNLPQDFD  146

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VK+QGSCGSCWSF
Sbjct  147  WREKGAVTPVKNQGSCGSCWSF  168



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 109/146 (75%), Gaps = 14/146 (10%)
 Frame = +1

Query  100  DPLIRQVV-SDGED-----DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            DPLIRQVV  DGE      DAL  A+HHF+ FK KYGKSYA++EEHDYR  VFKANLRRA
Sbjct  91   DPLIRQVVDGDGESHHHHHDAL-GAEHHFSFFKHKYGKSYASKEEHDYRFDVFKANLRRA  149

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
              HQ LDPSA HG+T+FSD+ P EFR++         G R LKLPADA  A ILPT +LP
Sbjct  150  ACHQRLDPSAQHGMTRFSDMIPAEFRKS-------QLGLRGLKLPADATEAPILPTENLP  202

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
             DFDWR++GAVT VK+QGSCGSCWSF
Sbjct  203  EDFDWREHGAVTAVKNQGSCGSCWSF  228



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 108/141 (77%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D +IRQVV DG +  +L+++ HF+LFK K+GK YA+ EEHDYRLSVFKANLRRA+RHQ 
Sbjct  34   DDLVIRQVV-DGAEPKVLSSEDHFSLFKRKFGKVYASSEEHDYRLSVFKANLRRARRHQK  92

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HGVT+FSDLT  EFR+      K    +   KLP DA+ A ILPT +LP DFDW
Sbjct  93   LDPSARHGVTQFSDLTRSEFRK------KHLGVRGGFKLPKDANKAPILPTENLPEDFDW  146

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QGSCGSCWSF
Sbjct  147  RDRGAVTPVKNQGSCGSCWSF  167



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 116/146 (79%), Gaps = 13/146 (9%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDA-----LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  261
            EDPLIRQV +DG+D++     LL A+HHF+LFK K+ K+YA+QEEHDYR  +FK+NLRRA
Sbjct  31   EDPLIRQV-TDGQDESSANPNLLGAEHHFSLFKKKFKKTYASQEEHDYRFKIFKSNLRRA  89

Query  262  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLP  441
            +RHQ LDP+A HGVT+FSDLT  EFRR F        G R+L+LP DA+ A +LPT+DLP
Sbjct  90   ERHQKLDPTATHGVTQFSDLTHSEFRRQF-------LGLRRLRLPKDANEAPMLPTNDLP  142

Query  442  SDFDWRDYGAVTGVKDQGSCGSCWSF  519
            +DFDWR+ GAVT VK+QGSCGSCWSF
Sbjct  143  ADFDWREKGAVTAVKNQGSCGSCWSF  168



>gb|KJB79048.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=263

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 105/142 (74%), Gaps = 9/142 (6%)
 Frame = +1

Query  100  DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            DPLI QV    +G +  LL A+HHF+LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA HGVT+FSDLTP EFR+ +        G R+L+LP DA  A ILPT +LP DFD
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAY-------LGLRRLRLPKDATEAPILPTDNLPQDFD  146

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VK+QGSCGSCWSF
Sbjct  147  WREKGAVTPVKNQGSCGSCWSF  168



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 107/147 (73%), Gaps = 14/147 (10%)
 Frame = +1

Query  100  DPLIRQVV-SDGED------DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            DPLIRQVV  DGE          L A+HHF+ FK KYGKSYA++EEHDYR  VFKANLRR
Sbjct  91   DPLIRQVVDGDGESHXXXXXXXALGAEHHFSFFKHKYGKSYASKEEHDYRFDVFKANLRR  150

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            A  HQ LDPSA HG+T+FSD+ P EFR++         G R LKLPADA  A ILPT +L
Sbjct  151  AACHQRLDPSAQHGMTRFSDMIPAEFRKS-------QLGLRGLKLPADATEAPILPTENL  203

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P DFDWR++GAVT VK+QGSCGSCWSF
Sbjct  204  PEDFDWREHGAVTAVKNQGSCGSCWSF  230



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   173 bits (438),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 102/137 (74%), Gaps = 6/137 (4%)
 Frame = +1

Query  109  IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  288
            I+QVV +  D+ LLN DH FT FKSKY K+Y  Q EHD+R  VFKAN+RRA+RHQ LDPS
Sbjct  32   IKQVVREENDEQLLNLDHQFTQFKSKYEKTYKNQVEHDHRFRVFKANVRRARRHQQLDPS  91

Query  289  AVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYG  468
            AVHGVT+FSD+TPKEF R +         KR+  LP D   A ILPTS+LP+DFDWR+ G
Sbjct  92   AVHGVTQFSDVTPKEFSRKY------LGLKRRFSLPNDTQKAAILPTSELPTDFDWREKG  145

Query  469  AVTGVKDQGSCGSCWSF  519
            AVT VK+QG CGSCWSF
Sbjct  146  AVTPVKNQGLCGSCWSF  162



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D +IRQVV    +  +L+++ HF+LFKSK+GK YA+ EEHDYR SVFKANLRRA+RHQ 
Sbjct  27   DDAVIRQVVDGAAEPNVLSSEDHFSLFKSKFGKVYASGEEHDYRFSVFKANLRRARRHQK  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSA HGVT+FSDLT  EFR            K   KLP DA+ A ILPT +LP DFDW
Sbjct  87   MDPSARHGVTQFSDLTRSEFREKH------LGVKGGFKLPKDANKAPILPTENLPEDFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QGSCGSCWSF
Sbjct  141  RDHGAVTPVKNQGSCGSCWSF  161



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 115/151 (76%), Gaps = 13/151 (9%)
 Frame = +1

Query  85   VRADE--DPLIRQVVSDGEDDALLN----ADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
            V +DE  D LIRQVV+  +D    +    A+HHF+ FK ++GK+Y + +EHD R  VFKA
Sbjct  25   VSSDESDDLLIRQVVAGADDHDNDDLLLNAEHHFSSFKKRFGKAYTSCDEHDRRFGVFKA  84

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            NLRRAKR+Q+LDPSAVHGVT+F DLTP EFRRT+        G ++L+LPAD H A ILP
Sbjct  85   NLRRAKRNQILDPSAVHGVTQFFDLTPAEFRRTY-------LGLKRLRLPADTHEAPILP  137

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            T+DLP+DFDWRD+GAVT VK+QGSCGSCWSF
Sbjct  138  TNDLPADFDWRDHGAVTPVKNQGSCGSCWSF  168



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 11/140 (8%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            DP+I QVV    DD  L A+HHF  FK ++GK YAT+EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPMICQVV----DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQLL  82

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVT+FSDLTP EF+ +         G R + LP+DA +A ILPT +LP DFDWR
Sbjct  83   DPSAVHGVTQFSDLTPMEFQHSV-------LGLRGVGLPSDADSAPILPTDNLPKDFDWR  135

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            ++GAVT VK+QGSCGSCWSF
Sbjct  136  EHGAVTPVKNQGSCGSCWSF  155



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V   +D +IRQVV  G +  +L ++ HF+LFK K+GK YA+ EEHDYR SVFKANLRRA+
Sbjct  25   VNDGDDLVIRQVVG-GAEPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRAR  83

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDPSA HGVT+FSDLT  EFR+      K    +   KLP DA+ A ILPT +LP 
Sbjct  84   RHQKLDPSATHGVTQFSDLTRSEFRK------KHLGVRSGFKLPKDANKAPILPTENLPE  137

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD+GAVT VK+QGSCGSCWSF
Sbjct  138  DFDWRDHGAVTPVKNQGSCGSCWSF  162



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V   +D +IRQVV  G +  +L ++ HF+LFK K+GK YA+ EEHDYR SVFKANLRRA+
Sbjct  25   VNDGDDLVIRQVVG-GAEPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRAR  83

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDPSA HGVT+FSDLT  EFR+      K    +   KLP DA+ A ILPT +LP 
Sbjct  84   RHQKLDPSATHGVTQFSDLTRSEFRK------KHLGVRSGFKLPKDANKAPILPTENLPE  137

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD+GAVT VK+QGSCGSCWSF
Sbjct  138  DFDWRDHGAVTPVKNQGSCGSCWSF  162



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V   +D +IRQVV  G +  +L ++ HF+LFKSK+GK YA+ EEHDYR SVFKANLRRA+
Sbjct  25   VNDGDDLVIRQVVG-GAEPQVLTSEDHFSLFKSKFGKVYASNEEHDYRFSVFKANLRRAR  83

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDPSA HGVT+FSDLT  EFR+      K    +   KLP DA+ A ILPT +LP 
Sbjct  84   RHQKLDPSARHGVTQFSDLTRSEFRK------KHLGVRAGFKLPKDANKAPILPTENLPE  137

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWRD GAVT VK+QGSCGSCWSF
Sbjct  138  DFDWRDRGAVTPVKNQGSCGSCWSF  162



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 104/142 (73%), Gaps = 9/142 (6%)
 Frame = +1

Query  100  DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            DPLI QV    +G +  LL A HHF+LFK ++ KSY +QEEHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAKHHFSLFKKRFKKSYGSQEEHDYRFKIFQVNLRRAARHQ  93

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA HGVT+FSDLTP EFR+ +        G R+L+LP DA  A ILPT +LP DFD
Sbjct  94   KLDPSATHGVTQFSDLTPGEFRKAY-------LGLRRLRLPKDATEAPILPTDNLPQDFD  146

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VK+QGSCGSCWSF
Sbjct  147  WREKGAVTPVKNQGSCGSCWSF  168



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 106/143 (74%), Gaps = 9/143 (6%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
             D++PLI QVV        L A+HHF  FK ++GK+YA+QEEH+YR  VFKAN+RRA+RH
Sbjct  25   GDDEPLIMQVVEG--SGVRLGAEHHFLDFKRRFGKAYASQEEHNYRFEVFKANMRRARRH  82

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSA HGVT+FSDLT  EFR           G R ++LP++A+ A ILPT +LPSDF
Sbjct  83   QSLDPSAAHGVTRFSDLTASEFRNKV-------LGLRGVRLPSNANKAPILPTDNLPSDF  135

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD+GAVT VK+QGSCGSCWSF
Sbjct  136  DWRDHGAVTPVKNQGSCGSCWSF  158



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 105/140 (75%), Gaps = 11/140 (8%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            DP+I QVV    DD  L A+HHF  FK ++GK YAT+EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPMICQVV----DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQLL  82

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVT+FSDLTP EF+ +         G R + LP+DA +A ILPT +LP DFDWR
Sbjct  83   DPSAVHGVTQFSDLTPMEFQHSV-------LGLRGVGLPSDADSAPILPTDNLPKDFDWR  135

Query  460  DYGAVTGVKDQGSCGSCWSF  519
             +GAVT VK+QGSCGSCWSF
Sbjct  136  GHGAVTPVKNQGSCGSCWSF  155



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 105/142 (74%), Gaps = 9/142 (6%)
 Frame = +1

Query  100  DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            DPLI QV    +G +  LL A+HHF+LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA HGVT+FSDLTP EFR+ +        G R+L+LP DA  A ILPT +LP DFD
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAY-------LGLRRLRLPKDATEAPILPTDNLPQDFD  146

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VK+QGSCGSCWSF
Sbjct  147  WREKGAVTPVKNQGSCGSCWSF  168



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 110/151 (73%), Gaps = 13/151 (9%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDA------LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
            V ++ DPLIRQV +D  DD       L  A+HHF+LFK+++ KSY ++ EHDYR  VF++
Sbjct  29   VASEVDPLIRQV-TDVHDDGTEPQQLLTAAEHHFSLFKARFNKSYGSKAEHDYRFKVFRS  87

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            NLRRA RHQ LDPSA HGVT+FSDLTP EFR+ F          R+L+LP DA+ A ILP
Sbjct  88   NLRRAARHQKLDPSATHGVTQFSDLTPGEFRKRF------LGLNRRLRLPKDANQAPILP  141

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            T +LP DFDWR+ GAVT VK+QG+CGSCWSF
Sbjct  142  TDNLPEDFDWREKGAVTAVKNQGTCGSCWSF  172



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   170 bits (431),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 104/141 (74%), Gaps = 6/141 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D +IRQVV    +  +L ++ HF+LFK K+GK YA+ EEHDYR SVFKANLRRA+RHQ 
Sbjct  27   DDAVIRQVVDGAAEPNVLTSEDHFSLFKRKFGKVYASGEEHDYRFSVFKANLRRARRHQK  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSA HGVT+FSDLT  EFR       K    K   KLP DA+ A ILPT +LP DFDW
Sbjct  87   MDPSARHGVTQFSDLTRSEFRE------KHLGVKGGFKLPKDANKAPILPTENLPEDFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD+GAVT VK+QGSCGSCWSF
Sbjct  141  RDHGAVTPVKNQGSCGSCWSF  161



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   170 bits (430),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 108/142 (76%), Gaps = 11/142 (8%)
 Frame = +1

Query  94   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ++D LIRQV +D EDD LLNA+HHFT FKSK+ KSYAT+EEHDYR  VFK+NL++AK HQ
Sbjct  24   NDDFLIRQV-TDHEDDQLLNAEHHFTTFKSKFSKSYATKEEHDYRFGVFKSNLKKAKLHQ  82

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA HGVTKFSDLT  EFRR F         K++L+LPA A  A ILPT++LP DFD
Sbjct  83   KLDPSAEHGVTKFSDLTASEFRRQF------LGLKKRLRLPAHAQKAPILPTNNLPEDFD  136

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT     GSCGSCW+F
Sbjct  137  WREKGAVT----PGSCGSCWAF  154



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 105/142 (74%), Gaps = 9/142 (6%)
 Frame = +1

Query  100  DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            DPLI QV    +G +  LL A+HH++LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHYSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSA HGVT+FSDLTP EFR+ +        G R+L+LP DA  A ILPT +LP DFD
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAY-------LGLRRLRLPKDATEAPILPTDNLPQDFD  146

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VK+QGSCGSCWSF
Sbjct  147  WREKGAVTPVKNQGSCGSCWSF  168



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 107/141 (76%), Gaps = 6/141 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D +I+QVV  G D  +L+++ HF+LFK K+GK YA++EEHDYR SVFK+NLRRA+RHQ 
Sbjct  28   DDLVIKQVVDGGADPNVLSSEDHFSLFKKKFGKVYASREEHDYRFSVFKSNLRRARRHQK  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HGVT+FSDLT  EF+R      K    K   KLP DA+ A ILPT +LP +FDW
Sbjct  88   LDPSARHGVTQFSDLTRSEFKR------KHLGVKGGFKLPKDANKAPILPTENLPVEFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VK+QGSCGSCWSF
Sbjct  142  RERGAVTPVKNQGSCGSCWSF  162



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V   +D +IRQVV   + + L +ADH F+LFK K+GK YA+ EEHDYR SVFKANLR+A+
Sbjct  25   VNDGDDLVIRQVVGGADSEVLSSADH-FSLFKKKFGKVYASNEEHDYRFSVFKANLRQAR  83

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDPSA HGVT+FSDLT  EFR+      K    K   KLP DA+ A ILPT +LP 
Sbjct  84   RHQKLDPSARHGVTQFSDLTRSEFRK------KHLGVKGGFKLPKDANKAPILPTENLPE  137

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            +FDWRD+GAVT VK+QGSCGSCWSF
Sbjct  138  EFDWRDHGAVTPVKNQGSCGSCWSF  162



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 11/140 (8%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
            DPLIRQVV DGE    L A+HHF  FK ++GK Y ++EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPLIRQVV-DGEG---LGAEHHFLEFKRRFGKVYVSEEEHGYRFNVFKSNMHRARRHQLL  82

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DPSAVHGVT+FSDLTP EFR +         G R + LP+DA +A IL T +LP DFDWR
Sbjct  83   DPSAVHGVTRFSDLTPMEFRHSV-------LGLRGVGLPSDADSAPILRTDNLPKDFDWR  135

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            ++GAVT VK+QGSCG+CWSF
Sbjct  136  EHGAVTPVKNQGSCGACWSF  155



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 104/145 (72%), Gaps = 7/145 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +  DED LIRQVV + E   +L+++ HFTLFK K+GK Y + EEH YR SVFKANLRRA 
Sbjct  21   ICGDEDLLIRQVVDEAEPK-VLSSEDHFTLFKKKFGKDYGSIEEHYYRFSVFKANLRRAM  79

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ +DPSA HGVT+FSDLT  EFRR      K        KLP DA+ A ILPT +LP 
Sbjct  80   RHQKMDPSARHGVTQFSDLTGSEFRR------KHLGVTGGFKLPKDANQAPILPTHNLPE  133

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            +FDWRD GAVT VK+QGSCGSCWSF
Sbjct  134  EFDWRDRGAVTPVKNQGSCGSCWSF  158



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 107/141 (76%), Gaps = 9/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV + +   +L+++ HF+LFK K+GK YA+ EEHDYRLSVFKANLRRA+RHQ 
Sbjct  31   DDLLIRQVVDEAK---VLSSEDHFSLFKKKFGKVYASNEEHDYRLSVFKANLRRARRHQK  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HGVT+FSDLT  EFR+      K    K   KLP DA+ A ILPT +LP +FDW
Sbjct  88   LDPSARHGVTQFSDLTRAEFRK------KHLGVKGGFKLPKDANKAPILPTENLPEEFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QGSCGSCWSF
Sbjct  142  RDRGAVTPVKNQGSCGSCWSF  162



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 107/141 (76%), Gaps = 6/141 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D +I+QVV  G +  +L+++ HF+LFK K+GK YA++EEHDYR SVFK+NLRRA+RHQ 
Sbjct  28   DDLVIKQVVDGGAEPNVLSSEDHFSLFKKKFGKVYASREEHDYRFSVFKSNLRRARRHQK  87

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HGVT+FSDLT  EF+R      K    K   KLP DA+ A ILPT +LP +FDW
Sbjct  88   LDPSARHGVTQFSDLTRSEFKR------KHLGVKGGFKLPKDANKAPILPTENLPEEFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT VK+QGSCGSCWSF
Sbjct  142  RERGAVTPVKNQGSCGSCWSF  162



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 111/145 (77%), Gaps = 12/145 (8%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +D LIRQVV +G+D++   LL A+ HHF+LFK K+ KSY +QEEHDYR SVFK+NLRRA 
Sbjct  27   DDSLIRQVV-EGQDESSSNLLTAEQHHFSLFKRKFKKSYLSQEEHDYRFSVFKSNLRRAA  85

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDP+A HGVT+FSDLT  EFR+          G RKL+LP DA+ A ILPT+DLP 
Sbjct  86   RHQKLDPTASHGVTQFSDLTSAEFRKQV-------LGLRKLRLPKDANTAPILPTNDLPE  138

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWR+ GAV  VK+QGSCGSCWSF
Sbjct  139  DFDWREKGAVGPVKNQGSCGSCWSF  163



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 111/145 (77%), Gaps = 12/145 (8%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +D LIRQVV +G+D++   LL A+ HHF+LFK K+ KSY +QEEHDYR SVFK+NLRRA 
Sbjct  27   DDSLIRQVV-EGQDESSSNLLTAEQHHFSLFKRKFKKSYLSQEEHDYRFSVFKSNLRRAA  85

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDP+A HGVT+FSDLT  EFR+          G RKL+LP DA+ A ILPT+DLP 
Sbjct  86   RHQKLDPTASHGVTQFSDLTSAEFRKQV-------LGLRKLRLPKDANTAPILPTNDLPE  138

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWR+ GAV  VK+QGSCGSCWSF
Sbjct  139  DFDWREKGAVGPVKNQGSCGSCWSF  163



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 107/141 (76%), Gaps = 9/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV + +   +L+++ HF+LFK K+GK YA+ EEHDYRLSVFKANLRRA+RHQ 
Sbjct  30   DDLLIRQVVDEAK---VLSSEDHFSLFKKKFGKVYASNEEHDYRLSVFKANLRRARRHQK  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HGVT+FSDLT  EF++      K    K   KLP DA+ A ILPT +LP +FDW
Sbjct  87   LDPSARHGVTQFSDLTRAEFKK------KHLGVKGGFKLPKDANKAPILPTENLPEEFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QGSCGSCWSF
Sbjct  141  RDRGAVTPVKNQGSCGSCWSF  161



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 107/141 (76%), Gaps = 9/141 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D +IRQVV + +   +L+++ HF+LFK K+GK YA+ EEHDYRLSVFKANLRRA+RHQ 
Sbjct  30   DDLVIRQVVDEAK---VLSSEDHFSLFKKKFGKVYASNEEHDYRLSVFKANLRRARRHQK  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDPSA HGVT+FSDLT  EFR+      K    K   KLP DA+ A ILPT +LP +FDW
Sbjct  87   LDPSARHGVTQFSDLTRAEFRK------KHLGVKGGFKLPKDANKAPILPTENLPEEFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QGSCGSCWSF
Sbjct  141  RDRGAVTPVKNQGSCGSCWSF  161



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   168 bits (425),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 6/143 (4%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
              +D +I+QVV  G +  +L+++ HF+LFK K+GK YA+ EEHDYR SVFK NLRRA+RH
Sbjct  27   GGDDLVIKQVVDGGAEPNVLSSEDHFSLFKKKFGKVYASSEEHDYRFSVFKTNLRRARRH  86

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDPSA HGVT+FSDLT  EF++      K    +   KLP DA+ A ILPT +LP +F
Sbjct  87   QKLDPSARHGVTQFSDLTRSEFKK------KHLGVRGGFKLPKDANKAPILPTENLPEEF  140

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD GAVT VK+QGSCGSCWSF
Sbjct  141  DWRDRGAVTPVKNQGSCGSCWSF  163



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 105/143 (73%), Gaps = 7/143 (5%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            AD DPLI QVV D + +  L+A+ HF  F  ++GK+YA +EE   R  VFKANL RA R+
Sbjct  28   ADGDPLILQVVDDEKGELALSAEAHFASFVRRFGKTYADEEERALRFKVFKANLHRAARY  87

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            Q LDP+A+HGVTKFSDL+P EFRR +LG+R+  + K         H A ILPT DLP+DF
Sbjct  88   QRLDPTAIHGVTKFSDLSPAEFRRAYLGLRRPEAHK-------STHEAPILPTDDLPTDF  140

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRDYGAVTGVK+QGSCGSCWSF
Sbjct  141  DWRDYGAVTGVKNQGSCGSCWSF  163



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = +1

Query  115  QVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAV  294
            QVV  G  D  L A+HHF  FK ++GK+YA+QEEH+YR  VFKAN+RRA+RHQ LDPSA 
Sbjct  2    QVVDGG--DVRLGAEHHFLDFKRRFGKAYASQEEHNYRFEVFKANMRRARRHQSLDPSAA  59

Query  295  HGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYGAV  474
            HGVT+FSDLT  EFR           G R ++LP++A+ A ILPT +LPSDFDWRD+GAV
Sbjct  60   HGVTRFSDLTASEFRNKV-------LGLRGVRLPSNANKAPILPTDNLPSDFDWRDHGAV  112

Query  475  TGVKDQGSCGSCWSF  519
            T VK+QGSCGSCWSF
Sbjct  113  TPVKNQGSCGSCWSF  127



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
             DE+PLIRQVV   +  D  L  D  F  F  ++GK+Y   EEH +RLSVFKANLRRA+R
Sbjct  27   GDEEPLIRQVVGGADPLDNDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARR  86

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQLLDPSA HGVTKFSDLTP EFRRT+LG++ +     +      AH A +LPT  LP D
Sbjct  87   HQLLDPSAEHGVTKFSDLTPAEFRRTYLGLKTTRRSFLREMA-GSAHDAPVLPTDGLPED  145

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWRD+GAV  VK+QGSCGSCWSF
Sbjct  146  FDWRDHGAVGPVKNQGSCGSCWSF  169



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 108/145 (74%), Gaps = 12/145 (8%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDA----LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +D LIRQVV +G+D++    L    HHF+LFK K+ KSY +Q+EHDYR SVFK+NLRRA 
Sbjct  27   DDSLIRQVV-EGQDESSSNLLTGEQHHFSLFKRKFKKSYLSQQEHDYRFSVFKSNLRRAA  85

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDP+A HGVT+FSDLT  EFR+          G RKL+LP DA+ A ILPT+DLP 
Sbjct  86   RHQKLDPTASHGVTQFSDLTAAEFRKQV-------LGLRKLRLPKDANKAPILPTNDLPE  138

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWR+ GAV  VK+QGSCGSCWSF
Sbjct  139  DFDWREKGAVGPVKNQGSCGSCWSF  163



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 104/145 (72%), Gaps = 7/145 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V  DED LIRQVV + E   +L+++ HFTLFK K+GK Y + EEH YR SVFKANL RA 
Sbjct  22   VCGDEDVLIRQVVDETEPK-VLSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAM  80

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ +DPSA HGVT+FSDLT  EFRR      K    K   KLP DA+ A ILPT +LP 
Sbjct  81   RHQKMDPSARHGVTQFSDLTRSEFRR------KHLGVKGGFKLPKDANQAPILPTQNLPE  134

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            +FDWRD GAVT VK+QGSCGSCWSF
Sbjct  135  EFDWRDRGAVTPVKNQGSCGSCWSF  159



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 104/145 (72%), Gaps = 7/145 (5%)
 Frame = +1

Query  85   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            V  DED LIRQVV + E   +L+++ HFTLFK K+GK Y + EEH YR SVFKANL RA 
Sbjct  22   VCGDEDVLIRQVVDETEPK-VLSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAM  80

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ +DPSA HGVT+FSDLT  EFRR      K    K   KLP DA+ A ILPT +LP 
Sbjct  81   RHQKMDPSARHGVTQFSDLTRSEFRR------KHLGVKGGFKLPKDANQAPILPTQNLPE  134

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            +FDWRD GAVT VK+QGSCGSCWSF
Sbjct  135  EFDWRDRGAVTPVKNQGSCGSCWSF  159



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 109/147 (74%), Gaps = 6/147 (4%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGE-DDAL---LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            A EDPLI QVV DG  DD L   LNA+ HF  F  ++GKSY    E  +R+SVFKANLRR
Sbjct  36   AAEDPLIEQVVGDGAADDELEMELNAEAHFASFVRRFGKSYRDDGERAHRMSVFKANLRR  95

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            A+RHQ LDP+AVHGVT+FSDLTP EFRR FLG+R+SS+        + AH A ILPT  L
Sbjct  96   ARRHQRLDPTAVHGVTQFSDLTPDEFRRQFLGLRRSSARDLLKG--SSAHQAPILPTDGL  153

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P+DFDWR++GAV  VK+QGSCGSCWSF
Sbjct  154  PTDFDWREHGAVGPVKNQGSCGSCWSF  180



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 110/145 (76%), Gaps = 12/145 (8%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +D LIRQVV +G+D++   LL A+ HH +LFK K+ KSY +QEEHDYR SVFK+NLRRA 
Sbjct  33   DDSLIRQVV-EGQDESSPNLLTAEQHHLSLFKRKFKKSYLSQEEHDYRFSVFKSNLRRAA  91

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
            RHQ LDP+A HGVT+FSDLT  EFR+          G RKL+LP DA+ A ILPT+DLP 
Sbjct  92   RHQKLDPTASHGVTQFSDLTSAEFRKQV-------LGLRKLRLPKDANKAPILPTNDLPE  144

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
            DFDWR+ GAV  VK+QGSCGSCWSF
Sbjct  145  DFDWREKGAVGPVKNQGSCGSCWSF  169



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 106/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  97   EDPLIRQVVS-DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLI QVV  D E++  LNA+ HF  F  ++GKSY   +EH++RLSVF+ANLRRA+RHQ
Sbjct  34   EDPLIEQVVGGDAENELELNAEAHFASFVRRFGKSYRDADEHEHRLSVFRANLRRARRHQ  93

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHG+TKFSDLTP EFR  FLG+RKS     K      AH A  LPT  LP++FD
Sbjct  94   RLDPSAVHGITKFSDLTPDEFRERFLGLRKSRRSFLKGIS-GSAHDAPALPTDGLPTEFD  152

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR++GAV  VKDQGSCGSCWSF
Sbjct  153  WREHGAVGPVKDQGSCGSCWSF  174



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            ED LIRQVV +G +  +L+++ HF+LFK ++GK Y + EEH +R +VF++NL+RA RHQ 
Sbjct  28   EDILIRQVV-NGSEPKVLSSEDHFSLFKRRFGKVYGSLEEHRHRFAVFRSNLQRAMRHQK  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSA HGVT+FSDLTP EFRR           +   KLP DA+ A ILPT DLP DFDW
Sbjct  87   MDPSARHGVTQFSDLTPSEFRRM------HLGVRGGFKLPKDANQAPILPTKDLPEDFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QGSCGSCWSF
Sbjct  141  RDRGAVTPVKNQGSCGSCWSF  161



>emb|CDP08018.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 102/145 (70%), Gaps = 6/145 (4%)
 Frame = +1

Query  97   EDPLIRQVVS-DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ED   RQVV  D + D LLNADHHF+LFK KYGK+Y+TQEE DYR SVFKANL RAKRHQ
Sbjct  35   EDLSFRQVVPLDDDVDPLLNADHHFSLFKKKYGKTYSTQEEDDYRFSVFKANLHRAKRHQ  94

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD--  447
            LLDPSAVHG+TKFSDLTP EF++           +  +   A+ + A ILPT DLPS   
Sbjct  95   LLDPSAVHGITKFSDLTPSEFQQRLHLGHHKQKRRLSVS--AEPNEAPILPTRDLPSPGS  152

Query  448  -FDWRDYGAVTGVKDQGSCGSCWSF  519
              D+R +G VT VKD+GSC S W+F
Sbjct  153  ALDYRQWGVVTPVKDEGSCRSSWAF  177



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 105/142 (74%), Gaps = 2/142 (1%)
 Frame = +1

Query  97   EDPLIRQVVS-DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLI QVV  D E++  LNA+ HF  F  ++GKSY   +EH +RLSVF+ANLRRA+RHQ
Sbjct  31   EDPLIEQVVGGDAENELELNAEAHFATFVRRFGKSYRDADEHAHRLSVFRANLRRARRHQ  90

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHG+TKFSDLTP EFR  FLG+RKS     K      AH A  LPT  LP++FD
Sbjct  91   RLDPSAVHGITKFSDLTPDEFRERFLGLRKSRRSFLKGIS-GSAHDAPALPTDGLPTEFD  149

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR++GAV  VKDQGSCGSCWSF
Sbjct  150  WREHGAVGPVKDQGSCGSCWSF  171



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            ED LIRQVV +G +  +L+++ HF+LFK ++GK Y + EEH +R +VF++NL+RA RHQ 
Sbjct  28   EDILIRQVV-NGSEPKVLSSEDHFSLFKRRFGKVYGSLEEHRHRFAVFRSNLQRAMRHQK  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSA HGVT+FSDLTP EFRR           +   KLP DA+ A ILPT DLP DFDW
Sbjct  87   MDPSARHGVTQFSDLTPSEFRRM------HLGVRGGFKLPKDANQAPILPTKDLPVDFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QGSCGSCWSF
Sbjct  141  RDRGAVTPVKNQGSCGSCWSF  161



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   165 bits (417),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 105/142 (74%), Gaps = 8/142 (6%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDD-ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLIRQVV D E +   L+A+ HF  F  ++ K+YA  EE   R +VFKANL RA+RHQ
Sbjct  30   EDPLIRQVVQDAEGELTALDAEVHFARFIKRFRKTYADTEERARRFAVFKANLLRARRHQ  89

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
            LLDP+AVHGVTKFSDLTP EFRR +LG+R  +         + +H A ILPT+DLP +FD
Sbjct  90   LLDPTAVHGVTKFSDLTPAEFRRAYLGLRGPTFV-------SSSHDAPILPTNDLPENFD  142

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WRD+GAVT VK+QGSCGSCWSF
Sbjct  143  WRDHGAVTPVKNQGSCGSCWSF  164



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 103/144 (72%), Gaps = 4/144 (3%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
             +EDPLI QVV  GE+ DA L+A+ HF  F+ ++G++Y    E  YR+SVF ANLRRA+R
Sbjct  32   GEEDPLIEQVVGGGEEEDAQLDAEAHFASFERRFGRTYRDAGERAYRMSVFAANLRRARR  91

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQ LDP+A HGVTKFSDLTP EFR  FLG+R+ S        P   H A ILPT  LP D
Sbjct  92   HQRLDPTATHGVTKFSDLTPGEFRDRFLGLRRPSLEGLVGGEP---HEAPILPTDGLPDD  148

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWR++GAV  VKDQGSCGSCWSF
Sbjct  149  FDWREHGAVGPVKDQGSCGSCWSF  172



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
             +E+PLIRQVV   +  D  L  D  F  F  ++GK+Y   EEH +RLSVFKA LRRA+R
Sbjct  19   GEEEPLIRQVVGGADPLDNDLELDSQFLGFVQRFGKTYRDAEEHAHRLSVFKATLRRARR  78

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQLLDPSA HGVTKFSDLTP EFRRTFLG++ +     +      AH A +LPT  LP D
Sbjct  79   HQLLDPSAEHGVTKFSDLTPAEFRRTFLGLKTTRRSFLREMA-GSAHDAPVLPTDGLPED  137

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWRD+GAV  VK+QGSCGSCWSF
Sbjct  138  FDWRDHGAVGPVKNQGSCGSCWSF  161



>ref|XP_010690815.1| PREDICTED: cysteine proteinase RD19a [Beta vulgaris subsp. vulgaris]
Length=403

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 107/147 (73%), Gaps = 15/147 (10%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDAL-LNA------DHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  258
            D +IRQVVS+   DAL LN+        HF+LFK ++ KSYATQEEHDYR +VFKANLRR
Sbjct  63   DEIIRQVVSN---DALSLNSLDLSQPHQHFSLFKKRFNKSYATQEEHDYRFNVFKANLRR  119

Query  259  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDL  438
            AKR+Q LDP+AVHGVT+FSDLT  EFR  F       + K +LK PA A+ A ILPT DL
Sbjct  120  AKRNQELDPTAVHGVTRFSDLTQSEFRNRF-----LGARKSRLKYPAHANKAPILPTDDL  174

Query  439  PSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            P DFDWR+ GAVT  KDQG CGSCW+F
Sbjct  175  PLDFDWRELGAVTPPKDQGGCGSCWAF  201



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
             DE+PLIRQVV   +  D  L  D     F  ++GK+Y   EEH +RLSVFKANLRRA+R
Sbjct  27   GDEEPLIRQVVGGADPLDNDLELDSQLLGFVQRFGKTYRDAEEHAHRLSVFKANLRRARR  86

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQ+LDPSA HGVTKFSDLTP EFRRTFLG++ +     +      AH A +LPT  LP D
Sbjct  87   HQMLDPSAEHGVTKFSDLTPAEFRRTFLGLKTTRRSFLREMA-GSAHDAPVLPTDGLPED  145

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWRD+GAV  VK+QGSC SCWSF
Sbjct  146  FDWRDHGAVGPVKNQGSCWSCWSF  169



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            EDPLI QVV   E + L LNA+ HF  F  ++ KSY   +EH +RLSVF ANLRRA+RHQ
Sbjct  51   EDPLIEQVVGGDEKNELELNAEAHFASFVQRFNKSYRDADEHAHRLSVFTANLRRARRHQ  110

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
             LDPSAVHGVTKFSDLTP EFR  FLG+RK      K      AH A  LPT  LP++FD
Sbjct  111  RLDPSAVHGVTKFSDLTPDEFRDRFLGLRKYRRSFLKGLS-GSAHDAPALPTDGLPTEFD  169

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR++GAV  VKDQGSCGSCWSF
Sbjct  170  WREHGAVGPVKDQGSCGSCWSF  191



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 13/141 (9%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDP+I+QVV  G       A+H F  FK ++GK Y++++EHDYR +VFK+NL RAKRH +
Sbjct  31   EDPIIQQVVDKG------GAEHQFNEFKQRFGKVYSSKDEHDYRFNVFKSNLHRAKRHVI  84

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSA HGVT+FSDLTP+EFR +         G + + LP  A AA IL + +LP DFDW
Sbjct  85   MDPSATHGVTRFSDLTPREFRNSI-------LGLKGVGLPRHAKAAPILSSENLPRDFDW  137

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT V++QG CGS WSF
Sbjct  138  REKGAVTPVRNQGFCGSSWSF  158



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 13/141 (9%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDP+I+QVV  G       A+H F  FK ++GK Y++++EHDYR +VFK+NL RAKRH +
Sbjct  30   EDPIIQQVVDKG------GAEHQFNEFKQRFGKVYSSKDEHDYRFNVFKSNLHRAKRHVI  83

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSA HGVT+FSDLTP+EFR +         G + + LP  A AA IL + +LP DFDW
Sbjct  84   MDPSATHGVTRFSDLTPREFRNSI-------LGLKGVGLPRHAKAAPILSSENLPRDFDW  136

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT V++QG CGS WSF
Sbjct  137  REKGAVTPVRNQGFCGSSWSF  157



>gb|AAN57719.1| cysteine proteinase precursor [Solanum melongena]
Length=120

 Score =   145 bits (366),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  28   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  207
            MDR  LLSLL  AL ++ +  +D+DPLIRQVVS+ +D+ +LNA+HHF+LFKSKYGK YA+
Sbjct  1    MDRLFLLSLLAFALFSSAIAFSDDDPLIRQVVSETDDNHMLNAEHHFSLFKSKYGKIYAS  60

Query  208  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  348
            QEEHD+RL VFKANLRRA+RHQLLDP+A HG+T+FSDLTP EFRRT+
Sbjct  61   QEEHDHRLKVFKANLRRARRHQLLDPTAEHGITQFSDLTPSEFRRTY  107



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 6/141 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            +D LIRQVV+  E   +L+++ HF LFK K+GK Y + EEH +RLS+F+ NL RA  HQ 
Sbjct  28   DDLLIRQVVNVTEPR-VLSSEDHFALFKRKFGKVYGSVEEHYHRLSIFRRNLLRAMHHQR  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DP A HGVT+FSDLTP EFRR               K+P D + A ILPT +LP +FDW
Sbjct  87   MDPFASHGVTQFSDLTPSEFRRM-----HLGVKGLGFKIPKDVNQAPILPTQNLPKEFDW  141

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QGSCGSCWSF
Sbjct  142  RDRGAVTPVKNQGSCGSCWSF  162



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = +1

Query  148  LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTP  327
            L  D  F  F  ++GK+Y   EEH +RLSVFKANLRRA+RHQ+LDPSA HGVTKFSDL P
Sbjct  39   LELDSQFLGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQMLDPSAEHGVTKFSDLAP  98

Query  328  KEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGS  507
             EFRRTFLG++ +     +      AH A +LPT  LP DFDWRD GAV  VK+QGSCGS
Sbjct  99   AEFRRTFLGLKTTRRSFLREMA-GSAHDAPVLPTDGLPEDFDWRDQGAVGPVKNQGSCGS  157

Query  508  CWSF  519
            CWSF
Sbjct  158  CWSF  161



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 13/141 (9%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDP+I+QVV  G       A++ F  FK ++GK Y++++EHDYR +VFK+NL RAKRH +
Sbjct  31   EDPIIQQVVDKG------GAEYQFNEFKQRFGKVYSSKDEHDYRFNVFKSNLHRAKRHGI  84

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSA HGVT+FSDLTP+EFR +         G + + LP  A AA IL T +LP DFDW
Sbjct  85   MDPSATHGVTRFSDLTPREFRNSI-------LGLKGVGLPRHAKAAPILSTENLPRDFDW  137

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT V++QG CGS WSF
Sbjct  138  REKGAVTPVRNQGFCGSSWSF  158



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = +1

Query  163  HFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRR  342
            HF+LFK ++GK Y + EEH +R +VF++NL+RA RHQ +DPSA HGVT+FSDLTP EFRR
Sbjct  30   HFSLFKRRFGKVYGSLEEHHHRFAVFRSNLQRAMRHQRMDPSARHGVTQFSDLTPSEFRR  89

Query  343  TFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                       +   KLP DA+ A ILPT DLP DFDWRD GAVT VK+QGSCGSCWSF
Sbjct  90   M------HLGVRGGFKLPKDANQAPILPTKDLPEDFDWRDRGAVTPVKNQGSCGSCWSF  142



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 99/141 (70%), Gaps = 13/141 (9%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDP+I+QVV  G       A++ F  FK ++GK Y++++EHDYR +VFK+NL RAKRH +
Sbjct  30   EDPIIQQVVDKG------GAEYQFNEFKQRFGKVYSSKDEHDYRFNVFKSNLHRAKRHGI  83

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DPSA HGVT+FSDLTP+EFR +         G + + LP  A AA IL + +LP DFDW
Sbjct  84   MDPSATHGVTRFSDLTPREFRNSI-------LGLKGVGLPRHAKAAPILSSENLPRDFDW  136

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R+ GAVT V++QG CGS WSF
Sbjct  137  REKGAVTPVRNQGFCGSSWSF  157



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 99/139 (71%), Gaps = 16/139 (12%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDAL--------LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLR  255
            DPLIRQVV +G D++         L A+HHF+LFK K+GKSYA++EEHDYR  VFKANLR
Sbjct  25   DPLIRQVV-EGRDESHHHHDHDHALGAEHHFSLFKHKFGKSYASKEEHDYRFDVFKANLR  83

Query  256  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSD  435
            RA RHQ LDPSA HGVT+FSD+ P EFR++         G R LKLP DA  A ILPT +
Sbjct  84   RAARHQRLDPSAQHGVTRFSDMPPAEFRKS-------QLGLRGLKLPEDATKAPILPTEN  136

Query  436  LPSDFDWRDYGAVTGVKDQ  492
            LP DFDWR++GA   VK+Q
Sbjct  137  LPEDFDWREHGAAPAVKNQ  155



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 101/134 (75%), Gaps = 7/134 (5%)
 Frame = +1

Query  118  VVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVH  297
            VV +G+  ALL+ + HF  F +++GK+YAT E + +RL VF+ANL RA  HQ LDPSAVH
Sbjct  5    VVDNGDRSALLDVETHFKSFIARFGKAYATAEAYAHRLKVFEANLVRAVSHQALDPSAVH  64

Query  298  GVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYGAVT  477
            G+T+FSDLT +EF++ FLG+R  S  +       +A+ A +LPT+DLP DFDWR++GAVT
Sbjct  65   GITQFSDLTEEEFKQQFLGLRVPSRLR-------EANKAPVLPTNDLPEDFDWREHGAVT  117

Query  478  GVKDQGSCGSCWSF  519
             VK+QG+CGSCW+F
Sbjct  118  EVKNQGACGSCWAF  131



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 97/149 (65%), Gaps = 16/149 (11%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDD--------ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANL  252
            +D LIRQV  +   D        AL NA+ HF  F  +YGK Y+  EEH++R  VFK+NL
Sbjct  26   DDDLIRQVTDEVVSDPQILDARSALFNAEVHFRHFIRRYGKKYSGPEEHEHRFGVFKSNL  85

Query  253  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTS  432
             RA  HQ LDP A HGVTKFSDLT +EFR  +LG+R             DAH A ILPT+
Sbjct  86   LRALEHQKLDPRASHGVTKFSDLTQEEFRHQYLGLRAPPLR--------DAHDAPILPTN  137

Query  433  DLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            DLP DFDWR+ GAVT VK+QGSCGSCW+F
Sbjct  138  DLPEDFDWREKGAVTEVKNQGSCGSCWAF  166



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 97/149 (65%), Gaps = 16/149 (11%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDD--------ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANL  252
            +D LIRQV  +   D        AL NA+ HF  F  +YGK Y+  EEH++R  VFK+NL
Sbjct  26   DDDLIRQVTDEVVSDPQILDARSALFNAEVHFRHFIRRYGKKYSGPEEHEHRFGVFKSNL  85

Query  253  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTS  432
             RA  HQ LDP A HGVTKFSDLT +EFR  +LG+R             DAH A ILPT+
Sbjct  86   LRALEHQKLDPRASHGVTKFSDLTQEEFRHQYLGLRAPPLR--------DAHDAPILPTN  137

Query  433  DLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            DLP DFDWR+ GAVT VK+QGSCGSCW+F
Sbjct  138  DLPEDFDWREKGAVTEVKNQGSCGSCWAF  166



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 84/116 (72%), Gaps = 6/116 (5%)
 Frame = +1

Query  172  LFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFl  351
            LFK K+GK Y + EEH YR SVFKANL RA RHQ +DPSA HGVT+FSDLT  EFRR   
Sbjct  2    LFKKKFGKVYGSIEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRR---  58

Query  352  girksssgkrklklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
               K    K   KLP DA+ A ILPT +LP +FDWRD GAVT VK+QGSCGSCWSF
Sbjct  59   ---KHLGVKGGFKLPKDANQAPILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSF  111



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 99/155 (64%), Gaps = 14/155 (9%)
 Frame = +1

Query  82   VVRA--DEDPLIRQVVSDG-------EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLS  234
            VVR+  +ED LI QVV  G       E   LL+A+ HF  F+ ++G++Y           
Sbjct  9    VVRSAEEEDALIEQVVGGGDGDGDDRELGELLDAEAHFASFERRFGRTYRDAXXXXXXXX  68

Query  235  VFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAA  414
            VFKANLRRA+RHQLLDPSA HGVTKFSDLTP EFR  +LG+R            A    A
Sbjct  69   VFKANLRRARRHQLLDPSASHGVTKFSDLTPAEFRERYLGLRGGGRTSL-----ASTAEA  123

Query  415  EILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
             ILPT  LP+DFDWR++GAV  VKDQGSCGSCWSF
Sbjct  124  PILPTDGLPADFDWREHGAVGPVKDQGSCGSCWSF  158



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 98/152 (64%), Gaps = 17/152 (11%)
 Frame = +1

Query  88   RADEDPLIRQVVSDGEDD--------ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFK  243
            R D+D LIRQV  +   D        AL NA+ HF  F  +YGK Y+  EEH++R  VFK
Sbjct  24   RPDDD-LIRQVTDEVVSDPQILDARSALFNAEVHFRHFIRRYGKKYSGPEEHEHRFGVFK  82

Query  244  ANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEIL  423
            +NL RA  HQ LDP A HGVTKFSDLT + FR  +LG+R             DAH A IL
Sbjct  83   SNLLRALEHQKLDPRASHGVTKFSDLTQEGFRHQYLGLRAPPLR--------DAHDAPIL  134

Query  424  PTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            PT+DLP DFDWR+ GAVT VK+QGSCGSCW+F
Sbjct  135  PTNDLPEDFDWREKGAVTEVKNQGSCGSCWAF  166



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 103/149 (69%), Gaps = 16/149 (11%)
 Frame = +1

Query  100  DPLIRQVVSDGEDD---------ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANL  252
            D  IR+V     D+         ALL+ + HF  F +++GK+YAT E + +RL VF+ANL
Sbjct  27   DSGIREVTDTARDESNGRLDAAKALLDVETHFKSFIARFGKAYATAEAYAHRLKVFEANL  86

Query  253  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTS  432
             RA  HQ LDPSAVHG+T+FSDLT +EF++ FLG+R  S  +       +A+ A +LPT+
Sbjct  87   VRAVSHQALDPSAVHGITQFSDLTEEEFKQQFLGLRVPSRLR-------EANKAPVLPTN  139

Query  433  DLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            DLP DFDWR++GAVT VK+QG+CGSCW+F
Sbjct  140  DLPEDFDWREHGAVTEVKNQGACGSCWAF  168



>ref|XP_009117680.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=357

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 90/141 (64%), Gaps = 7/141 (5%)
 Frame = +1

Query  100  DPLIRQVVSDGEDD-ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            D LIRQVV+  E +  +++ + HF LFK KYGK Y + EEH +R  +F++N  RA RHQ 
Sbjct  27   DILIRQVVNGSESEPTVMSWEDHFALFKRKYGKVYNSHEEHQHRFWIFRSNFMRATRHQR  86

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            +DP A HGVT+FSDLT  EFRR      K    K        A  A IL T +LP DFDW
Sbjct  87   MDPFARHGVTQFSDLTHSEFRR------KHLGVKGAYTFSQHADQAPILDTKNLPGDFDW  140

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            RD GAVT VK+QG+CGS WSF
Sbjct  141  RDRGAVTPVKNQGACGSSWSF  161



>ref|XP_010534431.1| PREDICTED: cysteine proteinase 15A [Tarenaya hassleriana]
Length=379

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 93/148 (63%), Gaps = 2/148 (1%)
 Frame = +1

Query  79   CVVRADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLR  255
            CV    ED  IRQV  D     +  + +  F  F S+YGKSY T+EE+ +RL VF  N+ 
Sbjct  28   CVASDHEDLAIRQVTEDHRKTLVGTHTESRFRAFMSEYGKSYETREEYVHRLGVFARNVL  87

Query  256  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSD  435
            RA  HQ++DP+AVHGVT+FSDLT +EF R F G+  +  G   ++  A A   E+     
Sbjct  88   RAAEHQMMDPTAVHGVTQFSDLTEEEFERMFTGVLAADEGGVGVQEAA-AEDVEMAEIDG  146

Query  436  LPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            LP DFDWR+ GAVT VK QG+CGSCW+F
Sbjct  147  LPEDFDWREKGAVTDVKMQGACGSCWAF  174



>ref|XP_006403513.1| hypothetical protein EUTSA_v10010475mg [Eutrema salsugineum]
 gb|ESQ44966.1| hypothetical protein EUTSA_v10010475mg [Eutrema salsugineum]
Length=367

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 92/142 (65%), Gaps = 2/142 (1%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ED  IRQV  D   + L  + +  F +F S YGKSY+T+EE+ +RL +F  N+ +A  HQ
Sbjct  24   EDLTIRQVTDDRLSNLLGTHTETKFRVFMSDYGKSYSTREEYVHRLGIFAKNVLKAAEHQ  83

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
            +LDP+AVHGVT+FSDLT +EF R + G+        +      A A  ++    LP+DFD
Sbjct  84   MLDPTAVHGVTRFSDLTEEEFTRMYTGVVGVVDVGGRRGGTVGAEAP-MVEVEGLPTDFD  142

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VKDQG+CGSCW+F
Sbjct  143  WREKGAVTEVKDQGACGSCWAF  164



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = +1

Query  109  IRQVVS-DGE---DD---ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
            IR+V   DGE   DD    LLNA+ HF  F  K+ K Y+  EEH  R S+FK NL +A R
Sbjct  49   IREVTDMDGEGVIDDLRRGLLNAEAHFAHFVKKFNKEYSGAEEHARRFSIFKKNLHKALR  108

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
            HQ LD  A+HG+ KFSDLT +EF   +LG+        +   P     A ILPT DLP D
Sbjct  109  HQKLDRDAIHGINKFSDLTEEEFHEQYLGLTTPPRSLSQRTQP-----APILPTDDLPPD  163

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWR+ GAVT VK+QG+CGSCW+F
Sbjct  164  FDWRELGAVTPVKNQGACGSCWTF  187



>ref|XP_008233261.1| PREDICTED: cysteine proteinase 15A [Prunus mume]
Length=377

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 90/149 (60%), Gaps = 16/149 (11%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            A +DP+I QV  +     LL  +  F +F  KYGK Y+TQ+E+ +RL +F  N+ RA  H
Sbjct  35   ASQDPIIHQVTDN--HRPLLGTERSFQMFIEKYGKKYSTQKEYMHRLGIFAKNMVRAAEH  92

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAH------AAEILPTS  432
            Q LDP+AVHGVT FSDL+ +EF R +           +   PA ++      A  ++  S
Sbjct  93   QALDPTAVHGVTPFSDLSEEEFERMY--------TGMRAVPPASSNDGVSDSAPPVMDVS  144

Query  433  DLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            DLP +FDWR+ GAVT VK QG CGSCW+F
Sbjct  145  DLPKNFDWREKGAVTEVKMQGGCGSCWAF  173



>emb|CAB41090.1| cysteine proteinase precursor-like protein [Arabidopsis thaliana]
Length=363

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 95/150 (63%), Gaps = 8/150 (5%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGED--DALLNA--DHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            VV + ED  IRQV +D       LL    +  F LF S YGK+Y+T+EE+ +RL +F  N
Sbjct  19   VVASVEDLTIRQVTADNRRIRPNLLGTHTESKFRLFMSDYGKNYSTREEYIHRLGIFAKN  78

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            + +A  HQ++DPSAVHGVT+FSDLT +EF+R +        G R   + A+A   E+   
Sbjct  79   VLKAAEHQMMDPSAVHGVTQFSDLTEEEFKRMY-TGVADVGGSRGGTVGAEAPMVEV---  134

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
              LP DFDWR+ G VT VK+QG+CGSCW+F
Sbjct  135  DGLPEDFDWREKGGVTEVKNQGACGSCWAF  164



>ref|NP_567010.5| Papain family cysteine protease [Arabidopsis thaliana]
 gb|AAL49820.1| putative cysteine proteinase [Arabidopsis thaliana]
 gb|AEE79316.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=367

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 95/150 (63%), Gaps = 8/150 (5%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGED--DALLNA--DHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            VV + ED  IRQV +D       LL    +  F LF S YGK+Y+T+EE+ +RL +F  N
Sbjct  19   VVASVEDLTIRQVTADNRRIRPNLLGTHTESKFRLFMSDYGKNYSTREEYIHRLGIFAKN  78

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            + +A  HQ++DPSAVHGVT+FSDLT +EF+R + G+      +      A+A   E+   
Sbjct  79   VLKAAEHQMMDPSAVHGVTQFSDLTEEEFKRMYTGVADVGGSRGGTVG-AEAPMVEV---  134

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
              LP DFDWR+ G VT VK+QG+CGSCW+F
Sbjct  135  DGLPEDFDWREKGGVTEVKNQGACGSCWAF  164



>ref|XP_009116190.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=364

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 93/142 (65%), Gaps = 5/142 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ED  IRQV  D   + L  + +  F +F S YGKSY+T+EE+ +RL +F  N+ +A  HQ
Sbjct  24   EDLTIRQVTEDRLPNLLGTHTERKFRVFMSDYGKSYSTREEYIHRLGIFAKNVLKAAEHQ  83

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
            ++DP+AVHGVT+FSDLT +EF+R + G+     G   +     A A + L    LP DFD
Sbjct  84   MMDPTAVHGVTQFSDLTEEEFKRMYTGVVDVDRGHGGV---VGAEAPQ-LDIKGLPKDFD  139

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VKDQG+CGSCW+F
Sbjct  140  WREKGAVTEVKDQGACGSCWAF  161



>emb|CDX73424.1| BnaC08g25790D [Brassica napus]
Length=364

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 93/142 (65%), Gaps = 5/142 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ED  IRQV  D   + L  + +  F +F S YGKSY+T+EE+ +RL +F  N+ +A  HQ
Sbjct  24   EDLTIRQVTEDRLPNLLGTHTERKFRVFMSDYGKSYSTREEYIHRLGIFAKNVLKAAEHQ  83

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
            ++DP+AVHGVT+FSDLT  EF+R + G+     G   +   A+A   EI     LP DFD
Sbjct  84   MMDPTAVHGVTQFSDLTEDEFKRMYNGVVDVDRGHGGVVG-AEAPKLEI---KGLPKDFD  139

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VKDQG+CGSCW+F
Sbjct  140  WREKGAVTEVKDQGACGSCWAF  161



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +1

Query  193  KSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksss  372
            + YAT+EEHD+R  VFK+NLRRA       P  VHGVTKFSDLTP EFRR FLG++    
Sbjct  15   RPYATKEEHDHRFGVFKSNLRRASCTPSSTPR-VHGVTKFSDLTPAEFRRQFLGLKAVRF  73

Query  373  gkrklklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                   PA A  A ILPT DLP DFDWRD GAVT VKDQG CGSCWSF
Sbjct  74   -------PAHAQKAPILPTKDLPKDFDWRDKGAVTNVKDQGGCGSCWSF  115



>emb|CDY56961.1| BnaA09g55030D [Brassica napus]
Length=364

 Score =   127 bits (320),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 91/142 (64%), Gaps = 5/142 (4%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            ED  IRQV  D   + L  + +  F +F S YGKSY+T+EE+ +RL +F  N+ +A  HQ
Sbjct  24   EDLTIRQVTEDRLPNLLGTHTERKFRVFMSDYGKSYSTREEYIHRLGIFAKNVLKAAEHQ  83

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFD  453
            ++DP+AVHGVT+FSDLT +EF+R + G+     G   +        A  L    LP DFD
Sbjct  84   MMDPTAVHGVTQFSDLTEEEFKRMYTGVVDVDRGHGGVV----GVEAPQLDIKGLPKDFD  139

Query  454  WRDYGAVTGVKDQGSCGSCWSF  519
            WR+ GAVT VKDQG+CGSCW+F
Sbjct  140  WREKGAVTEVKDQGACGSCWAF  161



>gb|KFK34737.1| hypothetical protein AALP_AA5G186400 [Arabis alpina]
Length=369

 Score =   127 bits (320),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 9/151 (6%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGEDDALLN-----ADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  246
            V  + ED  IRQV  D     L N      +  F +F S YGKSY+T+EE+ +RL +F  
Sbjct  20   VTGSLEDLTIRQVTDD-RQRVLPNLLGTHTETKFRVFMSDYGKSYSTREEYVHRLGIFAR  78

Query  247  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP  426
            N+ +A  HQ++DP+AVHGVT+FSDLT KEF++ + G+   S G     +  +   A +L 
Sbjct  79   NVLKAAEHQMMDPTAVHGVTRFSDLTEKEFKKMYTGVADVSHGGGVGAVRME---APMLE  135

Query  427  TSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
               LP DFDWR+ GAVT +KDQG CGSCW+F
Sbjct  136  VEGLPEDFDWREKGAVTEIKDQGKCGSCWAF  166



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 91/144 (63%), Gaps = 21/144 (15%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  267
             +EDPLI QVV  GE+ DA L+A+ HF  F+ ++G++Y                 RRA+R
Sbjct  32   GEEDPLIDQVVGGGEEEDAQLDAEAHFASFERRFGRTYP--------------GPRRARR  77

Query  268  HQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSD  447
               LDP+A HGVTKFSDLTP EFR  FLG+R+ S        P   H A ILPT  LP D
Sbjct  78   ---LDPTATHGVTKFSDLTPGEFRDRFLGLRRPSLEGLVGGEP---HEAPILPTDGLPDD  131

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWR++GAV  VKDQGSCGSCWSF
Sbjct  132  FDWREHGAVGPVKDQGSCGSCWSF  155



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = +1

Query  211  EEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklk  390
            +EH +RLSVF+ NLRRA+RHQ LDPSAVHG+TKFSDLTP EFR  FLG+RKS     K  
Sbjct  96   DEHAHRLSVFRDNLRRARRHQRLDPSAVHGITKFSDLTPDEFRERFLGLRKSRRSFLKGI  155

Query  391  lPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
                AH A  LPT  LP++FDWR++GAV  VKDQGSCGSCWSF
Sbjct  156  S-GSAHDAPALPTDGLPTEFDWREHGAVGPVKDQGSCGSCWSF  197



>ref|XP_007218137.1| hypothetical protein PRUPE_ppa007240mg [Prunus persica]
 gb|EMJ19336.1| hypothetical protein PRUPE_ppa007240mg [Prunus persica]
Length=377

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 89/149 (60%), Gaps = 16/149 (11%)
 Frame = +1

Query  91   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            A +DP+I QV  +     LL  +  F +F  KYGK Y+T++E+ +RL +F  N+ RA  H
Sbjct  35   AAQDPIIHQVTDN--HRPLLGTERSFQMFIEKYGKKYSTRKEYMHRLGIFAKNMVRAAEH  92

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAH------AAEILPTS  432
            Q LDP+AVHGVT FSDL+ +EF R +           +   PA ++      A  ++   
Sbjct  93   QALDPTAVHGVTPFSDLSEEEFERMY--------TGMRAVPPASSNDGVSDSAPPVMDVG  144

Query  433  DLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            DLP +FDWR+ GAVT VK QG CGSCW+F
Sbjct  145  DLPENFDWREKGAVTEVKMQGGCGSCWAF  173



>ref|XP_002876278.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52537.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 94/150 (63%), Gaps = 8/150 (5%)
 Frame = +1

Query  82   VVRADEDPLIRQVVSDGED--DALLNA--DHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  249
            VV + ED  IRQV +D       LL    +  F +F S YGK+Y+T+EE+ +RL +F  N
Sbjct  19   VVASVEDLTIRQVTADERRVRPNLLGTHTESKFRVFMSDYGKNYSTREEYIHRLGIFAKN  78

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            + +A  HQ++DP+AVHGVT+FSDLT +EF+R + G+      +      A    A ++  
Sbjct  79   VLKAAEHQMMDPTAVHGVTQFSDLTEEEFKRMYTGVADVGGSRGH----AVGAEAPMVEV  134

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
              LP DFDWR+ G VT VK+QG+CGSCW+F
Sbjct  135  DGLPEDFDWREKGGVTEVKNQGACGSCWAF  164



>ref|XP_008446834.1| PREDICTED: cysteine proteinase 15A [Cucumis melo]
Length=371

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 88/144 (61%), Gaps = 7/144 (5%)
 Frame = +1

Query  100  DPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  273
            DP   + V+DGE  ++    ++  F +F  KYGKSY T++E+ +RL +F  NL RA  HQ
Sbjct  30   DPEFLRQVTDGEIFNNLPAGSERKFAMFMEKYGKSYPTRKEYLHRLGIFVKNLIRAAEHQ  89

Query  274  LLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILP--TSDLPSD  447
             LDP+AVHGVT+FSDL+ +EF R F        G     LP    A E+       LP  
Sbjct  90   ALDPTAVHGVTQFSDLSEEEFERMF---MGVRGGAGGAGLPEMNQAVEVSAEEVKGLPER  146

Query  448  FDWRDYGAVTGVKDQGSCGSCWSF  519
            FDWR+ GAVTGVK QG+CGSCW+F
Sbjct  147  FDWREKGAVTGVKMQGTCGSCWAF  170



>ref|XP_010034320.1| PREDICTED: cysteine proteinase 1 [Eucalyptus grandis]
 gb|KCW51545.1| hypothetical protein EUGRSUZ_J01054 [Eucalyptus grandis]
Length=367

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +1

Query  100  DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  279
             P I QV    E + LL  +  F +F  KYGKSY+T+EE+  RL +F  NL RA  HQ L
Sbjct  29   SPAIFQVT---EHNPLLTTERRFHIFMRKYGKSYSTREEYARRLGIFAGNLARAAEHQAL  85

Query  280  DPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWR  459
            DP+AVHGVT FSDL+P+EF   + G+R              +  A     + LP  FDWR
Sbjct  86   DPTAVHGVTPFSDLSPEEFEMLYTGVRGGGGSLGSSSNGVASAVATEEEVNGLPESFDWR  145

Query  460  DYGAVTGVKDQGSCGSCWSF  519
            + GAVT VK QG CGSCW+F
Sbjct  146  EKGAVTEVKMQGVCGSCWAF  165



>ref|XP_001781954.1| predicted protein [Physcomitrella patens]
 gb|EDQ53250.1| predicted protein [Physcomitrella patens]
Length=369

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = +1

Query  142  ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDL  321
            ALL A+  F  F  ++GK Y T EE+++R  VFK+NL RA +HQ LDP+A HGVT FSDL
Sbjct  48   ALLGAEKQFESFIKEFGKVYHTVEEYEHRFKVFKSNLLRALKHQALDPTASHGVTMFSDL  107

Query  322  TPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSC  501
            T +EF   +LG+++ S+        + A  AE LPT DLP  FDWR+ GAV  VK+QGSC
Sbjct  108  TEEEFATQYLGLKRPSAL-------STAPTAEPLPTGDLPPSFDWREKGAVGPVKNQGSC  160

Query  502  GSCWSF  519
            GSCW+F
Sbjct  161  GSCWAF  166



>ref|XP_007010012.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY18822.1| Papain family cysteine protease [Theobroma cacao]
Length=382

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  HFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRR  342
             F +F  KYGK+Y+T EE+ +RL +F  NL RA  HQ+LDP+AVHGVT+FSDL+ +EF R
Sbjct  62   EFQVFVEKYGKNYSTTEEYMHRLGIFAKNLIRAAEHQVLDPTAVHGVTQFSDLSEEEFER  121

Query  343  TFlgirksssgkrklklPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
             + G++   +      +      AE++    LP  FDWR+ GAVT VK QG+CGSCW+F
Sbjct  122  LYTGVKGGMAAAAPRMMDGVGSEAEMVEVDGLPESFDWREKGAVTEVKMQGACGSCWAF  180



>ref|XP_006436511.1| hypothetical protein CICLE_v10031865mg [Citrus clementina]
 ref|XP_006485655.1| PREDICTED: cysteine proteinase 1-like [Citrus sinensis]
 gb|ESR49751.1| hypothetical protein CICLE_v10031865mg [Citrus clementina]
Length=373

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 94/143 (66%), Gaps = 5/143 (3%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNA--DHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  270
            ++P IRQV +D     LL +  +++F +F  KY KSYAT+E++ +RL +F  N+ RA  H
Sbjct  31   QNPTIRQV-TDNPGHLLLGSATENNFKIFMQKYEKSYATREDYVHRLGIFAKNMIRAAEH  89

Query  271  QLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDF  450
            QLLDP+AVHGVT FSDL+ +EF   + G++          L  ++ + +++    LP +F
Sbjct  90   QLLDPTAVHGVTPFSDLSEEEFESMYTGMKGGPPEMDGGGL--ESSSVKMMEIDGLPENF  147

Query  451  DWRDYGAVTGVKDQGSCGSCWSF  519
            DWRD GAVT VK QG+CGSCW+F
Sbjct  148  DWRDKGAVTEVKMQGACGSCWAF  170



>ref|XP_010918606.1| PREDICTED: probable cysteine proteinase A494 [Elaeis guineensis]
Length=376

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 83/141 (59%), Gaps = 3/141 (2%)
 Frame = +1

Query  97   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  276
            EDP IR V        +   +  F  F  +YGK Y ++EE+ +RL VF  NL RA  HQ 
Sbjct  33   EDPKIRPVTDLAGHRRVGATERRFRAFMRRYGKEYGSREEYGHRLGVFARNLARAAEHQA  92

Query  277  LDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPSDFDW  456
            LDP+AVHG+T FSDLT +EF R FLGI             A++  A  +    LPS+FDW
Sbjct  93   LDPTAVHGITPFSDLTAEEFERAFLGIVAKDDKGGAS---AESPTAPRMEVDGLPSNFDW  149

Query  457  RDYGAVTGVKDQGSCGSCWSF  519
            R  GAVT VK QGSCGSCW+F
Sbjct  150  RKKGAVTDVKMQGSCGSCWAF  170



>ref|XP_010103534.1| putative cysteine proteinase A494 [Morus notabilis]
 gb|EXB96194.1| putative cysteine proteinase A494 [Morus notabilis]
Length=372

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  97   EDPLIRQVVSDG----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  264
            +DP+I QV  D       + LL  +  F +F  KYGK+Y ++EE+  RL +F  N+ RA 
Sbjct  26   QDPVIHQVTDDLHPKFSGNELLGTEKKFKIFMEKYGKTYGSREEYVRRLGIFARNMLRAA  85

Query  265  RHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPTSDLPS  444
             HQ LDP+AVHGVT FSDL+ +EF   + G R            + A AAE+     LP 
Sbjct  86   EHQALDPTAVHGVTPFSDLSEEEFESMYTGFRGGPGFGHGNVANSAAAAAEVDGGGHLPE  145

Query  445  DFDWRDYGAVTGVKDQGSCGSCWSF  519
             FDWR+ GAVT VK QGSCGSCW+F
Sbjct  146  SFDWREKGAVTDVKMQGSCGSCWAF  170



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 71/90 (79%), Gaps = 5/90 (6%)
 Frame = +1

Query  250  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFlgirksssgkrklklPADAHAAEILPT  429
            +RRA+RHQ LDP+AVHGVT+FSDLTP EF+RT+LG+RK             AH A +LPT
Sbjct  1    MRRARRHQQLDPTAVHGVTQFSDLTPGEFKRTYLGLRKGKKHLV-----GSAHEAPLLPT  55

Query  430  SDLPSDFDWRDYGAVTGVKDQGSCGSCWSF  519
            +DLP DFDWRD GAVTGVK+QGSCGSCWSF
Sbjct  56   NDLPEDFDWRDKGAVTGVKNQGSCGSCWSF  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000