BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H14

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618477.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    141   2e-39   Nicotiana tomentosiformis
ref|XP_009787960.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    139   8e-39   Nicotiana sylvestris
emb|CDP02656.1|  unnamed protein product                                137   5e-38   Coffea canephora [robusta coffee]
ref|XP_011073657.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    136   1e-37   Sesamum indicum [beniseed]
ref|XP_004231959.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    135   3e-37   Solanum lycopersicum
ref|XP_006357740.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    131   1e-35   Solanum tuberosum [potatoes]
ref|XP_011099431.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    130   2e-35   Sesamum indicum [beniseed]
ref|NP_001236940.1|  uncharacterized protein LOC100527245               130   3e-35   Glycine max [soybeans]
ref|NP_001236314.1|  uncharacterized protein LOC100499808               130   4e-35   Glycine max [soybeans]
ref|XP_010028042.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    129   5e-35   Eucalyptus grandis [rose gum]
ref|XP_010526694.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    129   7e-35   Tarenaya hassleriana [spider flower]
ref|XP_002531993.1|  cytochrome-c oxidase, putative                     129   1e-34   Ricinus communis
gb|AFK34929.1|  unknown                                                 128   2e-34   Lotus japonicus
ref|XP_004155214.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    127   4e-34   
ref|XP_008342645.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    126   1e-33   Malus domestica [apple tree]
ref|XP_009375885.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    125   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_008450167.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    125   2e-33   Cucumis melo [Oriental melon]
ref|XP_006600132.1|  PREDICTED: uncharacterized protein LOC100499...    125   2e-33   Glycine max [soybeans]
ref|XP_010531320.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    124   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_004509040.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    125   4e-33   Cicer arietinum [garbanzo]
gb|KGN56323.1|  hypothetical protein Csa_3G115610                       124   5e-33   Cucumis sativus [cucumbers]
ref|XP_002264013.2|  PREDICTED: cytochrome c oxidase subunit 6a, ...    124   8e-33   
gb|ACF87866.1|  unknown                                                 124   9e-33   Zea mays [maize]
emb|CBI41023.3|  unnamed protein product                                124   9e-33   Vitis vinifera
gb|KJB18103.1|  hypothetical protein B456_003G034000                    124   1e-32   Gossypium raimondii
ref|XP_009400031.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    123   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG27928.1|  Cytochrome c oxidase subunit 6a, mitochondrial -l...    122   4e-32   Gossypium arboreum [tree cotton]
ref|NP_001142528.1|  uncharacterized protein LOC100274770               122   4e-32   
ref|XP_010245620.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    122   4e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010555434.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    122   5e-32   Tarenaya hassleriana [spider flower]
ref|XP_009419514.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    122   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU41359.1|  hypothetical protein MIMGU_mgv1a016898mg                122   6e-32   Erythranthe guttata [common monkey flower]
ref|XP_009109396.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    121   1e-31   Brassica rapa
ref|NP_001145536.1|  uncharacterized protein LOC100278971               120   1e-31   
gb|ACG24652.1|  hypothetical protein                                    120   1e-31   Zea mays [maize]
ref|NP_001051412.1|  Os03g0772800                                       120   2e-31   
ref|XP_010248259.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    120   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006411847.1|  hypothetical protein EUTSA_v10026651mg             120   3e-31   Eutrema salsugineum [saltwater cress]
ref|XP_007155785.1|  hypothetical protein PHAVU_003G231600g             120   3e-31   Phaseolus vulgaris [French bean]
ref|XP_006284822.1|  hypothetical protein CARUB_v10006101mg             119   5e-31   Capsella rubella
gb|AIZ06012.1|  hypothetical protein                                    119   6e-31   Zea nicaraguensis
ref|XP_003608580.1|  hypothetical protein MTR_4g097800                  118   1e-30   Medicago truncatula
ref|XP_010680777.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    118   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007207509.1|  hypothetical protein PRUPE_ppa013816mg             118   1e-30   Prunus persica
ref|XP_010432025.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    118   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006650664.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    117   2e-30   Oryza brachyantha
ref|XP_010446618.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    117   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_004288295.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    117   3e-30   Fragaria vesca subsp. vesca
ref|NP_195496.1|  cytochrome c oxidase subunit 6a                       117   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866930.1|  hypothetical protein ARALYDRAFT_912546             117   5e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_010936221.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    117   5e-30   
emb|CDY54215.1|  BnaA04g28190D                                          116   6e-30   Brassica napus [oilseed rape]
ref|XP_002466380.1|  hypothetical protein SORBIDRAFT_01g006750          116   6e-30   Sorghum bicolor [broomcorn]
emb|CDX69334.1|  BnaC01g01190D                                          116   6e-30   
ref|XP_008790423.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    116   8e-30   
ref|XP_004981603.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    116   9e-30   Setaria italica
ref|XP_009132836.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    115   2e-29   Brassica rapa
gb|AGN12790.1|  cytochrome c oxidase subunit Via                        115   3e-29   Leavenworthia alabamica
ref|XP_010229196.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    113   8e-29   Brachypodium distachyon [annual false brome]
ref|XP_011021816.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    112   2e-28   Populus euphratica
gb|ABK95790.1|  unknown                                                 112   3e-28   Populus trichocarpa [western balsam poplar]
gb|AAM66133.1|  unknown                                                 112   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006466401.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    111   8e-28   Citrus sinensis [apfelsine]
ref|XP_006426167.1|  hypothetical protein CICLE_v10026828mg             109   3e-27   Citrus clementina [clementine]
gb|KDP32136.1|  hypothetical protein JCGZ_12597                         109   4e-27   Jatropha curcas
gb|KFK30393.1|  hypothetical protein AALP_AA7G255200                    108   9e-27   Arabis alpina [alpine rockcress]
ref|XP_004155213.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    109   9e-27   
ref|XP_010943337.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    108   2e-26   Elaeis guineensis
emb|CDY49676.1|  BnaC03g61230D                                          106   5e-26   Brassica napus [oilseed rape]
dbj|BAK01482.1|  predicted protein                                      106   6e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010245619.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    103   6e-25   Nelumbo nucifera [Indian lotus]
ref|XP_007047646.1|  Cytochrome c oxidase-related                       103   9e-25   
ref|XP_004981602.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...    103   1e-24   
gb|AGL09475.1|  cytochrome c oxidase-related protein                  99.4    3e-23   Hydnora visseri
gb|ABK21401.1|  unknown                                               97.1    2e-22   Picea sitchensis
ref|XP_010939471.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  96.3    6e-22   
ref|XP_009354589.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  95.5    7e-22   Pyrus x bretschneideri [bai li]
ref|XP_002310323.2|  hypothetical protein POPTR_0007s14540g           95.9    1e-21   
ref|XP_006367050.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  95.1    1e-21   Solanum tuberosum [potatoes]
gb|KDO78785.1|  hypothetical protein CISIN_1g034187mg                 95.1    1e-21   Citrus sinensis [apfelsine]
gb|KHG23477.1|  Cytochrome c oxidase subunit 6a, mitochondrial -l...  94.7    2e-21   Gossypium arboreum [tree cotton]
ref|XP_002440668.1|  hypothetical protein SORBIDRAFT_09g004850        94.7    3e-21   Sorghum bicolor [broomcorn]
ref|XP_006360393.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  94.0    3e-21   Solanum tuberosum [potatoes]
gb|KJB43993.1|  hypothetical protein B456_007G228300                  92.8    7e-21   Gossypium raimondii
ref|XP_004234642.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  92.0    1e-20   Solanum lycopersicum
ref|XP_009354607.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  92.0    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_008785704.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  92.4    3e-20   
ref|XP_009766324.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  92.0    4e-20   Nicotiana sylvestris
gb|EMT05051.1|  hypothetical protein F775_28590                       92.0    4e-20   
gb|EMS53722.1|  hypothetical protein TRIUR3_01395                     89.0    1e-19   Triticum urartu
ref|NP_001078510.1|  cytochrome c oxidase subunit 6a                  89.0    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941974.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  90.1    3e-19   
ref|XP_010941975.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  88.6    4e-19   Elaeis guineensis
gb|EMS62770.1|  hypothetical protein TRIUR3_33892                     86.3    2e-18   Triticum urartu
ref|XP_008776851.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  82.4    8e-17   Phoenix dactylifera
ref|XP_008367805.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  79.0    4e-15   
ref|XP_010099395.1|  hypothetical protein L484_007758                 78.2    4e-15   
ref|XP_011401533.1|  hypothetical protein F751_0787                   75.9    2e-14   Auxenochlorella protothecoides
dbj|BAK06331.1|  predicted protein                                    73.9    6e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006852768.1|  hypothetical protein AMTR_s00033p00138450        71.2    7e-13   
ref|XP_001764988.1|  predicted protein                                68.9    8e-12   
ref|XP_001762163.1|  predicted protein                                68.2    2e-11   
tpg|DAA51649.1|  TPA: hypothetical protein ZEAMMB73_591450            58.5    2e-08   
ref|XP_005651687.1|  hypothetical protein COCSUDRAFT_52086            59.3    2e-08   Coccomyxa subellipsoidea C-169
ref|XP_005842874.1|  hypothetical protein CHLNCDRAFT_142490           58.9    2e-08   Chlorella variabilis
gb|KJB18102.1|  hypothetical protein B456_003G034000                  57.8    3e-08   Gossypium raimondii
gb|KDD75740.1|  hypothetical protein H632_c522p1                      56.2    1e-07   Helicosporidium sp. ATCC 50920
ref|XP_010913207.1|  PREDICTED: cytochrome c oxidase subunit 6a, ...  50.1    6e-05   Elaeis guineensis
ref|XP_002993085.1|  hypothetical protein SELMODRAFT_449005           52.0    7e-05   
ref|XP_001421755.1|  predicted protein                                48.1    9e-05   Ostreococcus lucimarinus CCE9901
ref|XP_007298972.1|  X15341 cytochrome C oxidase subunit              48.1    2e-04   Stereum hirsutum FP-91666 SS1
ref|XP_001773110.1|  predicted protein                                46.6    8e-04   
ref|XP_007508481.1|  predicted protein                                45.4    8e-04   Bathycoccus prasinos



>ref|XP_009618477.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Nicotiana 
tomentosiformis]
Length=100

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFss-sahhdeaaeasKWEKITYAGIVACTILA  192
            MA+ + RSSIRSALRGG  R  PASKR+ SS S+  +EA EASKWEKITY GIV+CTILA
Sbjct  1    MATAMFRSSIRSALRGGAPRVTPASKRTLSSHSSVEEEAREASKWEKITYVGIVSCTILA  60

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            A+ LSKGHPH +EPPAY Y+HIRNKEFPWGPDGLFEVKHH
Sbjct  61   AICLSKGHPHSDEPPAYSYLHIRNKEFPWGPDGLFEVKHH  100



>ref|XP_009787960.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Nicotiana 
sylvestris]
Length=100

 Score =   139 bits (350),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFss-sahhdeaaeasKWEKITYAGIVACTILA  192
            MA+ + RSSIRSALR G  R  PASKR+FSS S+  +EA EASKWEKITY GIV+C+ILA
Sbjct  1    MATAMFRSSIRSALRSGAPRVTPASKRTFSSHSSVEEEAREASKWEKITYVGIVSCSILA  60

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            A+ LSKGHPH +EPPAY Y+HIRNKEFPWGPDGLFEVKHH
Sbjct  61   AICLSKGHPHSDEPPAYSYLHIRNKEFPWGPDGLFEVKHH  100



>emb|CDP02656.1| unnamed protein product [Coffea canephora]
Length=101

 Score =   137 bits (346),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPA--SKRSFsssahhdeaaeasKWEKITYAGIVACTIL  189
            MAS IVRS +RSA+RGG SR APA  SKR+FS+SAHHDEAAEASKWEKITY GI  C+ L
Sbjct  1    MASAIVRSGLRSAIRGGASRTAPAPASKRTFSASAHHDEAAEASKWEKITYLGIATCSTL  60

Query  190  AAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            A  NLSKGH H EEPP YPY+HIRNKEFPWGPDGLFE KHH
Sbjct  61   AVYNLSKGHHHHEEPPPYPYLHIRNKEFPWGPDGLFEEKHH  101



>ref|XP_011073657.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Sesamum indicum]
Length=101

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVS--RRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTIL  189
            MA+ IVRS +RSALRGG S  R + ASKRSF+SSAHHDEAAEASKWEKITY  I  CT+L
Sbjct  1    MATVIVRSGLRSALRGGASTPRVSAASKRSFASSAHHDEAAEASKWEKITYLAIATCTVL  60

Query  190  AAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            +  NLSKGHPH EEPP Y Y+HIRNKEFPWGPDGLFEVKHH
Sbjct  61   SIYNLSKGHPHHEEPPPYQYLHIRNKEFPWGPDGLFEVKHH  101



>ref|XP_004231959.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Solanum 
lycopersicum]
Length=100

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFss-sahhdeaaeasKWEKITYAGIVACTILA  192
            MA+ + RSSIRSALRG   R  PA KR+FSS ++  +EA EASKWEKITY  I++ TILA
Sbjct  1    MATAMFRSSIRSALRGRAPRVTPAPKRTFSSHASVEEEAREASKWEKITYVAIISSTILA  60

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             VNLSKGHPH EEPPAYPY+HIRNKEFPWGPDGLFE KHH
Sbjct  61   VVNLSKGHPHSEEPPAYPYLHIRNKEFPWGPDGLFESKHH  100



>ref|XP_006357740.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Solanum tuberosum]
Length=100

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFss-sahhdeaaeasKWEKITYAGIVACTILA  192
            MA+ + RSSI S LRG   R  PA KR+FSS ++  +EA EASKWEKITY  I++ TILA
Sbjct  1    MATAMFRSSILSTLRGRAPRVTPAPKRTFSSHASVEEEAREASKWEKITYVAIISSTILA  60

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             VNLSKGHPH EEPPAYPY+HIRNKEFPWGPDGLFE KHH
Sbjct  61   VVNLSKGHPHSEEPPAYPYLHIRNKEFPWGPDGLFESKHH  100



>ref|XP_011099431.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Sesamum 
indicum]
Length=101

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 2/101 (2%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVS--RRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTIL  189
            MA+ IVRS +RSALRGG S  R +PAS+RSF+SS+HHDEAAEA+KWEKITY GI  C+IL
Sbjct  1    MATAIVRSGLRSALRGGASAPRASPASRRSFASSSHHDEAAEAAKWEKITYLGIATCSIL  60

Query  190  AAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            A  NLSKGHPH EEPPAYPY+HIRNKEFPWGPDGLFE KHH
Sbjct  61   AIYNLSKGHPHHEEPPAYPYLHIRNKEFPWGPDGLFESKHH  101



>ref|NP_001236940.1| uncharacterized protein LOC100527245 [Glycine max]
 gb|ACU16300.1| unknown [Glycine max]
 gb|KHN47564.1| Cytochrome c oxidase subunit 6a, mitochondrial [Glycine soja]
Length=102

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 2/100 (2%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA+++VRS  +RSALRG  +R +   KR+F+SS HHD+A E +KWEKITY GIV+CT LA
Sbjct  1    MATSLVRSGFLRSALRGS-ARGSQVPKRNFASSGHHDDAYETAKWEKITYLGIVSCTGLA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPHF+EPPAYPY+HIRNKEFPWGPDGLFE KHH
Sbjct  60   VYNLSKGHPHFKEPPAYPYLHIRNKEFPWGPDGLFETKHH  99



>ref|NP_001236314.1| uncharacterized protein LOC100499808 [Glycine max]
 gb|ACU13739.1| unknown [Glycine max]
 gb|KHN01710.1| Cytochrome c oxidase subunit 6a, mitochondrial [Glycine soja]
Length=102

 Score =   130 bits (326),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA+++VRS  +RSALRG  +R +   KR+F+SS HHD+A E +KWEKITY GIV CT LA
Sbjct  1    MATSLVRSGFLRSALRG-RARSSQVPKRNFASSGHHDDAYETAKWEKITYLGIVGCTGLA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPHF+EPPAYPY+HIRNKEFPWGPDGLFE KHH
Sbjct  60   VYNLSKGHPHFKEPPAYPYLHIRNKEFPWGPDGLFETKHH  99



>ref|XP_010028042.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Eucalyptus 
grandis]
 gb|KCW54700.1| hypothetical protein EUGRSUZ_I00649 [Eucalyptus grandis]
Length=98

 Score =   129 bits (325),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA  +VRS++ RS+LRGG +R +   KR+F+SSAH D    A KWEKITYAGIV CTILA
Sbjct  1    MAMAMVRSALLRSSLRGG-ARPSSVPKRNFASSAHDDAHETA-KWEKITYAGIVTCTILA  58

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPH+EEP AYPY+HIRNKEFPWGPDGLFEVKHH
Sbjct  59   IYNLSKGHPHYEEPAAYPYLHIRNKEFPWGPDGLFEVKHH  98



>ref|XP_010526694.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Tarenaya hassleriana]
Length=99

 Score =   129 bits (324),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA    RS++  A   G SR + A KRSF+S AHHD+A EA+KWEKITY GI AC  LA 
Sbjct  1    MAMAFARSALSRATIRGSSRTSAAPKRSFASKAHHDDAYEAAKWEKITYLGIAACAALAL  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             NLSKGHPH++EPPAYPY+HIRNKEFPWGPDGLFEVKHH
Sbjct  61   YNLSKGHPHYDEPPAYPYLHIRNKEFPWGPDGLFEVKHH  99



>ref|XP_002531993.1| cytochrome-c oxidase, putative [Ricinus communis]
 gb|EEF30392.1| cytochrome-c oxidase, putative [Ricinus communis]
Length=101

 Score =   129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKR--SFsssahhdeaaeasKWEKITYAGIVACTIL  189
            MA+ ++RS +R+ALRGG    AP  +R  S +      EAAEASKWEKITY  I +C+IL
Sbjct  1    MATALMRSGLRNALRGGSKPSAPLKRRFSSSAHHDDAYEAAEASKWEKITYVAIASCSIL  60

Query  190  AAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            A  NLSKGHPH EEPPAYPYMHIRNKEFPWGPDGLFE KHH
Sbjct  61   AIYNLSKGHPHHEEPPAYPYMHIRNKEFPWGPDGLFESKHH  101



>gb|AFK34929.1| unknown [Lotus japonicus]
 gb|AFK43728.1| unknown [Lotus japonicus]
Length=102

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MAS +VRS++ R+ LRGG    +   KR+FSSS  HD+A E +KWEKITY GI +CT LA
Sbjct  1    MASALVRSALLRTTLRGGARGGSLTPKRNFSSSGGHDDAYETAKWEKITYLGIASCTALA  60

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
            A  LSKGHPH+EEPPAYPY+HIRNKEFPWGPDGLFE KH
Sbjct  61   AYCLSKGHPHYEEPPAYPYLHIRNKEFPWGPDGLFETKH  99



>ref|XP_004155214.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
isoform 2 [Cucumis sativus]
Length=98

 Score =   127 bits (319),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA   +RS++ R+ALRG  SR +   KR F+SSAH D    A KWEKITYAGIV C+ILA
Sbjct  1    MAMASIRSNLLRAALRGA-SRNSVQPKRGFASSAHDDARETA-KWEKITYAGIVTCSILA  58

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPH EEPPAYPYMHIRNKEFPWGPDGLFEVKHH
Sbjct  59   FYNLSKGHPHHEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  98



>ref|XP_008342645.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Malus 
domestica]
Length=100

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA+ + RS+ +R+ALRGG SR A   +RSFSSSA HD+A E +KWEKITY GI +CTILA
Sbjct  1    MATAMFRSAGLRTALRGG-SRSAAPPRRSFSSSAGHDDARETAKWEKITYLGIASCTILA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             VNLSK HPH++ PPAYPY+HIRNKEFPWGPDGLFE KH
Sbjct  60   FVNLSKPHPHYDAPPAYPYLHIRNKEFPWGPDGLFETKH  98



>ref|XP_009375885.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009345890.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009345895.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Pyrus x bretschneideri]
Length=100

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA+ + RS+ +R+ALRGG SR A   +RSFSSSA HD+A E +KWEKITY GI +CTILA
Sbjct  1    MATAMFRSAGLRTALRGG-SRSAAPPRRSFSSSAGHDDARETAKWEKITYLGIASCTILA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             VNLSK HPH++ PPAYPY+HIRNKEFPWGPDGLFE KH
Sbjct  60   FVNLSKPHPHYDAPPAYPYLHIRNKEFPWGPDGLFEAKH  98



>ref|XP_008450167.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Cucumis 
melo]
Length=98

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA   +RS+ +R+ALRG  SR +   KR F+SSAH D    A KWEKITYAGIV C+ILA
Sbjct  1    MAMASIRSNFLRAALRGA-SRNSVQPKRGFASSAHDDARETA-KWEKITYAGIVTCSILA  58

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPH EEPPAYPY+HIRNKEFPWGPDGLFEVKHH
Sbjct  59   FYNLSKGHPHHEEPPAYPYLHIRNKEFPWGPDGLFEVKHH  98



>ref|XP_006600132.1| PREDICTED: uncharacterized protein LOC100499808 isoform X1 [Glycine 
max]
Length=103

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA+++VRS  +RSALRG  +R +   KR+F+SS HHD+A E +KWEKITY GIV CT LA
Sbjct  1    MATSLVRSGFLRSALRG-RARSSQVPKRNFASSGHHDDAYETAKWEKITYLGIVGCTGLA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPW-GPDGLFEVKHH  312
              NLSKGHPHF+EPPAYPY+HIRNKEFPW GPDGLFE KHH
Sbjct  60   VYNLSKGHPHFKEPPAYPYLHIRNKEFPWAGPDGLFETKHH  100



>ref|XP_010531320.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Tarenaya hassleriana]
Length=98

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 81/100 (81%), Gaps = 3/100 (3%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA  + RS++ R+A+RG     AP  +R+FSS  HHD+A E++KWEKITY GI +CT LA
Sbjct  1    MALALARSALSRAAIRGASRTSAP--RRNFSSKGHHDDAYESAKWEKITYLGIASCTALA  58

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPH++EPPAYPY+H+RNKEFPWGPDGLFEVKHH
Sbjct  59   LYNLSKGHPHYDEPPAYPYLHMRNKEFPWGPDGLFEVKHH  98



>ref|XP_004509040.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Cicer arietinum]
Length=104

 Score =   125 bits (313),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +1

Query  16   MASTIVRSS-IRSALR--GGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTI  186
            MA+T+VRS  +R+ LR  G  +R +P  KR+FSSS HHD+A E +KWEKITY GI +CT+
Sbjct  1    MATTLVRSGFLRNVLRRGGAPARSSPTPKRNFSSSGHHDDAYETAKWEKITYLGIASCTL  60

Query  187  LAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
            LA  NLSKGHPHF+E PAYPY+HIRNKEFPWGPDGLFE K+
Sbjct  61   LACYNLSKGHPHFDEAPAYPYLHIRNKEFPWGPDGLFETKN  101



>gb|KGN56323.1| hypothetical protein Csa_3G115610 [Cucumis sativus]
Length=96

 Score =   124 bits (311),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  22   STIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVN  201
            ++I  + +R+ALRG  SR +   KR F+SSAH D    A KWEKITYAGIV C+ILA  N
Sbjct  2    ASIRSNLLRAALRGA-SRNSVQPKRGFASSAHDDARETA-KWEKITYAGIVTCSILAFYN  59

Query  202  LSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            LSKGHPH EEPPAYPYMHIRNKEFPWGPDGLFEVKHH
Sbjct  60   LSKGHPHHEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  96



>ref|XP_002264013.2| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Vitis 
vinifera]
Length=115

 Score =   124 bits (312),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 2/100 (2%)
 Frame = +1

Query  13   RMASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            +MA  +VRS +R+ALR      AP  KR++SSSA HD+A E +KWEKITY GI  CT+LA
Sbjct  17   KMAMAMVRSGLRTALRSRTPAAAP--KRNYSSSAGHDDARETAKWEKITYLGIATCTVLA  74

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             VNLSKGHPH EEPP Y Y+HIRNKEFPWGPDGLFE K H
Sbjct  75   VVNLSKGHPHHEEPPRYDYLHIRNKEFPWGPDGLFETKQH  114



>gb|ACF87866.1| unknown [Zea mays]
Length=94

 Score =   124 bits (310),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 75/100 (75%), Gaps = 8/100 (8%)
 Frame = +1

Query  16   MASTIVRSSIRS-ALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MAS   RS +RS A+R G  RR  +S         HD+A E +KWEKITYAGIV CT+LA
Sbjct  1    MASAAARSGLRSLAVRAGPLRRRMSSS-------VHDDAYETAKWEKITYAGIVTCTLLA  53

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            A NLSKGHPHF+EPPAYPY+HIRNKEFPWGPDGLFE K H
Sbjct  54   AYNLSKGHPHFDEPPAYPYLHIRNKEFPWGPDGLFETKDH  93



>emb|CBI41023.3| unnamed protein product [Vitis vinifera]
Length=98

 Score =   124 bits (310),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA  +VRS +R+ALR      AP  KR++SSSA HD+A E +KWEKITY GI  CT+LA 
Sbjct  1    MAMAMVRSGLRTALRSRTPAAAP--KRNYSSSAGHDDARETAKWEKITYLGIATCTVLAV  58

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            VNLSKGHPH EEPP Y Y+HIRNKEFPWGPDGLFE K H
Sbjct  59   VNLSKGHPHHEEPPRYDYLHIRNKEFPWGPDGLFETKQH  97



>gb|KJB18103.1| hypothetical protein B456_003G034000 [Gossypium raimondii]
Length=100

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 2/100 (2%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA   VRS + R+ALRGG    AP  KR F+SS+HHD+A E +KWEKITY G+  CT+LA
Sbjct  1    MAMASVRSGLLRAALRGGSRPTAP-PKRGFASSSHHDDAYETAKWEKITYLGVATCTVLA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPH EEPPAYPY+HIRNKEFPWGPDGLFE K H
Sbjct  60   IYNLSKGHPHHEEPPAYPYLHIRNKEFPWGPDGLFETKEH  99



>ref|XP_009400031.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=105

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 79/103 (77%), Gaps = 5/103 (5%)
 Frame = +1

Query  16   MASTIVRSSIRSA---LRGGVSRRAPA-SKRSFsssahhdeaaeasKWEKITYAGIVACT  183
            MA+++ RS +RSA   LRGG   RA A +KRSFS+SAH D    A KWEKITYAGIV CT
Sbjct  1    MAASMARSGLRSASLLLRGGAKGRAGAPTKRSFSASAHDDAYETA-KWEKITYAGIVTCT  59

Query  184  ILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             LA  NLSKGH H EEPPAYPY+HIRNKEFPWGP+ LFE KHH
Sbjct  60   TLAIYNLSKGHHHGEEPPAYPYLHIRNKEFPWGPNSLFEKKHH  102



>gb|KHG27928.1| Cytochrome c oxidase subunit 6a, mitochondrial -like protein 
[Gossypium arboreum]
Length=100

 Score =   122 bits (306),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 2/100 (2%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA   VRS + R+ALRGG    AP  KR F+SS+HHD+A E +KWEKITY G+  CT+LA
Sbjct  1    MAMASVRSGLLRAALRGGSRPTAP-PKRGFASSSHHDDAYETAKWEKITYLGVATCTVLA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPH EEPPAYPY+HIRNKEFPWGPDGLFE K H
Sbjct  60   IYNLSKGHPHHEEPPAYPYLHIRNKEFPWGPDGLFERKEH  99



>ref|NP_001142528.1| uncharacterized protein LOC100274770 [Zea mays]
 gb|ACG24810.1| hypothetical protein [Zea mays]
 gb|ACG31328.1| hypothetical protein [Zea mays]
Length=94

 Score =   122 bits (306),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = +1

Query  28   IVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLS  207
            +  ++ RS LR    R AP  +R   SS+ HD+A E +KWEKITYAGIV CT+LAA NLS
Sbjct  1    MASAAARSGLRSLAVRAAPLRRR--MSSSVHDDAYETAKWEKITYAGIVTCTLLAAYNLS  58

Query  208  KGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            KGHPHF+EPPAYPY+HIRNKEFPWGPDGLFE K H
Sbjct  59   KGHPHFDEPPAYPYLHIRNKEFPWGPDGLFETKDH  93



>ref|XP_010245620.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
isoform X2 [Nelumbo nucifera]
Length=99

 Score =   122 bits (305),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ ++RS +++ALR G  R  P  KR F+SSAHHD+A E +KWEKITYAGIV CTIL+ 
Sbjct  1    MATAMMRSGLQAALRRG-GRTVPP-KRGFASSAHHDDAYETAKWEKITYAGIVTCTILSI  58

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             NLSKGHPH EEPP Y Y+HIRNKEFPWGPDGLFE KH
Sbjct  59   YNLSKGHPHHEEPPPYSYLHIRNKEFPWGPDGLFETKH  96



>ref|XP_010555434.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Tarenaya hassleriana]
Length=99

 Score =   122 bits (305),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA    RS++  A   G SR +   KRSF+S AHHD+A E++KWEKITY GI ACT LA 
Sbjct  1    MAMAFARSALSRATIRGASRISSDPKRSFASKAHHDDAYESAKWEKITYLGIAACTALAL  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             NLSKGHPH ++P AYPY+HIRNKEFPWGPDGLFEVKHH
Sbjct  61   HNLSKGHPHHDDPLAYPYLHIRNKEFPWGPDGLFEVKHH  99



>ref|XP_009419514.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=104

 Score =   122 bits (305),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 75/102 (74%), Gaps = 5/102 (5%)
 Frame = +1

Query  16   MASTIVRSSIRSA----LRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACT  183
            MA+++ RS +RSA     RG  S     +KRSFS+SAH D    A KWEKITYAGIV CT
Sbjct  1    MAASMARSGLRSASFLLRRGAKSNAVAPAKRSFSASAHDDAHETA-KWEKITYAGIVTCT  59

Query  184  ILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             LA  NLSKGHPH EEPPAYPY+HIRNKEFPWGPD LFE KH
Sbjct  60   TLAIYNLSKGHPHHEEPPAYPYLHIRNKEFPWGPDSLFEKKH  101



>gb|EYU41359.1| hypothetical protein MIMGU_mgv1a016898mg [Erythranthe guttata]
Length=102

 Score =   122 bits (305),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 81/102 (79%), Gaps = 3/102 (3%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSR---RAPASKRSFsssahhdeaaeasKWEKITYAGIVACTI  186
            MAS I+RS +RSALRGG       + +++   SS++  DEAAEASKWEKITY GI ACT 
Sbjct  1    MASAIMRSGLRSALRGGAYAPRVSSASNRSFSSSASQLDEAAEASKWEKITYVGIAACTC  60

Query  187  LAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            LAA  LSKGHPH +EPPAYP++HIRNKEFPWGPDGLFEVKHH
Sbjct  61   LAAFILSKGHPHHDEPPAYPFLHIRNKEFPWGPDGLFEVKHH  102



>ref|XP_009109396.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Brassica 
rapa]
 emb|CDX90403.1| BnaA08g15810D [Brassica napus]
Length=102

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A  G   + + A KR FSSSA HD+A EA+KWEKITY GI +CT LAA
Sbjct  1    MATAIVRSALSRAAIGAAPKTSLAPKRRFSSSAGHDDAYEAAKWEKITYLGIASCTALAA  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LSKGH H E+PPAYPYMHIRNKEFPWGPDGLFEVKH+
Sbjct  61   YVLSKGHHHGEDPPAYPYMHIRNKEFPWGPDGLFEVKHN  99



>ref|NP_001145536.1| uncharacterized protein LOC100278971 [Zea mays]
 gb|ACG48292.1| hypothetical protein [Zea mays]
Length=94

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = +1

Query  28   IVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLS  207
            +  ++ RS LR    R AP  +R   SS+ HD+A E +KWEKITYAGIV CT+LAA NLS
Sbjct  1    MASAAARSGLRSLAVRAAPLRRR--MSSSVHDDAYETAKWEKITYAGIVTCTLLAAYNLS  58

Query  208  KGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            KGHPHF+EPPAYPY+HIRNKEFPWGPDGLFE K H
Sbjct  59   KGHPHFDEPPAYPYLHIRNKEFPWGPDGLFEKKDH  93



>gb|ACG24652.1| hypothetical protein [Zea mays]
Length=94

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 74/100 (74%), Gaps = 8/100 (8%)
 Frame = +1

Query  16   MASTIVRSSIRS-ALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MAS   RS +RS A+R G  RR  +S         HD+A E +KWEKITYAGIV CT+LA
Sbjct  1    MASAAARSGLRSLAVRAGPLRRRMSSS-------VHDDAYETAKWEKITYAGIVTCTLLA  53

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            A NLSKGHPHF+EP AYPY+HIRNKEFPWGPDGLFE K H
Sbjct  54   AYNLSKGHPHFDEPXAYPYLHIRNKEFPWGPDGLFETKDH  93



>ref|NP_001051412.1| Os03g0772800 [Oryza sativa Japonica Group]
 gb|AAP68890.1| putative cytochrome c oxidase subunit VIa precursor [Oryza sativa 
Japonica Group]
 gb|ABF99101.1| Cytochrome c oxidase subunit VIa family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13326.1| Os03g0772800 [Oryza sativa Japonica Group]
 gb|EEC76250.1| hypothetical protein OsI_13691 [Oryza sativa Indica Group]
 gb|EEE60011.1| hypothetical protein OsJ_12754 [Oryza sativa Japonica Group]
 gb|ADR66989.1| cytochrome c oxidase [Oryza sativa Japonica Group]
Length=98

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MAS   RS +RS L       A  + R   SS+ HD+A E +KWEKITYAGIV CT+LAA
Sbjct  1    MASAAARSGLRS-LAARAKATAAPAARRRMSSSAHDDAHETAKWEKITYAGIVTCTLLAA  59

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             NLSKGHPHF+EPPAYPY+HIRNKEFPWGPDGLFE KHH
Sbjct  60   YNLSKGHPHFDEPPAYPYLHIRNKEFPWGPDGLFENKHH  98



>ref|XP_010248259.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Nelumbo nucifera]
Length=99

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA  ++RS +++ALR G    +P  KRSF+SSAHHD+A E +KWEKITYAGI  CTILA 
Sbjct  1    MAMAMMRSGLQAALRRGGRNASP--KRSFASSAHHDDAYETAKWEKITYAGIATCTILAF  58

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             NLSKGHPH EE P Y Y+HIRNKEFPWGPDGLFE KH
Sbjct  59   NNLSKGHPHHEETPPYSYLHIRNKEFPWGPDGLFEKKH  96



>ref|XP_006411847.1| hypothetical protein EUTSA_v10026651mg [Eutrema salsugineum]
 gb|ESQ53300.1| hypothetical protein EUTSA_v10026651mg [Eutrema salsugineum]
Length=102

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A      R + A KRSFSSSA HD+A EA+KWEKITY GI +CT LA 
Sbjct  1    MATAIVRSALSRATIRAAPRTSVAHKRSFSSSAGHDDAYEAAKWEKITYLGIASCTALAV  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
              LSKGH H E+PPAYPYMHIRNKEFPWGPDGLFEVKH
Sbjct  61   YVLSKGHHHGEDPPAYPYMHIRNKEFPWGPDGLFEVKH  98



>ref|XP_007155785.1| hypothetical protein PHAVU_003G231600g [Phaseolus vulgaris]
 gb|ESW27779.1| hypothetical protein PHAVU_003G231600g [Phaseolus vulgaris]
Length=100

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA+++VRS  +R+ALRGG +R +   KR+FSS+AHHD+A E +KWEKITY GIV+CT LA
Sbjct  1    MATSLVRSGFLRTALRGG-ARGSQVPKRNFSSAAHHDDAYETAKWEKITYLGIVSCTGLA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
               LSKGH H E PPAYPY+HIRNKEFPWGPDGLFE K H
Sbjct  60   LYTLSKGHHHTEAPPAYPYLHIRNKEFPWGPDGLFETKDH  99



>ref|XP_006284822.1| hypothetical protein CARUB_v10006101mg [Capsella rubella]
 gb|EOA17720.1| hypothetical protein CARUB_v10006101mg [Capsella rubella]
Length=102

 Score =   119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A      R + A KRSFSSSA HD+A EA+KWEKITY GI +CT LA 
Sbjct  1    MATAIVRSALSRAAIRAAPRTSVAPKRSFSSSAGHDDAYEAAKWEKITYLGIASCTALAV  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LSKGH H E+PPAYPYMHIRNKEFPWGPDGLFEVKH+
Sbjct  61   YVLSKGHHHGEDPPAYPYMHIRNKEFPWGPDGLFEVKHN  99



>gb|AIZ06012.1| hypothetical protein [Zea nicaraguensis]
Length=94

 Score =   119 bits (297),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = +1

Query  28   IVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLS  207
            +  ++ RS LR    R AP  +R   SS+ HD+A E +KWEKITYAGIV CT+LAA NLS
Sbjct  1    MASAAARSGLRSLAVRAAPLRRR--MSSSVHDDAYETAKWEKITYAGIVTCTLLAAYNLS  58

Query  208  KGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            KGHPHF+EPPAYPY+HIRNKEFPWGPDG FE K H
Sbjct  59   KGHPHFDEPPAYPYLHIRNKEFPWGPDGCFEKKDH  93



>ref|XP_003608580.1| hypothetical protein MTR_4g097800 [Medicago truncatula]
 gb|AES90777.1| cytochrome C oxidase [Medicago truncatula]
 gb|AFK35628.1| unknown [Medicago truncatula]
Length=103

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahh-deaaeasKWEKITYAGIVACTIL  189
            MA+T++RS  IR+ LR G S  +PA KR+FSSS+ H D+A E +KWEKITY GIV+CT L
Sbjct  1    MATTLMRSGFIRNVLRRGGSGASPAPKRNFSSSSGHHDDAYETAKWEKITYLGIVSCTGL  60

Query  190  AAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVK  306
            A   LSKGH H++EPPAYPY+HIRNKEFPWGPDGLFE+K
Sbjct  61   AVYILSKGHHHYDEPPAYPYLHIRNKEFPWGPDGLFEIK  99



>ref|XP_010680777.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=103

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 7/104 (7%)
 Frame = +1

Query  16   MASTI--VRSSIRSALRGGVSRRAPASKRSFsssa---hhdeaaeasKWEKITYAGIVAC  180
            MA T+  +RS ++SA+R G  R +   KRSFSSS+      EA EA+KWEKI+Y GIV+C
Sbjct  1    MAMTLGKLRSGVQSAIRSG--RSSDLLKRSFSSSSHHDEAYEAKEAAKWEKISYLGIVSC  58

Query  181  TILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            T+LA   LSKGH H++EPPAYPYMHIRNKEFPWGPDGLFEVK H
Sbjct  59   TVLAIYTLSKGHHHYDEPPAYPYMHIRNKEFPWGPDGLFEVKDH  102



>ref|XP_007207509.1| hypothetical protein PRUPE_ppa013816mg [Prunus persica]
 ref|XP_008236989.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Prunus 
mume]
 gb|EMJ08708.1| hypothetical protein PRUPE_ppa013816mg [Prunus persica]
Length=101

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA ++VRS+ +R+ALR G    AP  KRSFSSSA HD+A E +KWEKITY GI +CTI A
Sbjct  1    MAMSMVRSAALRTALRSGSRSSAPP-KRSFSSSAAHDDAHETAKWEKITYLGIASCTIFA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             V LSK HPH++EPP YPY+HIRNKEFPWGP+GLFE KH
Sbjct  60   FVVLSKPHPHYDEPPPYPYLHIRNKEFPWGPNGLFEKKH  98



>ref|XP_010432025.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Camelina 
sativa]
 ref|XP_010437180.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Camelina 
sativa]
Length=102

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A      + + A KRSFSSSA HD+A EA+KWEKITY GI +CT LAA
Sbjct  1    MATAIVRSALSRAAIRVTPKTSVAPKRSFSSSAGHDDAYEAAKWEKITYLGIASCTALAA  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LS+GH H E+PPAYPYMHIRNKEFPWGPDGLFEVKH+
Sbjct  61   YVLSQGHHHGEDPPAYPYMHIRNKEFPWGPDGLFEVKHN  99



>ref|XP_006650664.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Oryza brachyantha]
Length=100

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            KWEKITYAGIV CT+LAA NLSKGHPHF+EPPAYPY+HIRNKEFPWGPDGLFE KHH
Sbjct  44   KWEKITYAGIVTCTLLAAYNLSKGHPHFDEPPAYPYLHIRNKEFPWGPDGLFENKHH  100



>ref|XP_010446618.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Camelina sativa]
Length=102

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A      +   A KRSFSSSA HD+A EA+KWEKITY GI +CT LAA
Sbjct  1    MATAIVRSALSRAAIRVTPKTTVAPKRSFSSSAGHDDAYEAAKWEKITYLGIASCTALAA  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LS+GH H E+PPAYPYMHIRNKEFPWGPDGLFEVKH+
Sbjct  61   YVLSQGHHHGEDPPAYPYMHIRNKEFPWGPDGLFEVKHN  99



>ref|XP_004288295.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=102

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = +1

Query  16   MASTIVRS-SIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA  ++RS ++R+ALRGG SR +   KRSFSSSA HD+A E +KWEKITY GIV+CT LA
Sbjct  1    MAMAMLRSGALRTALRGG-SRSSAQPKRSFSSSAGHDDAYETAKWEKITYLGIVSCTGLA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
               LSKGH H+E PP YPY+HIRNKEFPWGPDGLFE+K+
Sbjct  60   VYILSKGHHHYETPPPYPYLHIRNKEFPWGPDGLFEIKN  98



>ref|NP_195496.1| cytochrome c oxidase subunit 6a [Arabidopsis thaliana]
 sp|Q9T070.1|COX6A_ARATH RecName: Full=Cytochrome c oxidase subunit 6a, mitochondrial; 
Short=AtCOX6a; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG41474.1|AF326892_1 unknown protein [Arabidopsis thaliana]
 gb|AAK00391.1|AF339709_1 unknown protein [Arabidopsis thaliana]
 gb|AAK55726.1|AF380645_1 AT4g37830/T28I19_110 [Arabidopsis thaliana]
 emb|CAB38931.1| putative protein [Arabidopsis thaliana]
 emb|CAB80448.1| putative protein [Arabidopsis thaliana]
 gb|AAL06978.1| AT4g37830/T28I19_110 [Arabidopsis thaliana]
 dbj|BAF00740.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86842.1| cytochrome c oxidase subunit 6a [Arabidopsis thaliana]
Length=102

 Score =   117 bits (292),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A+     + + A KR+FSSSA HD+A EA+KWEKITY GI +CT LA 
Sbjct  1    MATAIVRSALSRAVTRAAPKTSVAPKRNFSSSAGHDDAYEAAKWEKITYLGIASCTALAV  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
              LSKGH H E+PPAYP+MHIRNKEFPWGPDGLFEVKH
Sbjct  61   YVLSKGHHHGEDPPAYPHMHIRNKEFPWGPDGLFEVKH  98



>ref|XP_002866930.1| hypothetical protein ARALYDRAFT_912546 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43189.1| hypothetical protein ARALYDRAFT_912546 [Arabidopsis lyrata subsp. 
lyrata]
Length=102

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A      R + A KR+FSSSA HD+A EA+KWEKITY GI +CT LA 
Sbjct  1    MATAIVRSALSRAAIRVAPRTSVAPKRNFSSSAGHDDAYEAAKWEKITYLGIASCTALAV  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LSKGH H E+PPAYPYMHIRNKEFPWGPDGLFEVKH+
Sbjct  61   YVLSKGHHHGEDPPAYPYMHIRNKEFPWGPDGLFEVKHN  99



>ref|XP_010936221.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Elaeis guineensis]
Length=100

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +1

Query  31   VRSSIRSALRGGVSRRAPAS-KRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLS  207
             R  ++  LR G  R  PA+ KRSFS+SAHHD+A E +KWEKITYAGIV CT+L+  NLS
Sbjct  4    ARYGLQVLLRSGARRSNPAAGKRSFSASAHHDDAYETAKWEKITYAGIVTCTVLSIYNLS  63

Query  208  KGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
            KGHPH  EPPAY Y+H+RNKEFPWGPDGLFE KH
Sbjct  64   KGHPHHPEPPAYAYLHVRNKEFPWGPDGLFERKH  97



>emb|CDY54215.1| BnaA04g28190D [Brassica napus]
Length=97

 Score =   116 bits (291),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 77/99 (78%), Gaps = 5/99 (5%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A +  V     A KR FSSSA HD+A EA+KWEKITY GI +CT LAA
Sbjct  1    MATAIVRSALSRAAKTSV-----APKRRFSSSAGHDDAYEAAKWEKITYLGIASCTALAA  55

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LSKGH H E+PPAYPY+HIRNKEFPWGPDGLFEVKH+
Sbjct  56   YVLSKGHQHGEDPPAYPYLHIRNKEFPWGPDGLFEVKHN  94



>ref|XP_002466380.1| hypothetical protein SORBIDRAFT_01g006750 [Sorghum bicolor]
 gb|EER93378.1| hypothetical protein SORBIDRAFT_01g006750 [Sorghum bicolor]
Length=94

 Score =   116 bits (291),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 70/99 (71%), Gaps = 6/99 (6%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MAS   RS +RS        R   S       + HD+A E +KWEKITYAGIV CT+LAA
Sbjct  1    MASAAARSGLRSLAARAAPLRRRMSS------SVHDDAYETAKWEKITYAGIVTCTLLAA  54

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             NLSKGHPHF+EPPAYPY+HIRNKEFPWGPDGLFE K H
Sbjct  55   YNLSKGHPHFDEPPAYPYLHIRNKEFPWGPDGLFEKKDH  93



>emb|CDX69334.1| BnaC01g01190D [Brassica napus]
Length=102

 Score =   116 bits (291),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ I+RS++  A      R + A KR FSSS+  D+A E+ KWE ITY GI +CT++AA
Sbjct  1    MATAIIRSALSRAAITAAPRTSVAPKRRFSSSSGLDDAYESGKWESITYLGIFSCTLIAA  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LS+GH H E+PPAYPYMHIRNKEFPWGPDGLFEVKH+
Sbjct  61   YVLSEGHQHGEDPPAYPYMHIRNKEFPWGPDGLFEVKHN  99



>ref|XP_008790423.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Phoenix dactylifera]
Length=100

 Score =   116 bits (290),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +1

Query  31   VRSSIRSALRGGVSRRAPAS-KRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLS  207
             R  +R  LRGG  R  PA+ KRSFSSS  HD+A E +KWEKITYAGIV CT+L+  NLS
Sbjct  4    ARYGLRVLLRGGALRSKPAAGKRSFSSSPLHDDAHETAKWEKITYAGIVTCTVLSIYNLS  63

Query  208  KGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
            + HPH  EPPAY Y+H+RNKEFPWGPDGLFE KH
Sbjct  64   QDHPHHPEPPAYQYLHVRNKEFPWGPDGLFERKH  97



>ref|XP_004981603.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
isoform X2 [Setaria italica]
Length=94

 Score =   116 bits (290),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            KWEKITYAGIV CT+LAA NLSKGHPHF+EPPAYPY+HIRNKEFPWGPDGLFE K H
Sbjct  37   KWEKITYAGIVTCTLLAAYNLSKGHPHFDEPPAYPYLHIRNKEFPWGPDGLFETKDH  93



>ref|XP_009132836.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Brassica rapa]
Length=102

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ I+RS++  A      + + A KR FSSSA  D+A E+ KWE ITY GI +CT++AA
Sbjct  1    MATAIIRSALSRAAITAAPKTSLAPKRRFSSSAGLDDAYESGKWESITYLGIFSCTLIAA  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LSKGH H E+PP YPYMHIRNKEFPWGPDGLFEVKH+
Sbjct  61   YVLSKGHQHGEDPPTYPYMHIRNKEFPWGPDGLFEVKHN  99



>gb|AGN12790.1| cytochrome c oxidase subunit Via [Leavenworthia alabamica]
Length=102

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A      R   A KR FSSSA HD+A EA+KWEKITY GI +CT LA 
Sbjct  1    MATAIVRSALSRASITVAPRTFVAPKRRFSSSAGHDDAYEAAKWEKITYLGIASCTALAT  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LSKGH H E+PPAYPYMHIRNKEFPWGPDGLFEVKH+
Sbjct  61   YVLSKGHHHGEDPPAYPYMHIRNKEFPWGPDGLFEVKHN  99



>ref|XP_010229196.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Brachypodium 
distachyon]
Length=97

 Score =   113 bits (283),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 71/98 (72%), Gaps = 3/98 (3%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MAS   RS +RS      +      + S   S+ HD+A E +KWEKITYAGIV CT+LAA
Sbjct  1    MASAAARSGLRSLAARAKAPAPARRRMS---SSVHDDAYETAKWEKITYAGIVTCTLLAA  57

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             NLSKGHPHF+EP  YPY+HIRNKEFPWGPDGLFEVKH
Sbjct  58   WNLSKGHPHFDEPAPYPYLHIRNKEFPWGPDGLFEVKH  95



>ref|XP_011021816.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Populus 
euphratica]
Length=101

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA +++RS++ R++LR      AP ++R FSSSAHHD+A EA+KWEKITY G  +CTILA
Sbjct  1    MAISMMRSALLRNSLRSASKPSAP-TRRGFSSSAHHDDAYEAAKWEKITYLGAASCTILA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVK  306
              NLSKGHPH E PP YPY+HIRNKEFPWGP+GLFEVK
Sbjct  60   IYNLSKGHPHHETPPEYPYLHIRNKEFPWGPNGLFEVK  97



>gb|ABK95790.1| unknown [Populus trichocarpa]
Length=101

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 4/102 (4%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA +++RS++ R++LR      AP ++R FSSSAHHD+A EA+KWEKI Y G   CTILA
Sbjct  1    MAISMMRSALLRNSLRSASKPSAP-TRRGFSSSAHHDDAYEAAKWEKIAYLGAATCTILA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVK--HH  312
              NLSKGHPH+E PP YPY+HIRNKEFPWGP+GLFEVK  HH
Sbjct  60   IYNLSKGHPHYETPPEYPYLHIRNKEFPWGPNGLFEVKEDHH  101



>gb|AAM66133.1| unknown [Arabidopsis thaliana]
Length=102

 Score =   112 bits (279),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A      + + A KR+FSSSA HD+A EA+KWEKITY GI +CT LA 
Sbjct  1    MATAIVRSALSRAATRAAPKTSVAPKRNFSSSAGHDDAYEAAKWEKITYLGIASCTALAV  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LSKGH   E+PPAYP+MHIRNKEFPWGPDGLFEVKH+
Sbjct  61   YVLSKGHHPGEDPPAYPHMHIRNKEFPWGPDGLFEVKHN  99



>ref|XP_006466401.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Citrus sinensis]
Length=102

 Score =   111 bits (277),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 75/102 (74%), Gaps = 3/102 (3%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            M   +VRS + R+ LR   S  +   KR F+SSAHHD+A E +KWEKITY GI  CT+LA
Sbjct  1    MPMAMVRSGLLRTTLRRVSSASSAPPKRGFASSAHHDDAYETAKWEKITYLGIATCTVLA  60

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVK--HH  312
              NLSKGHPH+EEPP Y Y+HIRNKEFPWGPDGLFE K  HH
Sbjct  61   FYNLSKGHPHYEEPPRYEYLHIRNKEFPWGPDGLFEKKPTHH  102



>ref|XP_006426167.1| hypothetical protein CICLE_v10026828mg [Citrus clementina]
 gb|ESR39407.1| hypothetical protein CICLE_v10026828mg [Citrus clementina]
 gb|KDO78784.1| hypothetical protein CISIN_1g034187mg [Citrus sinensis]
Length=100

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +1

Query  28   IVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNL  204
            +VRS + ++ALR   S  +   KR F+SSAHHD+A E +KWEKITY GI  CT+LA  NL
Sbjct  3    MVRSGLLQTALRRVSSASSAPPKRGFASSAHHDDAYETAKWEKITYLGIATCTVLAFYNL  62

Query  205  SKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVK  306
            SKGHPH+EEPP Y Y+HIRNKEFPWGPDGLFE K
Sbjct  63   SKGHPHYEEPPRYEYLHIRNKEFPWGPDGLFEKK  96



>gb|KDP32136.1| hypothetical protein JCGZ_12597 [Jatropha curcas]
Length=108

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKR--SFsssahhdeaaeasKWEKITYAGIVACTIL  189
            MAS ++RS +R+ALRGG    AP  +R  S +      EAAEASKWEKITY GI  CTIL
Sbjct  1    MASAMMRSGLRNALRGGSKVSAPPKRRFSSSAHHDEAYEAAEASKWEKITYLGIATCTIL  60

Query  190  AAVNLSKGHPHFEEPPAYPYMHIRNKEFPW  279
            A  NLSKGHPH EEPPAYPY+HIRNKEFPW
Sbjct  61   AIYNLSKGHPHHEEPPAYPYLHIRNKEFPW  90



>gb|KFK30393.1| hypothetical protein AALP_AA7G255200 [Arabis alpina]
Length=103

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 76/100 (76%), Gaps = 1/100 (1%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA+ IVRS++ RS++R          KR+ SSSA HD+A EA+KWEKITY G  +CT LA
Sbjct  1    MATAIVRSALSRSSIRLTPRTSFAPPKRNMSSSAGHDDAYEAAKWEKITYLGAASCTALA  60

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
               LSKGH H E+PPAYPYMHIRNKEFPWGPDGLFEVKH+
Sbjct  61   VWILSKGHHHGEDPPAYPYMHIRNKEFPWGPDGLFEVKHN  100



>ref|XP_004155213.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
isoform 1 [Cucumis sativus]
Length=141

 Score =   109 bits (273),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 79/143 (55%), Gaps = 46/143 (32%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA   +RS++ R+ALRG  SR +   KR F+SSAH D    A KWEKITYAGIV C+ILA
Sbjct  1    MAMASIRSNLLRAALRGA-SRNSVQPKRGFASSAHDDARETA-KWEKITYAGIVTCSILA  58

Query  193  AVNLSKGHPHFEEPP-------------------------------------------AY  243
              NLSKGHPH EEPP                                           AY
Sbjct  59   FYNLSKGHPHHEEPPVSYNFSQFILFPQVLSTLVELWNYVLYSHVLTIYFCLGFHCMQAY  118

Query  244  PYMHIRNKEFPWGPDGLFEVKHH  312
            PYMHIRNKEFPWGPDGLFEVKHH
Sbjct  119  PYMHIRNKEFPWGPDGLFEVKHH  141



>ref|XP_010943337.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Elaeis guineensis]
Length=109

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +1

Query  70   SRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPY  249
            SR    +KRSFS+SAHHD+A E +KWEKITYAGIV CTIL+  NLSKGHPH  +PPAY Y
Sbjct  26   SRPVIPNKRSFSASAHHDDAYETAKWEKITYAGIVTCTILSIYNLSKGHPHHPDPPAYAY  85

Query  250  MHIRNKEFPWGPDGLFEVKHH  312
            +HIR+KEFPWGPDGLFE K H
Sbjct  86   LHIRSKEFPWGPDGLFEKKQH  106



>emb|CDY49676.1| BnaC03g61230D [Brassica napus]
Length=92

 Score =   106 bits (264),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +1

Query  70   SRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPY  249
            ++ + A KR FSSSA HD+A EA+KWEKITY GI +CT LAA  LSKGH H E+PPAYPY
Sbjct  9    AKTSVAPKRRFSSSAGHDDAYEAAKWEKITYLGIASCTALAAYVLSKGHQHGEDPPAYPY  68

Query  250  MHIRNKEFPWGPDGLFEVKHH  312
            +HIRNKEFPWGPDGLFEVKH+
Sbjct  69   LHIRNKEFPWGPDGLFEVKHN  89



>dbj|BAK01482.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=99

 Score =   106 bits (264),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MAS   RS +RS L       APA      SS+ HD+A E +KWEKIT  G V CT+LAA
Sbjct  1    MASLAARSGLRS-LAARARAPAPAPAGRRMSSSAHDDAYETAKWEKITIMGAVTCTLLAA  59

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             NLSKGHPH++EPPAYPY+ IRNKEFPWGP+GLFEVKH
Sbjct  60   WNLSKGHPHYDEPPAYPYLRIRNKEFPWGPNGLFEVKH  97



>ref|XP_010245619.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
isoform X1 [Nelumbo nucifera]
Length=101

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ ++RS +++ALR G  R  P  KR F+SSAHHD+A E +KWEKITYAGIV CTIL+ 
Sbjct  1    MATAMMRSGLQAALRRG-GRTVPP-KRGFASSAHHDDAYETAKWEKITYAGIVTCTILSI  58

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWG  282
             NLSKGHPH EEPP Y Y+HIRNKEFPWG
Sbjct  59   YNLSKGHPHHEEPPPYSYLHIRNKEFPWG  87



>ref|XP_007047646.1| Cytochrome c oxidase-related [Theobroma cacao]
 gb|EOX91803.1| Cytochrome c oxidase-related [Theobroma cacao]
Length=126

 Score =   103 bits (258),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA   VRS  +R+ LRGG SR +   KR F+SS+HHD+A E +KWEKITY GI  CT+LA
Sbjct  1    MAMASVRSGFLRTVLRGG-SRPSATPKRGFASSSHHDDAYETAKWEKITYLGIATCTVLA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWG  282
              NLSKGH H EEPPAYPY+HIRNKEFPWG
Sbjct  60   IYNLSKGHHHHEEPPAYPYLHIRNKEFPWG  89



>ref|XP_004981602.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
isoform X1 [Setaria italica]
Length=112

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH*LL  321
            KWEKITYAGIV CT+LAA NLSKGHPHF+EPPAYPY+HIRNKEFPWG D L  ++H  L+
Sbjct  37   KWEKITYAGIVTCTLLAAYNLSKGHPHFDEPPAYPYLHIRNKEFPWGMDCL-PLQHFDLV  95

Query  322  QTSLR  336
               +R
Sbjct  96   TCLIR  100



>gb|AGL09475.1| cytochrome c oxidase-related protein, partial [Hydnora visseri]
Length=101

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 64/89 (72%), Gaps = 2/89 (2%)
 Frame = +1

Query  46   RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLSKGHPHF  225
            R   RG  SR     K+SFS+SA+HD+A E  KWE+ITY GI  CTILA  NLSKGH H 
Sbjct  15   RLICRG--SRVIQLKKKSFSASAYHDDAHEMVKWERITYLGIATCTILAIYNLSKGHHHE  72

Query  226  EEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             E PAY Y+HIRNK+FPWG DGLFE KHH
Sbjct  73   LEQPAYSYLHIRNKDFPWGQDGLFEKKHH  101



>gb|ABK21401.1| unknown [Picea sitchensis]
 gb|ABK27052.1| unknown [Picea sitchensis]
 gb|ABR16190.1| unknown [Picea sitchensis]
Length=106

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
            KW+KIT AGI+ACT LA  +LS  H HFEE PAYPY+HIRNKEFPWGPDGLFE K H
Sbjct  46   KWKKITIAGIIACTALATYSLSGEHEHFEESPAYPYLHIRNKEFPWGPDGLFERKKH  102



>ref|XP_010939471.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Elaeis guineensis]
Length=105

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSR-RAPASKRSFsssahhdeaa---easKWEKITYAGIVACT  183
            MA ++ R+ +R+ LRGGV R  A A KRSFS+SAH D+ A   E  KWEKITY GI+  T
Sbjct  1    MAMSVARNGLRALLRGGVRRSDAVAGKRSFSASAHQDDVAFAVEMEKWEKITYVGIITYT  60

Query  184  ILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
            +L+  NLS+ HPH    P + Y+H+R+K F WGPDGLFE KH
Sbjct  61   VLSIYNLSRDHPHHPGAPPFEYLHVRHKGFRWGPDGLFEKKH  102



>ref|XP_009354589.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009354602.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Pyrus x bretschneideri]
Length=100

 Score = 95.5 bits (236),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA  +VR++ +R+ALRGG SR     KRSFSSSA H++A EA KWEKITY GI ACTIL 
Sbjct  1    MAMAMVRAAGLRTALRGG-SRSVAPPKRSFSSSAGHNDAREADKWEKITYLGIAACTILT  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             VNLSK HPH E PP YPY+HIRNKEFPWGPDGLFE KH
Sbjct  60   FVNLSKPHPHHEPPPPYPYLHIRNKEFPWGPDGLFERKH  98



>ref|XP_002310323.2| hypothetical protein POPTR_0007s14540g [Populus trichocarpa]
 gb|EEE90773.2| hypothetical protein POPTR_0007s14540g [Populus trichocarpa]
Length=124

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA +++RS++ R++LR      AP ++R FSSSAHHD+A EA+KWEKI Y G   CTILA
Sbjct  1    MAISMMRSALLRNSLRSASKPSAP-TRRGFSSSAHHDDAYEAAKWEKIAYLGAATCTILA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWG  282
              NLSKGHPH+E PP YPY+HIRNKEFPWG
Sbjct  60   IYNLSKGHPHYETPPEYPYLHIRNKEFPWG  89



>ref|XP_006367050.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Solanum tuberosum]
Length=93

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 6/99 (6%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MAS +++S I SAL GG      A KR+FSSSA+HDEA EA+KWEK TY GIV C IL  
Sbjct  1    MASALIKSRINSALHGG------AFKRNFSSSAYHDEAREAAKWEKNTYVGIVTCAILTI  54

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             NLSKGHPH+EEPP YPY+HIRNKEFPWGPDGLFE KHH
Sbjct  55   FNLSKGHPHYEEPPPYPYLHIRNKEFPWGPDGLFERKHH  93



>gb|KDO78785.1| hypothetical protein CISIN_1g034187mg [Citrus sinensis]
Length=102

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = +1

Query  28   IVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNL  204
            +VRS + ++ALR   S  +   KR F+SSAHHD+A E +KWEKITY GI  CT+LA  NL
Sbjct  3    MVRSGLLQTALRRVSSASSAPPKRGFASSAHHDDAYETAKWEKITYLGIATCTVLAFYNL  62

Query  205  SKGHPHFEEPPAYPYMHIRNKEFPWG  282
            SKGHPH+EEPP Y Y+HIRNKEFPWG
Sbjct  63   SKGHPHYEEPPRYEYLHIRNKEFPWG  88



>gb|KHG23477.1| Cytochrome c oxidase subunit 6a, mitochondrial -like protein 
[Gossypium arboreum]
Length=99

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 79/100 (79%), Gaps = 2/100 (2%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA   VRS + R+ALRGG    AP  KR FSSS +HD+A E +KWEKITY GI+ CT LA
Sbjct  1    MAMASVRSGLLRTALRGGSRPPAPP-KRGFSSSPNHDDAYETAKWEKITYLGILTCTGLA  59

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPH+EEPP YPY+HIRNKEFPWGPDGLFEVKHH
Sbjct  60   FYNLSKGHPHYEEPPPYPYLHIRNKEFPWGPDGLFEVKHH  99



>ref|XP_002440668.1| hypothetical protein SORBIDRAFT_09g004850 [Sorghum bicolor]
 gb|EES19098.1| hypothetical protein SORBIDRAFT_09g004850 [Sorghum bicolor]
Length=114

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVK  306
            KWE+ITYAGI  CT+LA  NLSKGH  F +PP  PY+HIRNK+FPWGPDGLFE K
Sbjct  42   KWERITYAGIATCTVLAMFNLSKGHQEFPDPPPNPYLHIRNKDFPWGPDGLFERK  96



>ref|XP_006360393.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Solanum tuberosum]
Length=94

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 76/99 (77%), Gaps = 5/99 (5%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MAS +++S I S LR G      A KR+FSSS HHDEA EA+KWEKITY GIV C IL  
Sbjct  1    MASALIKSRIHSVLRSG-----GAFKRNFSSSVHHDEAREAAKWEKITYVGIVTCAILTI  55

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             NLSKGHPH+EEPP YPY HIRNKEFPWGPDGLFE KHH
Sbjct  56   FNLSKGHPHYEEPPPYPYRHIRNKEFPWGPDGLFERKHH  94



>gb|KJB43993.1| hypothetical protein B456_007G228300 [Gossypium raimondii]
Length=97

 Score = 92.8 bits (229),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MAS  VRS + R+ALRGG    AP  KR FSSS++ D+A E +KWEKITY GI+ CT LA
Sbjct  1    MAS--VRSGLLRTALRGGSRPPAPP-KRGFSSSSNRDDAYETAKWEKITYLGILTCTGLA  57

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              NLSKGHPH+EEPP YPY+HIRNKEFPWGPDGLFEVKHH
Sbjct  58   FYNLSKGHPHYEEPPPYPYLHIRNKEFPWGPDGLFEVKHH  97



>ref|XP_004234642.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Solanum lycopersicum]
Length=89

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 10/99 (10%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MAS +++S+ R          A A KR+FSSSAH+DEA EA+KWEKITYAGI AC IL  
Sbjct  1    MASALIKSAFR----------ASAFKRNFSSSAHNDEAREAAKWEKITYAGIAACAILTI  50

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
             NLSKGHPH+EEPP YPY+HIRNKEFPWGPDGLFE KHH
Sbjct  51   FNLSKGHPHYEEPPPYPYLHIRNKEFPWGPDGLFERKHH  89



>ref|XP_009354607.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Pyrus x bretschneideri]
Length=97

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 5/99 (5%)
 Frame = +1

Query  16   MASTIVRSS-IRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA  +VR++ +R+ALRGG    AP  KRSFSSSA H++A EA KWEKITY GI ACTIL 
Sbjct  1    MAMAMVRAAGLRTALRGG---SAP-PKRSFSSSAGHNDAREADKWEKITYLGIAACTILT  56

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             VNLSK HPH E PP YPY+HIRNKEFPWGPDGLFE KH
Sbjct  57   FVNLSKPHPHHEPPPPYPYLHIRNKEFPWGPDGLFERKH  95



>ref|XP_008785704.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Phoenix dactylifera]
Length=135

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 71/117 (61%), Gaps = 21/117 (18%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSR-RAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            M+ +  R  +R+ LRGG  R  A A KRSFS+SAH D+A E +KWEKITYAGIV CT+L+
Sbjct  3    MSMSAGRCGLRALLRGGARRSDAAAGKRSFSASAHQDDAYETAKWEKITYAGIVTCTVLS  62

Query  193  AVNLSKGHPHFEEPPAYPYMHIRNKE------------------FPWGPDGLFEVKH  309
              NLSK HPH  EPPAY Y+H+RN +                  FPW  D  F ++H
Sbjct  63   IYNLSKDHPHHLEPPAYEYLHVRNNDLQVLMVSLKRSMLNIRAPFPWFSD--FHLEH  117



>ref|XP_009766324.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Nicotiana sylvestris]
Length=132

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MAS +++ S RSALRGG S   PA KR+++SSAHHDEA EA+KWEKITY GI+ CTILA 
Sbjct  1    MASAMIKCSFRSALRGGASHGTPAFKRTYASSAHHDEAREAAKWEKITYVGIITCTILAI  60

Query  196  VNLSKGHPHFEEPP  237
            VNLSKGHPH EEPP
Sbjct  61   VNLSKGHPHHEEPP  74



>gb|EMT05051.1| hypothetical protein F775_28590 [Aegilops tauschii]
Length=134

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MAS   RS +RS      +       R  SSSAH D    A KWEKIT  G V CT+LAA
Sbjct  1    MASLAARSGLRSLAARARAPAPATGGRRMSSSAHDDAYETA-KWEKITIMGAVTCTLLAA  59

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWG  282
             NLSKGHPHF+EPPAYPY+HIRNKEFPW 
Sbjct  60   WNLSKGHPHFDEPPAYPYLHIRNKEFPWD  88



>gb|EMS53722.1| hypothetical protein TRIUR3_01395 [Triticum urartu]
Length=62

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWG  282
            KWEKIT  G V CT+LAA NLSKGHPHF++PPAYPY+HIRNKEFPWG
Sbjct  13   KWEKITIMGAVTCTLLAAWNLSKGHPHFDDPPAYPYLHIRNKEFPWG  59



>ref|NP_001078510.1| cytochrome c oxidase subunit 6a [Arabidopsis thaliana]
 gb|AEE86843.1| cytochrome c oxidase subunit 6a [Arabidopsis thaliana]
Length=92

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 68/99 (69%), Gaps = 10/99 (10%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA+ IVRS++  A+     + + A KR+FSSSA HD+A EA+KWEKITY GI +CT LA 
Sbjct  1    MATAIVRSALSRAVTRAAPKTSVAPKRNFSSSAGHDDAYEAAKWEKITYLGIASCTALAV  60

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH  312
              LSKGH H E+PP          EFPWGPDGLFEVKH+
Sbjct  61   YVLSKGHHHGEDPP----------EFPWGPDGLFEVKHN  89



>ref|XP_010941974.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=152

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  88   SKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNK  267
            +KRSFS+SAHHD+A E +KWEKITYAGIV CTIL+  NLSKGH H  EPP YPY+ IRNK
Sbjct  75   NKRSFSASAHHDDAYETAKWEKITYAGIVTCTILSIHNLSKGHRHPPEPPPYPYLRIRNK  134

Query  268  EFPWGPDGLFEVKHH  312
            EFPWGPDGLFE K H
Sbjct  135  EFPWGPDGLFEKKKH  149



>ref|XP_010941975.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=108

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  88   SKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNK  267
            +KRSFS+SAHHD+A E +KWEKITYAGIV CTIL+  NLSKGH H  EPP YPY+ IRNK
Sbjct  31   NKRSFSASAHHDDAYETAKWEKITYAGIVTCTILSIHNLSKGHRHPPEPPPYPYLRIRNK  90

Query  268  EFPWGPDGLFEVKHH  312
            EFPWGPDGLFE K H
Sbjct  91   EFPWGPDGLFEKKKH  105



>gb|EMS62770.1| hypothetical protein TRIUR3_33892 [Triticum urartu]
Length=100

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPW  279
            KWEKIT  G V CT+L A NLSKGHPHF+EPPAYPY+HIRNKEFPW
Sbjct  54   KWEKITIMGAVTCTLLTAWNLSKGHPHFDEPPAYPYLHIRNKEFPW  99



>ref|XP_008776851.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Phoenix 
dactylifera]
Length=108

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  88   SKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNK  267
            +KRSFS+SAHHD+A E +KWEKITYAGIV CTIL+  NLSKGHPH  EPP YPY+HIRNK
Sbjct  32   NKRSFSASAHHDDAYETAKWEKITYAGIVTCTILSIYNLSKGHPHHPEPPPYPYLHIRNK  91

Query  268  EFPWGPDGLFEVKH  309
            EFPWGPDGLFE KH
Sbjct  92   EFPWGPDGLFEKKH  105



>ref|XP_008367805.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Malus domestica]
Length=144

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPD  288
            KWEKITY GI + TILA VNLSK HPH + PPAY Y+HI NK+FPWG +
Sbjct  41   KWEKITYLGIASYTILAFVNLSKQHPHHDAPPAYLYLHILNKDFPWGKN  89



>ref|XP_010099395.1| hypothetical protein L484_007758 [Morus notabilis]
 gb|EXB78240.1| hypothetical protein L484_007758 [Morus notabilis]
Length=116

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 4/76 (5%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPAS-KRSFsssahhdeaaeasKWEKITYAGIVACTIL  189
            MA   +RS + R+ALRGG   RAPA  KR+FSSSAHHD+A E +KWEKITYAGIV CT+L
Sbjct  1    MAMASIRSGLLRTALRGG--SRAPAPPKRNFSSSAHHDDAYETAKWEKITYAGIVTCTVL  58

Query  190  AAVNLSKGHPHFEEPP  237
            A  NLSKGHPH +EPP
Sbjct  59   AIFNLSKGHPHHDEPP  74



>ref|XP_011401533.1| hypothetical protein F751_0787 [Auxenochlorella protothecoides]
 gb|KFM28513.1| hypothetical protein F751_0787 [Auxenochlorella protothecoides]
Length=93

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +1

Query  37   SSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLSKGH  216
             ++R+A R  V+R A  +++        +E  E +KW+ ITY  I  C    A +LS   
Sbjct  3    GALRAATR--VARVAKQTRQFSGKVNIEEEIKEMNKWKIITYVAIPVCIAKGAYDLSHPA  60

Query  217  PHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
             H  E P YP++HIRNKEFPWGPDGLFEVKH
Sbjct  61   HHDAEKPDYPFLHIRNKEFPWGPDGLFEVKH  91



>dbj|BAK06331.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=76

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  166  GIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGL  294
            G V CT+LAA NLSKGHPH++EPPAYPY+ IRNKEFPWG + L
Sbjct  2    GAVTCTLLAAWNLSKGHPHYDEPPAYPYLRIRNKEFPWGMNLL  44



>ref|XP_006852768.1| hypothetical protein AMTR_s00033p00138450 [Amborella trichopoda]
 gb|ERN14235.1| hypothetical protein AMTR_s00033p00138450 [Amborella trichopoda]
Length=92

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +1

Query  16   MASTIVRSSIRSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAA  195
            MA  + RS  R+ALR     + P  KRSF+SSAHHD+  EA KWEKITY GIV CT+LA 
Sbjct  1    MAQALWRSGFRAALRRSGQAQVP-QKRSFASSAHHDDTHEAEKWEKITYLGIVTCTVLAV  59

Query  196  VNLSKGHPHFEEPPAYPYMHIRNKEFPW  279
             NLSKGHPH+ +PP YPY+HIRNKEFPW
Sbjct  60   YNLSKGHPHYPDPPPYPYLHIRNKEFPW  87



>ref|XP_001764988.1| predicted protein [Physcomitrella patens]
 gb|EDQ70204.1| predicted protein [Physcomitrella patens]
Length=112

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = +1

Query  46   RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLS-KGHPH  222
            ++A  G V++R  ASK     S  HD+A E +KW  IT A  + C  +    L+ + H H
Sbjct  23   QTARDGAVAKRFFASK-----SHAHDDAEETAKWRSITIAAYIMCVGMGIYTLANEEHGH  77

Query  223  FEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
              E P Y Y+HIRNK+FPWGPDGLFE KH
Sbjct  78   GGETPGYSYLHIRNKQFPWGPDGLFEYKH  106



>ref|XP_001762163.1| predicted protein [Physcomitrella patens]
 gb|EDQ72955.1| predicted protein [Physcomitrella patens]
Length=112

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = +1

Query  10   ERMASTIVRSSIRSALRGGVSRRAPASKRSFsssahh-deaaeasKWEKITYAGIVACTI  186
            +R+ + + R  I S L G  ++   ASKR F+S +H  D+A E +KW  IT A  + C  
Sbjct  7    QRLGALLSRP-ISSPL-GQTAQTGAASKRFFASKSHAHDDAEETAKWRSITIAAYIMCIG  64

Query  187  LAAVNLS-KGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKH  309
            +    L+ + H H  E P Y Y+HIRNK+FPWGPDGLFE KH
Sbjct  65   MGIYILANEEHGHDGEKPGYSYLHIRNKQFPWGPDGLFEYKH  106



>tpg|DAA51649.1| TPA: hypothetical protein ZEAMMB73_591450 [Zea mays]
Length=65

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 46/69 (67%), Gaps = 8/69 (12%)
 Frame = +1

Query  16   MASTIVRSSIRS-ALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MAS   RS +RS A+R G  RR  +S         HD+A E +KWEKITYAGIV CT+LA
Sbjct  1    MASAAARSGLRSLAVRAGPLRRRMSSS-------VHDDAYETAKWEKITYAGIVTCTLLA  53

Query  193  AVNLSKGHP  219
            A NLSKGHP
Sbjct  54   AYNLSKGHP  62



>ref|XP_005651687.1| hypothetical protein COCSUDRAFT_52086 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27143.1| hypothetical protein COCSUDRAFT_52086 [Coccomyxa subellipsoidea 
C-169]
Length=106

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 5/90 (6%)
 Frame = +1

Query  46   RSALRGGVSRRAPASKRSFsssahhdeaaeasK----WEKITYAGIVACTILAAVNLSKG  213
            R AL+   SR AP+  R     +      E  K    W+K++ A I  C  +A  +LS  
Sbjct  5    RCALQRFTSR-APSQLRQIRQMSGAVSHEEEIKQMYFWQKVSLAAIPVCVGVAIWDLSHA  63

Query  214  HPHFEEPPAYPYMHIRNKEFPWGPDGLFEV  303
            H H  +   YPYMHIR K+FPWG   LF+ 
Sbjct  64   HEHDHDQIQYPYMHIRTKDFPWGACSLFDT  93



>ref|XP_005842874.1| hypothetical protein CHLNCDRAFT_142490 [Chlorella variabilis]
 gb|EFN50762.1| hypothetical protein CHLNCDRAFT_142490 [Chlorella variabilis]
Length=98

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVK  306
            KW+ I++  I  C  L A+ LS  H H    P YPYM  + K+FPWGPD LF  K
Sbjct  44   KWKMISFGCIPVCVGLGALTLSNAHTHHRHAPNYPYMLYKVKDFPWGPDPLFGYK  98



>gb|KJB18102.1| hypothetical protein B456_003G034000 [Gossypium raimondii]
Length=74

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  16   MASTIVRSSI-RSALRGGVSRRAPASKRSFsssahhdeaaeasKWEKITYAGIVACTILA  192
            MA   VRS + R+ALRGG    AP  KR F+SS+HHD+A E +KWEKITY G+  CT+LA
Sbjct  1    MAMASVRSGLLRAALRGGSRPTAP-PKRGFASSSHHDDAYETAKWEKITYLGVATCTVLA  59

Query  193  AVNLSKGHPHF  225
              NLSKG P F
Sbjct  60   IYNLSKGIPIF  70



>gb|KDD75740.1| hypothetical protein H632_c522p1 [Helicosporidium sp. ATCC 50920]
Length=71

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEPPAYPYMH---IRNKEFPWGPDGLFE  300
            KW  +T+  + AC + A V+LS  H H  E PA+PY++   +R+K+FPWG + L E
Sbjct  16   KWRIVTFLAVPACVVKAFVDLSHSHHHSAEKPAFPYLNSTLLRSKDFPWGKNSLLE  71



>ref|XP_010913207.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like 
[Elaeis guineensis]
Length=146

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  88   SKRSFsssahhdeaaeasKWEKITYAGIVACTILAAVNLSKGHPHF--EEPPAYPYMHIR  261
            +K+SFS+SAHH +A E  KWEKITYAGIV CTIL+  NLSKG   +  E  P  P++ +R
Sbjct  26   NKQSFSASAHHGDAYEIVKWEKITYAGIVTCTILSIYNLSKGWRDWGSERQPPPPFVEVR  85



>ref|XP_002993085.1| hypothetical protein SELMODRAFT_449005 [Selaginella moellendorffii]
 gb|EFJ05833.1| hypothetical protein SELMODRAFT_449005 [Selaginella moellendorffii]
Length=795

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 3/54 (6%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKGHPHFEEP-PAYPYMHIRNKEFPWGPDGLFE  300
            KW+KIT   I+ C  L        HP   EP   YPYM++R+K+FPWGPD L +
Sbjct  737  KWKKITLGMIIVC--LCDGFYVYNHPEVHEPRKEYPYMNVRHKDFPWGPDPLLK  788



>ref|XP_001421755.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00049.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=77

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 32/58 (55%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKG-HPHFEEPPAYPYMHIRNKE-FPWGPD-GLFEVK  306
            KW  ++   I AC       LS   H H  E PAY Y+ IRN+E FPWG D GLFE +
Sbjct  16   KWRAVSMLVIPACAGFGVYTLSNAAHGHGHENPAYSYLRIRNREQFPWGGDCGLFEYR  73



>ref|XP_007298972.1| X15341 cytochrome C oxidase subunit [Stereum hirsutum FP-91666 
SS1]
 gb|EIM92611.1| X15341 cytochrome C oxidase subunit [Stereum hirsutum FP-91666 
SS1]
Length=128

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +1

Query  145  WEKITY----AGIVACTILAAVNLSKGHP------------HFEEPPAYPYMHIRNKEFP  276
            W KI+Y      IVACT L   N    H             H  +PP YPY++ RNK FP
Sbjct  51   WRKISYFVAVPAIVACT-LWVRNTENDHSEHMDHLRAENDGHLPQPPDYPYLNRRNKPFP  109

Query  277  WGPDGLF  297
            WGP+ LF
Sbjct  110  WGPNSLF  116



>ref|XP_001773110.1| predicted protein [Physcomitrella patens]
 gb|EDQ62150.1| predicted protein [Physcomitrella patens]
Length=128

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 3/67 (4%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKG--HPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKHH*  315
            +W  IT A ++ C +    N   G  H H E+ PAY Y+ IRNK FPWG   +   +   
Sbjct  49   QWRNITIAAVMGC-MGTVFNTFSGEEHHHPEDRPAYSYLRIRNKAFPWGTSFILLTQLMW  107

Query  316  LLQTSLR  336
            L++ S++
Sbjct  108  LMEASVK  114



>ref|XP_007508481.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20098.1| predicted protein [Bathycoccus prasinos]
Length=67

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 3/59 (5%)
 Frame = +1

Query  142  KWEKITYAGIVACTILAAVNLSKG-HPHFEEPPAYPYMHIRNKE-FPWGPD-GLFEVKH  309
            KW  +T+  I AC      + +   H H EE PAY Y+  R++E +PWG D GLFE  H
Sbjct  3    KWRTVTFLAIPACAAFGVYSFATAEHGHGEEQPAYSYLKRRSREQWPWGGDLGLFEYPH  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200