BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H15

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275472.1|  alpha-tubulin-like protein                         243   7e-78   Solanum tuberosum [potatoes]
gb|ACU24494.1|  unknown                                                 240   8e-78   Glycine max [soybeans]
gb|ACN40426.1|  unknown                                                 243   5e-77   Picea sitchensis
gb|ACU18775.1|  unknown                                                 239   5e-77   Glycine max [soybeans]
ref|XP_001786415.1|  predicted protein                                  236   5e-77   
emb|CBI29424.3|  unnamed protein product                                242   7e-77   Vitis vinifera
gb|ABE66388.1|  alpha-tubulin                                           239   9e-77   Striga asiatica [witchweed]
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     243   1e-76   
gb|AAN33000.1|  alpha-tubulin 4                                         241   3e-76   Gossypium hirsutum [American cotton]
gb|ABF13307.1|  alpha-tubulin                                           234   4e-76   Phaseolus vulgaris [French bean]
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          244   4e-76   
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    244   4e-76   Brassica rapa
gb|AAI59362.1|  Unknown (protein for MGC:185872)                        235   5e-76   Xenopus tropicalis [western clawed frog]
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               237   5e-76   Erythranthe guttata [common monkey flower]
ref|XP_005932718.1|  PREDICTED: tubulin alpha chain-like                234   5e-76   
ref|WP_039310890.1|  hypothetical protein                               244   6e-76   
emb|CBI22190.3|  unnamed protein product                                243   6e-76   Vitis vinifera
ref|XP_006433709.1|  hypothetical protein CICLE_v100015521mg            234   7e-76   
ref|XP_003793694.1|  PREDICTED: tubulin alpha chain-like                234   7e-76   Otolemur garnettii
gb|ERE81184.1|  tubulin alpha-1C chain                                  236   8e-76   Cricetulus griseus [Chinese hamsters]
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   242   8e-76   Citrus sinensis [apfelsine]
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     244   9e-76   
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        244   9e-76   Brassica rapa
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    243   9e-76   
ref|XP_005466520.1|  PREDICTED: tubulin alpha chain-like                234   9e-76   
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     243   1e-75   
ref|XP_002609253.1|  hypothetical protein BRAFLDRAFT_86837              233   1e-75   Branchiostoma floridae
gb|AAW30622.1|  unknown                                                 235   1e-75   Sus scrofa [pigs]
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    244   1e-75   
gb|AAW30623.1|  unknown                                                 236   2e-75   Sus scrofa [pigs]
ref|XP_008294350.1|  PREDICTED: tubulin alpha chain                     236   2e-75   Stegastes partitus
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        244   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        243   2e-75   
emb|CBI19330.3|  unnamed protein product                                242   2e-75   Vitis vinifera
emb|CBI25125.3|  unnamed protein product                                241   2e-75   Vitis vinifera
tpg|DAA51110.1|  TPA: alpha-tubulin                                     237   2e-75   
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like             237   2e-75   
emb|CDY25017.1|  BnaC02g39910D                                          242   2e-75   Brassica napus [oilseed rape]
emb|CDY66630.1|  BnaCnng51680D                                          243   2e-75   Brassica napus [oilseed rape]
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                  236   2e-75   Ochotona princeps [southern American pika]
gb|AAX21196.1|  putative alpha-tubulin                                  235   2e-75   Solanum betaceum [tamarillo]
dbj|BAE01779.1|  unnamed protein product                                237   2e-75   Macaca fascicularis [crab eating macaque]
emb|CAJ26346.1|  alpha-tubulin                                          234   2e-75   Platynereis dumerilii
ref|XP_003392163.2|  PREDICTED: tubulin alpha chain, testis-speci...    234   3e-75   Amphimedon queenslandica
gb|AHJ80818.1|  Tua1                                                    238   3e-75   Eragrostis tef [tef]
gb|EPZ32931.1|  Tubulin domain-containing protein                       233   3e-75   Rozella allomycis CSF55
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    243   3e-75   
ref|XP_005906298.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    235   3e-75   Bos mutus
ref|XP_005466564.1|  PREDICTED: tubulin alpha chain-like                233   3e-75   
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like             237   3e-75   
gb|AGG37287.1|  alpha-tubulin 5                                         243   3e-75   Salix arbutifolia
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             243   3e-75   Selaginella moellendorffii
ref|XP_007042689.1|  Tubulin alpha-2 chain                              243   3e-75   Theobroma cacao [chocolate]
dbj|BAP59012.1|  alpha tubulin                                          243   3e-75   Taxus cuspidata [ichii]
ref|XP_006056311.1|  PREDICTED: tubulin alpha-1B chain-like             236   3e-75   
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   243   3e-75   Populus euphratica
ref|XP_002510010.1|  tubulin alpha chain, putative                      243   3e-75   Ricinus communis
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     243   3e-75   Eucalyptus grandis [rose gum]
gb|ABK92552.1|  unknown                                                 243   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             243   3e-75   Populus trichocarpa [western balsam poplar]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         243   3e-75   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           243   3e-75   Betula pendula [white birch]
gb|AGG37285.1|  alpha-tubulin 3                                         243   4e-75   Salix arbutifolia
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             243   4e-75   Prunus persica
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                243   4e-75   Pyrus x bretschneideri [bai li]
emb|CDY29334.1|  BnaA05g16010D                                          242   4e-75   Brassica napus [oilseed rape]
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    243   4e-75   Tarenaya hassleriana [spider flower]
ref|XP_006264720.1|  PREDICTED: tubulin alpha-1C chain                  233   4e-75   
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             243   4e-75   Citrus clementina [clementine]
gb|AAV92352.1|  alpha tubulin 1                                         243   4e-75   Pseudotsuga menziesii var. menziesii
ref|XP_010726225.1|  PREDICTED: tubulin alpha chain-like                234   4e-75   Meleagris gallopavo [common turkey]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             243   4e-75   Eutrema salsugineum [saltwater cress]
ref|XP_002522104.1|  tubulin alpha chain, putative                      243   4e-75   Ricinus communis
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          242   4e-75   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                242   4e-75   Tarenaya hassleriana [spider flower]
gb|ABX57816.1|  alpha tubulin                                           242   4e-75   Picea wilsonii
ref|XP_006109205.1|  PREDICTED: tubulin alpha-1D chain-like             235   4e-75   Myotis lucifugus
ref|NP_849388.1|  tubulin alpha-6 chain                                 242   4e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AID52921.1|  tubulin alpha chain                                     242   5e-75   Carthamus tinctorius
ref|XP_007018369.1|  Tubulin alpha-2 chain                              242   5e-75   Theobroma cacao [chocolate]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   242   5e-75   Fragaria vesca subsp. vesca
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                242   5e-75   Tarenaya hassleriana [spider flower]
gb|ABO47737.1|  alpha-tubulin                                           242   5e-75   Gossypium hirsutum [American cotton]
ref|XP_003979912.1|  PREDICTED: tubulin alpha-1D chain-like             231   5e-75   
gb|KHG20487.1|  Tubulin alpha chain                                     242   5e-75   Gossypium arboreum [tree cotton]
ref|NP_171974.1|  tubulin alpha-4 chain                                 242   5e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             242   5e-75   Capsella rubella
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              242   5e-75   
ref|XP_004778983.1|  PREDICTED: tubulin alpha-1C chain                  236   5e-75   
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     242   5e-75   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     242   5e-75   Pyrus x bretschneideri [bai li]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    242   5e-75   Gossypium raimondii
gb|AAG49533.3|  alpha tubulin                                           237   5e-75   Glossina morsitans morsitans
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                242   5e-75   Elaeis guineensis
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                242   6e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    241   6e-75   Gossypium raimondii
ref|XP_010093625.1|  Tubulin alpha chain                                242   6e-75   Morus notabilis
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    242   6e-75   Brassica rapa
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    243   6e-75   
ref|XP_008969760.1|  PREDICTED: tubulin alpha chain-like                234   6e-75   
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          242   6e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     241   6e-75   
gb|AIK29207.1|  putative alpha-tubulin                                  236   6e-75   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KHG18997.1|  Tubulin alpha chain                                     242   7e-75   Gossypium arboreum [tree cotton]
gb|ABO47736.1|  alpha-tubulin                                           242   7e-75   Gossypium hirsutum [American cotton]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     242   7e-75   Cucumis melo [Oriental melon]
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like             237   7e-75   Pteropus vampyrus
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                242   7e-75   Cucumis sativus [cucumbers]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                242   7e-75   Vitis vinifera
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    242   7e-75   Citrus sinensis [apfelsine]
ref|XP_007426287.1|  PREDICTED: tubulin alpha-1C chain                  236   7e-75   Python bivittatus
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    242   7e-75   Glycine max [soybeans]
gb|AGG37283.1|  alpha-tubulin 1                                         242   7e-75   Salix arbutifolia
gb|KHN01709.1|  Tubulin alpha chain                                     242   7e-75   Glycine soja [wild soybean]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             242   8e-75   Citrus clementina [clementine]
ref|XP_006895063.1|  PREDICTED: tubulin alpha-1B chain-like             235   8e-75   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        242   8e-75   
gb|ABO33166.1|  alpha tubulin a2                                        235   8e-75   Mesenchytraeus solifugus
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             241   9e-75   Prunus persica
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          241   9e-75   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              241   9e-75   Camelina sativa [gold-of-pleasure]
gb|AAO73546.1|  alpha-tubulin                                           241   9e-75   Ceratopteris richardii
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             241   9e-75   Selaginella moellendorffii
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like             235   1e-74   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              241   1e-74   
ref|XP_008575749.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    237   1e-74   Galeopterus variegatus [Malayan flying lemur]
gb|AIJ27191.1|  alpha-tubulin 1a                                        236   1e-74   Mytilus galloprovincialis
gb|ABO47740.1|  alpha-tubulin                                           241   1e-74   Gossypium hirsutum [American cotton]
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                241   1e-74   Populus euphratica
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   241   1e-74   Malus domestica [apple tree]
gb|EDL87015.1|  rCG50513, isoform CRA_a                                 238   1e-74   Rattus norvegicus [brown rat]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              241   1e-74   Fragaria vesca subsp. vesca
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    242   1e-74   
ref|XP_007663362.1|  PREDICTED: tubulin alpha chain-like                231   1e-74   
gb|ACN40181.1|  unknown                                                 241   1e-74   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     241   1e-74   Vitis vinifera
ref|XP_008475351.1|  PREDICTED: tubulin alpha-1 chain-like              237   1e-74   
ref|XP_006264718.1|  PREDICTED: tubulin alpha chain-like                232   1e-74   
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                  236   1e-74   Chrysemys picta bellii
gb|ABQ59634.1|  alpha-tubulin 5                                         241   1e-74   Populus tremuloides
gb|AIX10966.1|  tubulin                                                 241   1e-74   Ornithogalum longebracteatum [sea-onion]
gb|KGL81705.1|  Tubulin alpha-1C chain                                  234   1e-74   Tinamus guttatus
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         241   1e-74   Jatropha curcas
ref|XP_008317242.1|  PREDICTED: tubulin alpha-1C chain-like             237   1e-74   
gb|AGE09583.1|  TUA1-like protein                                       240   1e-74   Eucalyptus cladocalyx
ref|XP_007047652.1|  Tubulin alpha-2 chain                              242   1e-74   
ref|XP_003804211.2|  PREDICTED: tubulin alpha-3E chain                  231   2e-74   Pan paniscus [bonobo]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    241   2e-74   Gossypium hirsutum [American cotton]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   241   2e-74   Vitis vinifera
gb|AFV46219.1|  hypothetical protein                                    241   2e-74   Scutellaria baicalensis [Baikal skullcap]
gb|ABO47739.1|  alpha-tubulin                                           241   2e-74   Gossypium hirsutum [American cotton]
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     241   2e-74   Sesamum indicum [beniseed]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 241   2e-74   Populus trichocarpa [western balsam poplar]
gb|KIY93466.1|  Tubulin alpha-1 chain                                   233   2e-74   Monoraphidium neglectum
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    241   2e-74   Arabis alpina [alpine rockcress]
ref|XP_010995722.1|  PREDICTED: tubulin alpha-1B chain                  238   2e-74   Camelus dromedarius [camel]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                240   2e-74   Erythranthe guttata [common monkey flower]
gb|ABK92520.1|  unknown                                                 241   2e-74   Populus trichocarpa [western balsam poplar]
ref|NP_001289660.1|  tubulin alpha chain-like                           241   2e-74   Eucalyptus grandis [rose gum]
ref|XP_006264719.1|  PREDICTED: tubulin alpha-1A chain                  237   2e-74   
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    241   2e-74   Gossypium hirsutum [American cotton]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              241   2e-74   Cucumis sativus [cucumbers]
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     241   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010104543.1|  Tubulin alpha chain                                241   2e-74   
gb|ABQ59633.1|  alpha-tubulin 3                                         241   2e-74   Populus tremuloides
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                241   2e-74   Prunus dulcis [sweet almond]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     241   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             241   2e-74   
ref|XP_001764722.1|  predicted protein                                  241   2e-74   
gb|AAC97930.1|  alpha tubulin                                           231   2e-74   Notothenia coriiceps [yellowbelly rockcod]
gb|ABB02631.1|  unknown                                                 240   2e-74   Solanum tuberosum [potatoes]
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              240   2e-74   
ref|XP_004617224.1|  PREDICTED: tubulin alpha-1D chain-like             233   2e-74   
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                240   2e-74   Nelumbo nucifera [Indian lotus]
emb|CAD13176.1|  alpha-tubulin                                          240   3e-74   Nicotiana tabacum [American tobacco]
gb|ADW66593.1|  alpha tubulin                                           238   3e-74   Hirschfeldia incana [buchanweed]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     240   3e-74   Nicotiana sylvestris
gb|AAO23139.1|  alpha tubulin                                           240   3e-74   Populus tremuloides
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        240   3e-74   Glycine max [soybeans]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             240   3e-74   Hordeum vulgare [barley]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     240   3e-74   Nicotiana tomentosiformis
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    240   3e-74   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   240   3e-74   Brassica rapa
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    240   3e-74   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              240   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        240   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     240   3e-74   
gb|AII97815.1|  BLTX443                                                 235   3e-74   Nephila pilipes
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              240   3e-74   Oryza brachyantha
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             240   3e-74   Selaginella moellendorffii
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        239   3e-74   
emb|CDP02221.1|  unnamed protein product                                240   3e-74   Coffea canephora [robusta coffee]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              240   3e-74   Populus euphratica
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              240   3e-74   Nicotiana tomentosiformis
dbj|BAC24800.1|  alpha tubulin                                          240   3e-74   Physcomitrella patens
ref|NP_193232.1|  tubulin alpha-6 chain                                 240   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002110664.1|  alpha tubulin                                      234   3e-74   Trichoplax adhaerens
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                240   3e-74   Solanum tuberosum [potatoes]
gb|ABS57456.1|  alpha-tubulin                                           233   3e-74   Heliconius melpomene [common postman]
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              240   3e-74   Solanum lycopersicum
gb|ABP65320.1|  alpha tubulin                                           240   3e-74   Capsicum annuum
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     240   4e-74   Phoenix dactylifera
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                240   4e-74   Phoenix dactylifera
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     240   4e-74   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                240   4e-74   Eucalyptus grandis [rose gum]
gb|AEF59080.1|  alpha tubulin-like protein                              235   4e-74   Phragmatopoma lapidosa
ref|XP_010096739.1|  Tubulin alpha chain                                240   4e-74   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             240   4e-74   Populus trichocarpa [western balsam poplar]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     240   4e-74   Vitis vinifera
gb|AAH33064.1|  TUBA1C protein                                          236   4e-74   Homo sapiens [man]
gb|EDL87016.1|  rCG50513, isoform CRA_b                                 236   4e-74   Rattus norvegicus [brown rat]
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   240   5e-74   Nicotiana tomentosiformis
gb|ETE59910.1|  Tubulin alpha-1A chain                                  235   5e-74   Ophiophagus hannah
ref|XP_008412910.1|  PREDICTED: tubulin alpha-1B chain-like             238   5e-74   Poecilia reticulata
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                240   5e-74   Elaeis guineensis
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             239   5e-74   Prunus persica
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                239   5e-74   Phoenix dactylifera
ref|XP_003979092.1|  PREDICTED: tubulin alpha-1B chain-like             233   5e-74   
ref|XP_003608582.1|  Tubulin alpha-5 chain                              239   5e-74   Medicago truncatula
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                239   5e-74   Daucus carota [carrots]
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    239   6e-74   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         239   6e-74   Jatropha curcas
ref|XP_007068754.1|  PREDICTED: tubulin alpha-1D chain-like             233   6e-74   
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                239   6e-74   Elaeis guineensis
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    239   6e-74   Glycine max [soybeans]
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          239   6e-74   Malus domestica [apple tree]
ref|XP_005406777.1|  PREDICTED: tubulin alpha-1A chain-like             234   6e-74   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     239   6e-74   Glycine max [soybeans]
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                239   7e-74   Cicer arietinum [garbanzo]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             239   7e-74   
ref|XP_002517492.1|  tubulin alpha chain, putative                      239   7e-74   Ricinus communis
gb|ACU19580.1|  unknown                                                 239   7e-74   Glycine max [soybeans]
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             239   7e-74   Phaseolus vulgaris [French bean]
ref|XP_005139691.1|  PREDICTED: tubulin alpha-1B chain-like             238   7e-74   
emb|CAB66336.1|  alpha-tubulin                                          239   7e-74   Betula pendula [white birch]
ref|XP_003770912.1|  PREDICTED: tubulin alpha-1C chain                  236   7e-74   
gb|AAW30624.1|  unknown                                                 231   7e-74   Sus scrofa [pigs]
ref|XP_001427644.1|  hypothetical protein                               231   7e-74   Paramecium tetraurelia strain d4-2
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    239   8e-74   Gossypium hirsutum [American cotton]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                239   8e-74   Fragaria vesca subsp. vesca
ref|XP_005452428.1|  PREDICTED: tubulin alpha-1A chain-like             234   8e-74   
ref|XP_004874971.1|  PREDICTED: tubulin alpha-3 chain-like              234   8e-74   
ref|NP_001291325.1|  tubulin alpha chain-like                           239   8e-74   Sesamum indicum [beniseed]
ref|XP_004817225.1|  PREDICTED: tubulin alpha-3 chain-like              237   8e-74   
ref|XP_007248487.1|  PREDICTED: tubulin alpha-1B chain-like             237   8e-74   
ref|XP_003976815.1|  PREDICTED: tubulin alpha-1 chain-like              230   8e-74   
gb|AFW67745.1|  alpha tubulin4                                          228   8e-74   
ref|XP_005324966.1|  PREDICTED: tubulin alpha-1B chain                  234   8e-74   
ref|XP_002763662.3|  PREDICTED: tubulin alpha chain-like                230   9e-74   
gb|KFO33466.1|  Tubulin alpha-1C chain                                  236   9e-74   Fukomys damarensis [Damara mole rat]
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          239   1e-73   
ref|XP_011475942.1|  PREDICTED: tubulin alpha chain-like                235   1e-73   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        239   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007073037.1|  PREDICTED: tubulin alpha-1C chain                  235   1e-73   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             239   1e-73   Selaginella moellendorffii
ref|XP_003603670.1|  Tubulin alpha-7 chain                              239   1e-73   Medicago truncatula
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                239   1e-73   Cicer arietinum [garbanzo]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               239   1e-73   Pisum sativum [garden pea]
ref|XP_006974484.1|  PREDICTED: tubulin alpha-1A chain-like             235   1e-73   Peromyscus maniculatus bairdii
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              238   1e-73   Nicotiana sylvestris
gb|EKC22339.1|  Tubulin alpha chain                                     234   1e-73   Crassostrea gigas
dbj|BAJ07366.1|  alpha-tubulin                                          229   1e-73   Hydatigera taeniaeformis
gb|ETN59126.1|  tubulin alpha chain                                     236   1e-73   Anopheles darlingi [American malaria mosquito]
ref|XP_009246735.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    234   1e-73   
gb|AFW67748.1|  alpha tubulin4                                          236   2e-73   
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          239   2e-73   
ref|XP_010751704.1|  PREDICTED: tubulin alpha chain                     235   2e-73   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             238   2e-73   Selaginella moellendorffii
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             238   2e-73   Selaginella moellendorffii
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             238   2e-73   Selaginella moellendorffii
gb|KEH43997.1|  tubulin beta-1 chain                                    238   2e-73   Medicago truncatula
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             238   2e-73   Phaseolus vulgaris [French bean]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             238   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             238   2e-73   Selaginella moellendorffii
gb|AHZ58482.1|  alpha-tubulin                                           232   2e-73   Syntrichia caninervis
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              238   2e-73   Selaginella moellendorffii
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     238   2e-73   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                238   2e-73   Triticum aestivum [Canadian hard winter wheat]
gb|AAB08791.1|  alpha tubulin                                           238   2e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGV54441.1|  tubulin alpha-2 chain-like protein                      238   2e-73   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             238   2e-73   
ref|XP_006168270.1|  PREDICTED: tubulin alpha-2 chain-like              236   2e-73   
gb|ABD92930.1|  alpha tubulin-2A                                        238   2e-73   
ref|XP_010852034.1|  PREDICTED: tubulin alpha-1C chain                  238   2e-73   
ref|NP_001067613.1|  Os11g0247300                                       238   2e-73   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   238   2e-73   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     238   2e-73   
gb|ABV55999.1|  alpha-tubulin 7                                         238   2e-73   
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    237   2e-73   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          238   2e-73   
ref|XP_002599490.1|  hypothetical protein BRAFLDRAFT_81006              234   2e-73   
gb|AAM73791.1|  alpha-tubulin                                           228   3e-73   
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3       233   3e-73   
ref|XP_005354088.1|  PREDICTED: tubulin alpha-1B chain                  235   3e-73   
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        238   3e-73   
gb|EHB00536.1|  Tubulin alpha-1C chain                                  238   3e-73   
ref|XP_007606030.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    236   3e-73   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     238   3e-73   
gb|ACH68563.1|  alpha-tubulin                                           238   3e-73   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             238   3e-73   
gb|EGW14703.1|  Tubulin alpha chain, nucleomorph                        236   3e-73   
ref|XP_006916969.1|  PREDICTED: tubulin alpha-1B chain                  237   3e-73   
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          238   3e-73   
pdb|3DU7|A  Chain A, Tubulin-Colchicine-Phomopsin A: Stathmin-Lik...    238   3e-73   
gb|KFM01620.1|  Tubulin alpha-1C chain                                  233   3e-73   
dbj|BAB19779.1|  alpha tubulin                                          238   3e-73   
gb|AGG37289.1|  alpha-tubulin 7                                         238   3e-73   
ref|NP_001029376.1|  tubulin alpha-1C chain                             238   3e-73   
ref|XP_005680058.1|  PREDICTED: tubulin alpha-1C chain                  238   3e-73   
tpg|DAA32343.1|  TPA: tubulin alpha-1C chain-like                       238   3e-73   
gb|AEW46684.1|  beta-tubulin                                            238   3e-73   
ref|XP_004085980.2|  PREDICTED: tubulin alpha-1D chain-like             227   3e-73   
ref|XP_001790595.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    238   3e-73   
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             238   3e-73   
ref|XP_008702766.1|  PREDICTED: tubulin alpha-1B chain-like             236   4e-73   
ref|XP_010803242.1|  PREDICTED: tubulin alpha-1C chain isoform X1       238   4e-73   
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     237   4e-73   
ref|XP_009554397.1|  PREDICTED: tubulin alpha-1A chain                  232   4e-73   
gb|AAX29832.1|  tubulin alpha 2                                         236   4e-73   
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    237   4e-73   
ref|XP_004863237.1|  PREDICTED: uncharacterized protein LOC101707673    234   4e-73   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   237   4e-73   
ref|XP_006779408.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    234   4e-73   
ref|XP_001101935.1|  PREDICTED: tubulin alpha-3C/D chain-like iso...    236   4e-73   
gb|ACK76232.1|  alpha-tubulin                                           237   4e-73   
gb|AFX62784.1|  alpha tubulin 84B                                       236   4e-73   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              237   4e-73   
gb|AFX62804.1|  alpha tubulin 84B                                       236   5e-73   
dbj|BAJ06362.1|  alpha-tubulin                                          237   5e-73   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   237   5e-73   
gb|ACY05960.1|  alpha-tubulin                                           235   5e-73   
emb|CAD32468.1|  alpha-tubulin                                          229   5e-73   
gb|AFX62789.1|  alpha tubulin 84B                                       236   5e-73   
ref|XP_007936041.1|  PREDICTED: tubulin alpha-1A chain isoform X2       237   5e-73   
gb|ACH70610.1|  alpha tubulin                                           237   5e-73   
gb|AFX62793.1|  alpha tubulin 84B                                       236   5e-73   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   237   5e-73   
gb|ELK23510.1|  Tubulin alpha chain                                     226   5e-73   
ref|XP_005745106.1|  PREDICTED: tubulin alpha-1B chain-like             236   5e-73   
ref|XP_010641177.1|  PREDICTED: tubulin alpha-3 chain                   237   5e-73   
gb|AIX10773.1|  alpha tubulin                                           237   5e-73   
gb|ABO47742.1|  alpha-tubulin                                           237   5e-73   
gb|AFX62786.1|  alpha tubulin 84B                                       236   5e-73   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    237   5e-73   
gb|AFX62802.1|  alpha tubulin 84B                                       236   5e-73   
gb|AFX62799.1|  alpha tubulin 84B                                       236   5e-73   
gb|AFX62798.1|  alpha tubulin 84B                                       236   5e-73   
gb|AFX62797.1|  alpha tubulin 84B                                       236   5e-73   
gb|AFX62791.1|  alpha tubulin 84B                                       236   5e-73   
gb|AFX62790.1|  alpha tubulin 84B                                       236   5e-73   
ref|XP_006752422.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    237   5e-73   
emb|CDQ59454.1|  unnamed protein product                                234   5e-73   
gb|AFX62805.1|  alpha tubulin 84B                                       236   5e-73   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             237   5e-73   
gb|EFO61055.1|  Alpha-tubulin                                           228   6e-73   
gb|AFX62864.1|  alpha tubulin 84B                                       236   6e-73   
gb|AFX62860.1|  alpha tubulin 84B                                       236   6e-73   
gb|AFX62858.1|  alpha tubulin 84B                                       236   6e-73   
gb|AFX62785.1|  alpha tubulin 84B                                       236   6e-73   
gb|AFX62862.1|  alpha tubulin 84B                                       236   6e-73   
gb|AFX62861.1|  alpha tubulin 84B                                       236   6e-73   
gb|AFX62788.1|  alpha tubulin 84B                                       236   6e-73   
ref|XP_005851144.1|  alpha-tubulin                                      237   6e-73   
dbj|BAE39705.1|  unnamed protein product                                237   6e-73   
ref|XP_002714140.1|  PREDICTED: tubulin alpha-1B chain-like             237   6e-73   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                237   6e-73   
gb|AFX62787.1|  alpha tubulin 84B                                       236   6e-73   
ref|XP_005986293.1|  PREDICTED: tubulin alpha-1A chain-like isofo...    237   6e-73   
pdb|4DRX|A  Chain A, Gtp-Tubulin In Complex With A Darpin               236   6e-73   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                237   6e-73   
ref|NP_001029267.1|  tubulin alpha-1B chain                             237   6e-73   
ref|XP_007179355.1|  PREDICTED: tubulin alpha-1B chain                  237   6e-73   
ref|NP_989078.1|  tubulin, alpha 1c                                     237   6e-73   
ref|NP_001165669.1|  tubulin, alpha 3e                                  237   6e-73   
gb|AFX62859.1|  alpha tubulin 84B                                       236   6e-73   
gb|AHJ80822.1|  Tua1                                                    237   6e-73   
ref|XP_005981039.1|  PREDICTED: tubulin alpha-1B chain-like             237   6e-73   
ref|XP_004032593.1|  PREDICTED: tubulin alpha-3 chain-like              236   6e-73   
ref|XP_005532035.1|  PREDICTED: tubulin alpha-1C chain isoform X2       237   7e-73   
ref|NP_001095253.1|  tubulin alpha chain                                237   7e-73   
ref|XP_004400918.1|  PREDICTED: tubulin alpha-1B chain-like             237   7e-73   
ref|XP_007107561.1|  PREDICTED: tubulin alpha-1C chain isoform X1       237   7e-73   
ref|XP_004274417.1|  PREDICTED: tubulin alpha-1C chain-like             237   7e-73   
ref|XP_006054596.1|  PREDICTED: tubulin alpha-1B chain                  237   7e-73   
ref|XP_008542826.1|  PREDICTED: tubulin alpha-3 chain-like              235   7e-73   
ref|XP_008069065.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    237   7e-73   
ref|XP_007198449.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    237   7e-73   
ref|XP_004447014.1|  PREDICTED: tubulin alpha-1C chain                  237   7e-73   
ref|XP_004863093.1|  PREDICTED: tubulin alpha-1B chain-like             237   7e-73   
gb|AFX62796.1|  alpha tubulin 84B                                       236   7e-73   
dbj|BAE34741.1|  unnamed protein product                                237   7e-73   
ref|NP_001167663.1|  tubulin alpha-3 chain                              237   7e-73   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              237   7e-73   
ref|XP_004429038.1|  PREDICTED: tubulin alpha-1B chain                  237   7e-73   
ref|XP_004400917.1|  PREDICTED: tubulin alpha-1B chain-like             237   7e-73   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   237   7e-73   
gb|AHJ80815.1|  Tua1                                                    237   7e-73   
ref|XP_002732020.1|  PREDICTED: tubulin alpha-1A chain-like             237   7e-73   
emb|CAA06619.1|  alpha-tubulin 1                                        237   7e-73   
dbj|BAK03519.1|  predicted protein                                      237   7e-73   
ref|XP_001753986.1|  predicted protein                                  237   7e-73   
gb|AAH42319.1|  Tuba1 protein                                           237   7e-73   
pdb|3J6E|A  Chain A, Energy Minimized Average Structure Of Microt...    236   7e-73   
ref|XP_003355423.1|  PREDICTED: tubulin alpha-1C chain isoformX1        236   7e-73   
ref|NP_524264.1|  alpha-Tubulin at 84D                                  236   7e-73   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    237   7e-73   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          237   7e-73   
ref|XP_005324967.1|  PREDICTED: tubulin alpha-1C chain                  236   7e-73   
ref|XP_006916875.1|  PREDICTED: tubulin alpha-1C chain                  236   8e-73   
ref|XP_002038709.1|  GM10965                                            236   8e-73   
gb|AAX29538.1|  tubulin alpha 6                                         236   8e-73   
ref|XP_008831082.1|  PREDICTED: tubulin alpha-1B chain                  236   8e-73   
ref|XP_005986295.1|  PREDICTED: tubulin alpha-1A chain-like             236   8e-73   
ref|XP_007235803.1|  PREDICTED: tubulin alpha chain-like isoform X2     236   8e-73   
ref|XP_004880762.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    236   8e-73   
sp|P36220.1|TBA_TORMA  RecName: Full=Tubulin alpha chain; AltName...    236   8e-73   
gb|AAI51892.1|  MGC171407 protein                                       236   8e-73   
ref|XP_003223237.1|  PREDICTED: tubulin alpha-1C chain                  236   8e-73   
ref|XP_004880760.1|  PREDICTED: tubulin alpha-1C chain isoform X1       236   8e-73   
ref|XP_004569650.1|  PREDICTED: tubulin alpha chain-like                236   8e-73   
ref|XP_005532033.1|  PREDICTED: tubulin alpha-1A chain isoform X3       237   8e-73   
ref|XP_006811914.1|  PREDICTED: tubulin alpha-1A chain-like             236   8e-73   
ref|XP_010348076.1|  PREDICTED: tubulin alpha-1C chain                  236   8e-73   
pdb|1TUB|A  Chain A, Tubulin Alpha-Beta Dimer, Electron Diffraction     236   8e-73   
gb|AAA91576.1|  alpha-tubulin                                           236   8e-73   
ref|XP_010594690.1|  PREDICTED: tubulin alpha-1C chain                  236   8e-73   
ref|NP_919369.2|  tubulin alpha-1C chain                                236   8e-73   
dbj|BAJ98211.1|  predicted protein                                      236   8e-73   
gb|AAB84143.1|  alpha-tubulin                                           236   8e-73   
ref|XP_006035257.1|  PREDICTED: tubulin alpha-1B chain                  236   8e-73   
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              236   8e-73   
gb|AHJ80816.1|  Tua1                                                    236   8e-73   
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              236   8e-73   
ref|XP_004599950.1|  PREDICTED: tubulin alpha-3 chain-like              234   8e-73   
gb|AHJ80817.1|  Tua1                                                    236   8e-73   
ref|NP_035784.1|  tubulin alpha-1B chain                                236   8e-73   
ref|XP_005532034.1|  PREDICTED: tubulin alpha-1C chain isoform X1       236   8e-73   
ref|XP_005061430.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    236   8e-73   
ref|XP_010348074.1|  PREDICTED: tubulin alpha-1B chain                  236   8e-73   
ref|XP_011282203.1|  PREDICTED: tubulin alpha-1C chain                  236   8e-73   
ref|XP_009001973.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    236   8e-73   
ref|XP_006131233.1|  PREDICTED: tubulin alpha-1C chain                  236   8e-73   
ref|XP_004880763.1|  PREDICTED: tubulin alpha-1B chain-like             236   8e-73   
ref|NP_001098596.2|  tubulin alpha-1B chain                             236   8e-73   
gb|AAH83344.1|  Tubulin, alpha 1A                                       236   8e-73   
ref|XP_010971611.1|  PREDICTED: tubulin alpha-1C chain-like             236   8e-73   
ref|XP_006168269.1|  PREDICTED: tubulin alpha-1C chain                  236   8e-73   
ref|XP_008580941.1|  PREDICTED: tubulin alpha-1C chain                  236   8e-73   
ref|NP_116093.1|  tubulin alpha-1C chain isoform c                      236   8e-73   
ref|XP_011233044.1|  PREDICTED: tubulin alpha-1B chain                  236   8e-73   
ref|XP_003765945.1|  PREDICTED: tubulin alpha-1D chain-like             236   8e-73   
ref|XP_008144051.1|  PREDICTED: tubulin alpha-1C chain                  236   8e-73   
dbj|BAN20459.1|  tubulin alpha chain                                    236   8e-73   
gb|AAX29190.1|  tubulin alpha 3                                         236   8e-73   
ref|XP_005709455.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    236   9e-73   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             236   9e-73   
ref|XP_010383709.1|  PREDICTED: tubulin alpha-1C chain                  236   9e-73   
emb|CDQ72000.1|  unnamed protein product                                236   9e-73   
ref|XP_002718632.1|  PREDICTED: tubulin alpha-1C chain-like             236   9e-73   
ref|XP_004429035.1|  PREDICTED: tubulin alpha-1C chain isoform 1        236   9e-73   
sp|P02550.1|TBA1A_PIG  RecName: Full=Tubulin alpha-1A chain; AltN...    236   9e-73   
ref|NP_033474.1|  tubulin alpha-1C chain                                236   9e-73   
ref|NP_001011995.1|  tubulin alpha-1C chain                             236   9e-73   
dbj|BAE29999.1|  unnamed protein product                                236   9e-73   
dbj|BAF82043.1|  unnamed protein product                                236   9e-73   
ref|XP_001504231.1|  PREDICTED: tubulin alpha-1C chain isoform 1        236   9e-73   
ref|XP_005809818.1|  PREDICTED: tubulin alpha-1B chain-like             236   9e-73   
ref|XP_008400581.1|  PREDICTED: tubulin alpha-1B chain-like             236   1e-72   
pdb|1JFF|A  Chain A, Refined Structure Of Alpha-beta Tubulin From...    236   1e-72   
ref|XP_005353993.1|  PREDICTED: tubulin alpha-1C chain isoform X1       236   1e-72   
ref|XP_005532031.1|  PREDICTED: tubulin alpha-1A chain isoform X1       236   1e-72   
pdb|1Z2B|A  Chain A, Tubulin-Colchicine-Vinblastine: Stathmin-Lik...    236   1e-72   
gb|AAM73790.1|  alpha-tubulin                                           226   1e-72   
dbj|BAD96744.1|  tubulin alpha 6 variant                                236   1e-72   
gb|AAH57810.1|  Tubulin, alpha 3d                                       236   1e-72   
pdb|2XRP|B  Chain B, Human Doublecortin N-Dc Repeat (1mjd) And Ma...    236   1e-72   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              236   1e-72   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              236   1e-72   
ref|NP_001033252.1|  tubulin alpha-3 chain                              236   1e-72   
ref|XP_007426281.1|  PREDICTED: tubulin alpha-1A chain isoform X3       236   1e-72   
gb|AIV98130.1|  tubulin alpha-2                                         236   1e-72   
ref|XP_008831083.1|  PREDICTED: tubulin alpha-1B chain-like             236   1e-72   
prf||0812252A  tubulin alpha                                            236   1e-72
ref|XP_005324965.1|  PREDICTED: tubulin alpha-1A chain                  236   1e-72   
gb|ELR55924.1|  hypothetical protein M91_03110                          234   1e-72   
ref|XP_008317371.1|  PREDICTED: tubulin alpha chain-like                236   1e-72   
gb|ACQ58153.1|  Tubulin alpha chain                                     236   1e-72   
ref|NP_035783.1|  tubulin alpha-1A chain                                236   1e-72   
ref|XP_005023678.1|  PREDICTED: tubulin alpha-3 chain-like              236   1e-72   
gb|AAH62238.1|  Tubulin, alpha 1A                                       236   1e-72   
ref|XP_003215119.2|  PREDICTED: tubulin alpha-1D chain-like             236   1e-72   
ref|XP_004878662.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    236   1e-72   
ref|XP_003793653.1|  PREDICTED: tubulin alpha-1C chain isoform 2        236   1e-72   
ref|XP_002783368.1|  alpha tubulin, putative                            227   1e-72   
emb|CDQ99132.1|  unnamed protein product                                226   1e-72   
ref|XP_007501737.1|  PREDICTED: tubulin alpha-1D chain-like             236   1e-72   
ref|XP_005330562.1|  PREDICTED: tubulin alpha-1D chain-like             236   1e-72   
ref|XP_008561381.1|  PREDICTED: tubulin alpha-3 chain                   236   1e-72   
pdb|1SA0|A  Chain A, Tubulin-Colchicine: Stathmin-Like Domain Com...    236   1e-72   
ref|XP_006008956.1|  PREDICTED: tubulin alpha-1A chain-like             236   1e-72   



>ref|NP_001275472.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABA46784.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=237

 Score =   243 bits (619),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ACU24494.1| unknown [Glycine max]
Length=173

 Score =   240 bits (613),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   243 bits (621),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   239 bits (610),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_001786415.1| predicted protein [Physcomitrella patens]
 gb|EDQ48774.1| predicted protein, partial [Physcomitrella patens]
Length=127

 Score =   236 bits (603),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   242 bits (617),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   239 bits (609),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABF13307.1| alpha-tubulin [Phaseolus vulgaris]
Length=132

 Score =   234 bits (598),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AAI59362.1| Unknown (protein for MGC:185872) [Xenopus (Silurana) tropicalis]
Length=145

 Score =   235 bits (599),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN++RGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYSRGHYTIGK  112



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   237 bits (604),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_005932718.1| PREDICTED: tubulin alpha chain-like [Haplochromis burtoni]
Length=142

 Score =   234 bits (598),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   244 bits (624),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/114 (99%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +2

Query  119  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  298
            +KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  62

Query  299  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  63   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  116



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006433709.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
 gb|ESR46949.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
Length=153

 Score =   234 bits (598),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_003793694.1| PREDICTED: tubulin alpha chain-like [Otolemur garnettii]
Length=142

 Score =   234 bits (597),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|ERE81184.1| tubulin alpha-1C chain [Cricetulus griseus]
Length=197

 Score =   236 bits (602),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  36   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  95

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  96   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  147



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   244 bits (622),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   244 bits (624),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   243 bits (621),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_005466520.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score =   234 bits (597),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002609253.1| hypothetical protein BRAFLDRAFT_86837 [Branchiostoma floridae]
 gb|EEN65263.1| hypothetical protein BRAFLDRAFT_86837, partial [Branchiostoma 
floridae]
Length=125

 Score =   233 bits (595),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|AAW30622.1| unknown, partial [Sus scrofa]
Length=189

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AAW30623.1| unknown [Sus scrofa]
Length=201

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_008294350.1| PREDICTED: tubulin alpha chain [Stegastes partitus]
Length=202

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_005932717.1| PREDICTED: tubulin alpha-1B chain-like [Haplochromis burtoni]
Length=243

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_004599399.1| PREDICTED: tubulin alpha-1B chain, partial [Ochotona princeps]
Length=231

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>dbj|BAE01779.1| unnamed protein product [Macaca fascicularis]
Length=251

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>emb|CAJ26346.1| alpha-tubulin [Platynereis dumerilii]
Length=190

 Score =   234 bits (598),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_003392163.2| PREDICTED: tubulin alpha chain, testis-specific-like, partial 
[Amphimedon queenslandica]
Length=163

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYT+GK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGK  112



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|EPZ32931.1| Tubulin domain-containing protein [Rozella allomycis CSF55]
Length=144

 Score =   233 bits (594),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPR VFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRTVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_005906298.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-1 chain-like [Bos 
mutus]
Length=202

 Score =   235 bits (599),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSE GAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSEMGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGK  112



>ref|XP_005466564.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score =   233 bits (593),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVR+GTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_005801996.1| PREDICTED: tubulin alpha-1B chain-like, partial [Xiphophorus 
maculatus]
Length=255

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006056311.1| PREDICTED: tubulin alpha-1B chain-like, partial [Bubalus bubalis]
Length=233

 Score =   236 bits (601),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006264720.1| PREDICTED: tubulin alpha-1C chain [Alligator mississippiensis]
Length=159

 Score =   233 bits (594),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQP GQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPXGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010726225.1| PREDICTED: tubulin alpha chain-like, partial [Meleagris gallopavo]
Length=181

 Score =   234 bits (596),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  95   VCSSNSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFN  274
            + S   S    RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FN
Sbjct  3    ISSQTPSLTPQRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN  62

Query  275  TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTI  454
            TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTI
Sbjct  63   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTI  122

Query  455  GK  460
            GK
Sbjct  123  GK  124



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006109205.1| PREDICTED: tubulin alpha-1D chain-like, partial [Myotis lucifugus]
Length=223

 Score =   235 bits (600),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_003979912.1| PREDICTED: tubulin alpha-1D chain-like, partial [Takifugu rubripes]
Length=121

 Score =   231 bits (590),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAG+Q+GNACWELYCLEHGIQPDG MPSDKTVGGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGVQIGNACWELYCLEHGIQPDGLMPSDKTVGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYT+GK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGK  112



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006601463.1| PREDICTED: tubulin alpha-3 chain-like [Glycine max]
Length=432

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_004778983.1| PREDICTED: tubulin alpha-1C chain [Mustela putorius furo]
Length=249

 Score =   236 bits (602),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AAG49533.3| alpha tubulin [Glossina morsitans morsitans]
Length=278

 Score =   237 bits (604),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKTVGGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008969760.1| PREDICTED: tubulin alpha chain-like [Pan paniscus]
Length=194

 Score =   234 bits (596),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AIK29207.1| putative alpha-tubulin, partial [Cynoglossus semilaevis]
Length=270

 Score =   236 bits (603),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_011366648.1| PREDICTED: tubulin alpha-1C chain-like [Pteropus vampyrus]
Length=301

 Score =   237 bits (605),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_007426287.1| PREDICTED: tubulin alpha-1C chain [Python bivittatus]
Length=256

 Score =   236 bits (601),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFIDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006895063.1| PREDICTED: tubulin alpha-1B chain-like [Elephantulus edwardii]
Length=249

 Score =   235 bits (600),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_010500556.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
Length=462

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABO33166.1| alpha tubulin a2 [Mesenchytraeus solifugus]
Length=241

 Score =   235 bits (599),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008372962.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=438

 Score =   241 bits (615),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_005801995.1| PREDICTED: tubulin alpha-1A chain-like, partial [Xiphophorus 
maculatus]
Length=256

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVR+GTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008575749.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3E chain [Galeopterus 
variegatus]
Length=308

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|AIJ27191.1| alpha-tubulin 1a, partial [Mytilus galloprovincialis]
Length=271

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQL++GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLVTGKEDAANNYARGHYTIGK  112



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|EDL87015.1| rCG50513, isoform CRA_a [Rattus norvegicus]
Length=319

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_007663362.1| PREDICTED: tubulin alpha chain-like, partial [Ornithorhynchus 
anatinus]
Length=144

 Score =   231 bits (590),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 115/117 (98%), Gaps = 1/117 (1%)
 Frame = +2

Query  110  SSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSE  289
            +SF + RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSE
Sbjct  3    TSFPQ-RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSE  61

Query  290  TGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            TGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  62   TGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  118



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008475351.1| PREDICTED: tubulin alpha-1 chain-like [Diaphorina citri]
Length=307

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKTVGGGDD+FNTFFSETG+GK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_006264718.1| PREDICTED: tubulin alpha chain-like [Alligator mississippiensis]
Length=158

 Score =   232 bits (591),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYT GK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTXGK  112



>ref|XP_008172101.1| PREDICTED: tubulin alpha-1B chain [Chrysemys picta bellii]
Length=279

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFADLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|KGL81705.1| Tubulin alpha-1C chain, partial [Tinamus guttatus]
Length=239

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/111 (94%), Positives = 111/111 (100%), Gaps = 0/111 (0%)
 Frame = +2

Query  128  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  307
            RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGKH
Sbjct  1    RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH  60

Query  308  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  111



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008317242.1| PREDICTED: tubulin alpha-1C chain-like, partial [Cynoglossus 
semilaevis]
Length=307

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|AGE09583.1| TUA1-like protein [Eucalyptus cladocalyx]
 gb|KCW68570.1| hypothetical protein EUGRSUZ_F02183 [Eucalyptus grandis]
Length=420

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  107  NSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFS  286
             S+  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFS
Sbjct  45   QSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFS  104

Query  287  ETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            ETG+GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  105  ETGSGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  162



>ref|XP_003804211.2| PREDICTED: tubulin alpha-3E chain [Pan paniscus]
Length=145

 Score =   231 bits (589),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+ GGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTISGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +2

Query  119  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  298
            AKMRECISIHIG+AGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGA
Sbjct  36   AKMRECISIHIGRAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGA  95

Query  299  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  96   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  149



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|KIY93466.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=193

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/112 (95%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPR +F+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRCIFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010995722.1| PREDICTED: tubulin alpha-1B chain, partial [Camelus dromedarius]
Length=339

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006264719.1| PREDICTED: tubulin alpha-1A chain [Alligator mississippiensis]
Length=340

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            +VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   YVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPADKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AAC97930.1| alpha tubulin, partial [Notothenia coriiceps]
Length=168

 Score =   231 bits (590),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDG+MPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGRMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGIYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_004617224.1| PREDICTED: tubulin alpha-1D chain-like [Sorex araneus]
Length=200

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            +RECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  20   VRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  79

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  80   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  131



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ADW66593.1| alpha tubulin [Hirschfeldia incana]
Length=355

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +2

Query  131  ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  310
            ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV
Sbjct  1    ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  60

Query  311  PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  110



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006606007.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=437

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010461854.1| PREDICTED: tubulin alpha-6 chain-like [Camelina sativa]
Length=450

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AII97815.1| BLTX443 [Nephila pilipes]
Length=274

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+H+GQAG+QVGNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAV+VDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVYVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRPGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002110664.1| alpha tubulin [Trichoplax adhaerens]
 gb|EDV26668.1| alpha tubulin [Trichoplax adhaerens]
Length=265

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+G GDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGYGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANN+ARGHYT+GK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTVGK  112



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABS57456.1| alpha-tubulin [Heliconius melpomene]
Length=221

 Score =   233 bits (594),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMP+DKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006589612.1| PREDICTED: tubulin alpha chain-like isoform X2 [Glycine max]
Length=449

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGN+CWELYC+EHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCVEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AEF59080.1| alpha tubulin-like protein [Phragmatopoma lapidosa]
Length=301

 Score =   235 bits (600),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GN CWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNGCWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|AAH33064.1| TUBA1C protein [Homo sapiens]
Length=325

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>gb|EDL87016.1| rCG50513, isoform CRA_b [Rattus norvegicus]
Length=325

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            +RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  7    LRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  66

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  67   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  118



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ETE59910.1| Tubulin alpha-1A chain, partial [Ophiophagus hannah]
Length=310

 Score =   235 bits (600),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +2

Query  122  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAG  301
            K+RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAG
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAG  183

Query  302  KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  184  KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  236


 Score =   235 bits (599),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_008412910.1| PREDICTED: tubulin alpha-1B chain-like [Poecilia reticulata]
Length=381

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGT+RQLFHPEQLI+GKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTFRQLFHPEQLINGKEDAANNFARGHYTIGK  112



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_003979092.1| PREDICTED: tubulin alpha-1B chain-like, partial [Takifugu rubripes]
Length=236

 Score =   233 bits (594),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 103/111 (93%), Positives = 111/111 (100%), Gaps = 0/111 (0%)
 Frame = +2

Query  128  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  307
            RECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGKH
Sbjct  47   RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGKH  106

Query  308  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  107  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  157



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>sp|Q9FT36.1|TBA_DAUCA RecName: Full=Tubulin alpha chain [Daucus carota]
 gb|AAG02564.1| alpha-tubulin [Daucus carota]
Length=451

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/112 (96%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQ+GNACWELYCLEHGIQP+GQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQIGNACWELYCLEHGIQPNGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_006573681.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Glycine max]
Length=424

 Score =   239 bits (609),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_007068754.1| PREDICTED: tubulin alpha-1D chain-like [Chelonia mydas]
Length=234

 Score =   233 bits (593),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 103/111 (93%), Positives = 111/111 (100%), Gaps = 0/111 (0%)
 Frame = +2

Query  128  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  307
            RECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGKH
Sbjct  41   RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH  100

Query  308  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  101  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  151



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_005406777.1| PREDICTED: tubulin alpha-1A chain-like [Chinchilla lanigera]
Length=287

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +2

Query  119  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  298
            ++ RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGA
Sbjct  4    SRPRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGA  63

Query  299  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  64   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  117



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   239 bits (611),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG MPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_007155784.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
 gb|ESW27778.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
Length=450

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_005139691.1| PREDICTED: tubulin alpha-1B chain-like, partial [Melopsittacus 
undulatus]
Length=407

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +2

Query  122  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAG  301
            K+RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAG
Sbjct  66   KLRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAG  125

Query  302  KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  126  KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  178


 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  341  TVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            ++ DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  15   SLADEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  54



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_003770912.1| PREDICTED: tubulin alpha-1C chain [Sarcophilus harrisii]
Length=334

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKED ANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDVANNYARGHYTIGK  112



>gb|AAW30624.1| unknown [Sus scrofa]
Length=193

 Score =   231 bits (589),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FN FFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNAFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_001427644.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK60246.1| unnamed protein product [Paramecium tetraurelia]
Length=189

 Score =   231 bits (588),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/112 (95%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIH+GQ GIQVGNACWEL+CLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQGGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   239 bits (610),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAF TFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFYTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   239 bits (610),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_005452428.1| PREDICTED: tubulin alpha-1A chain-like [Oreochromis niloticus]
Length=292

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MREC+S+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECLSVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_004874971.1| PREDICTED: tubulin alpha-3 chain-like [Heterocephalus glaber]
Length=299

 Score =   234 bits (598),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTTGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   239 bits (610),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDQTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  112



>ref|XP_004817225.1| PREDICTED: tubulin alpha-3 chain-like [Mustela putorius furo]
Length=376

 Score =   237 bits (604),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_007248487.1| PREDICTED: tubulin alpha-1B chain-like, partial [Astyanax mexicanus]
Length=384

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_003976815.1| PREDICTED: tubulin alpha-1 chain-like, partial [Takifugu rubripes]
Length=180

 Score =   230 bits (587),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDG+MPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGRMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEP+VIDEVR+GTYRQLFHPEQLI+GKEDAANN+ARGHYT+GK
Sbjct  61   HVPRAVFVDLEPSVIDEVRSGTYRQLFHPEQLITGKEDAANNYARGHYTVGK  112



>gb|AFW67745.1| alpha tubulin4 [Zea mays]
Length=111

 Score =   228 bits (581),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT  451
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT  109



>ref|XP_005324966.1| PREDICTED: tubulin alpha-1B chain [Ictidomys tridecemlineatus]
Length=294

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



>ref|XP_002763662.3| PREDICTED: tubulin alpha chain-like, partial [Callithrix jacchus]
Length=178

 Score =   230 bits (587),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  101  SSNSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTF  280
            SS        ECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTF
Sbjct  40   SSPRGSGPRHECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTF  99

Query  281  FSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            FSETGAGKHVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  100  FSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  159



>gb|KFO33466.1| Tubulin alpha-1C chain [Fukomys damarensis]
Length=343

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYTIGK
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGK  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563956788320