BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H13

Length=472
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP15690.1|  unnamed protein product                                158   7e-61   Coffea canephora [robusta coffee]
ref|XP_011082149.1|  PREDICTED: protein notum homolog isoform X1        161   5e-60   
ref|XP_010644665.1|  PREDICTED: uncharacterized protein LOC100245856    157   6e-60   Vitis vinifera
ref|XP_011073252.1|  PREDICTED: protein notum homolog isoform X2        163   7e-60   Sesamum indicum [beniseed]
ref|XP_011073171.1|  PREDICTED: protein notum homolog isoform X1        163   9e-60   
gb|ACF05806.1|  PAE                                                     151   2e-58   Litchi chinensis [litchi]
ref|XP_008808358.1|  PREDICTED: protein notum homolog                   156   1e-57   Phoenix dactylifera
gb|KCW72721.1|  hypothetical protein EUGRSUZ_E01170                     150   4e-57   Eucalyptus grandis [rose gum]
gb|KCW72726.1|  hypothetical protein EUGRSUZ_E01170                     150   4e-57   Eucalyptus grandis [rose gum]
gb|KCW72722.1|  hypothetical protein EUGRSUZ_E01170                     150   4e-57   Eucalyptus grandis [rose gum]
ref|XP_010056136.1|  PREDICTED: protein notum homolog                   150   5e-57   Eucalyptus grandis [rose gum]
gb|KCW72723.1|  hypothetical protein EUGRSUZ_E01170                     150   5e-57   Eucalyptus grandis [rose gum]
ref|XP_010942978.1|  PREDICTED: uncharacterized protein LOC105060...    152   7e-57   Elaeis guineensis
ref|XP_010942975.1|  PREDICTED: protein notum homolog isoform X1        152   8e-57   Elaeis guineensis
ref|XP_010942979.1|  PREDICTED: uncharacterized protein LOC105060...    152   1e-56   Elaeis guineensis
gb|EYU29130.1|  hypothetical protein MIMGU_mgv1a007782mg                151   1e-56   Erythranthe guttata [common monkey flower]
gb|EYU29131.1|  hypothetical protein MIMGU_mgv1a007782mg                151   1e-56   Erythranthe guttata [common monkey flower]
ref|XP_009616254.1|  PREDICTED: protein notum homolog                   146   2e-56   Nicotiana tomentosiformis
gb|KDO40418.1|  hypothetical protein CISIN_1g013734mg                   147   3e-56   Citrus sinensis [apfelsine]
ref|XP_009794297.1|  PREDICTED: protein notum homolog                   146   3e-56   Nicotiana sylvestris
ref|XP_010056129.1|  PREDICTED: protein notum homolog isoform X1        149   3e-56   Eucalyptus grandis [rose gum]
gb|KCW72720.1|  hypothetical protein EUGRSUZ_E01169                     149   3e-56   Eucalyptus grandis [rose gum]
ref|XP_010056132.1|  PREDICTED: protein notum homolog isoform X3        149   4e-56   Eucalyptus grandis [rose gum]
ref|XP_010056131.1|  PREDICTED: protein notum homolog isoform X2        149   4e-56   Eucalyptus grandis [rose gum]
ref|XP_006432878.1|  hypothetical protein CICLE_v100013712mg            147   5e-56   
gb|KDO40416.1|  hypothetical protein CISIN_1g013734mg                   146   6e-56   Citrus sinensis [apfelsine]
gb|KDO40412.1|  hypothetical protein CISIN_1g013734mg                   146   7e-56   Citrus sinensis [apfelsine]
ref|XP_006471634.1|  PREDICTED: uncharacterized protein LOC102628021    146   8e-56   Citrus sinensis [apfelsine]
gb|EYU37455.1|  hypothetical protein MIMGU_mgv1a007934mg                151   9e-56   Erythranthe guttata [common monkey flower]
ref|XP_004509524.1|  PREDICTED: uncharacterized protein LOC101493...    142   1e-55   
gb|KDO40410.1|  hypothetical protein CISIN_1g013734mg                   146   1e-55   Citrus sinensis [apfelsine]
ref|XP_006363875.1|  PREDICTED: protein notum homolog                   147   1e-55   Solanum tuberosum [potatoes]
ref|XP_004509522.1|  PREDICTED: uncharacterized protein LOC101493...    141   2e-55   Cicer arietinum [garbanzo]
gb|AFK37998.1|  unknown                                                 139   2e-55   Lotus japonicus
ref|XP_010056135.1|  PREDICTED: protein notum homolog                   144   2e-55   Eucalyptus grandis [rose gum]
ref|XP_010529277.1|  PREDICTED: protein notum homolog                   147   3e-55   Tarenaya hassleriana [spider flower]
gb|KDP28068.1|  hypothetical protein JCGZ_19476                         145   4e-55   Jatropha curcas
ref|XP_007158098.1|  hypothetical protein PHAVU_002G123900g             143   4e-55   Phaseolus vulgaris [French bean]
ref|XP_011028479.1|  PREDICTED: uncharacterized protein LOC105128...    139   6e-55   Populus euphratica
ref|XP_011028482.1|  PREDICTED: uncharacterized protein LOC105128...    139   9e-55   Populus euphratica
gb|AFK45147.1|  unknown                                                 138   9e-55   Lotus japonicus
ref|XP_010434420.1|  PREDICTED: protein notum homolog                   144   9e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010439718.1|  PREDICTED: protein notum homolog                   144   1e-54   Camelina sativa [gold-of-pleasure]
ref|NP_193677.2|  putative pectinacetylesterase                         143   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002519911.1|  pectin acetylesterase, putative                    142   2e-54   
ref|XP_010325633.1|  PREDICTED: uncharacterized protein LOC101257...    148   2e-54   Solanum lycopersicum
ref|XP_010325632.1|  PREDICTED: protein notum homolog isoform X1        148   2e-54   Solanum lycopersicum
ref|XP_010244169.1|  PREDICTED: protein notum homolog                   138   3e-54   Nelumbo nucifera [Indian lotus]
emb|CAA67728.1|  pectinacetylesterase precursor                         140   5e-54   Vigna radiata var. radiata [golden gram]
ref|XP_011028483.1|  PREDICTED: uncharacterized protein LOC105128...    139   8e-54   Populus euphratica
gb|KHN41567.1|  Protein notum like                                      137   9e-54   Glycine soja [wild soybean]
ref|XP_010449357.1|  PREDICTED: protein notum homolog                   140   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007040902.1|  Pectinacetylesterase family protein                140   1e-53   
ref|XP_006599203.1|  PREDICTED: uncharacterized protein LOC100781...    136   2e-53   Glycine max [soybeans]
ref|XP_004150551.1|  PREDICTED: protein notum homolog                   139   2e-53   
gb|KHN41756.1|  Protein notum like                                      138   2e-53   Glycine soja [wild soybean]
ref|XP_006573491.1|  PREDICTED: protein notum homolog isoform X1        138   2e-53   Glycine max [soybeans]
ref|XP_006573492.1|  PREDICTED: protein notum homolog isoform X2        138   3e-53   
ref|XP_010054028.1|  PREDICTED: uncharacterized protein LOC104442...    139   3e-53   Eucalyptus grandis [rose gum]
ref|XP_010244170.1|  PREDICTED: uncharacterized protein LOC104588061    140   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008238012.1|  PREDICTED: protein notum homolog isoform X2        141   4e-53   Prunus mume [ume]
ref|XP_002867938.1|  pectinacetylesterase family protein                139   4e-53   
ref|XP_007156330.1|  hypothetical protein PHAVU_003G277500g             137   5e-53   Phaseolus vulgaris [French bean]
ref|XP_006385136.1|  hypothetical protein POPTR_0004s24220g             137   6e-53   
ref|XP_007156331.1|  hypothetical protein PHAVU_003G277500g             137   6e-53   Phaseolus vulgaris [French bean]
ref|XP_006385134.1|  hypothetical protein POPTR_0004s24220g             137   7e-53   
ref|XP_006385140.1|  hypothetical protein POPTR_0004s24220g             137   7e-53   
ref|XP_003628995.1|  Notum-like protein                                 132   8e-53   
ref|XP_006385137.1|  hypothetical protein POPTR_0004s24220g             136   1e-52   
gb|AET03471.2|  pectinacetylesterase family protein                     131   1e-52   Medicago truncatula
ref|XP_006385138.1|  hypothetical protein POPTR_0004s24220g             136   1e-52   
gb|KEH20327.1|  pectinacetylesterase family protein                     131   1e-52   Medicago truncatula
ref|XP_007209211.1|  hypothetical protein PRUPE_ppa006668mg             140   1e-52   Prunus persica
gb|ACJ85294.1|  unknown                                                 131   1e-52   Medicago truncatula
emb|CDX99377.1|  BnaC01g11750D                                          136   2e-52   
gb|EEC73846.1|  hypothetical protein OsI_08601                          144   2e-52   Oryza sativa Indica Group [Indian rice]
emb|CDX78933.1|  BnaA01g10000D                                          136   2e-52   
ref|NP_001047850.1|  Os02g0702400                                       144   2e-52   
ref|XP_006587655.1|  PREDICTED: protein notum homolog isoform X1        136   2e-52   Glycine max [soybeans]
ref|XP_006587656.1|  PREDICTED: protein notum homolog isoform X2        136   3e-52   Glycine max [soybeans]
ref|XP_008238015.1|  PREDICTED: protein notum homolog isoform X5        142   3e-52   
ref|XP_008451860.1|  PREDICTED: protein notum homolog isoform X1        135   3e-52   Cucumis melo [Oriental melon]
ref|XP_010266386.1|  PREDICTED: uncharacterized protein LOC104603...    139   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008238014.1|  PREDICTED: protein notum homolog isoform X4        142   3e-52   
ref|XP_008451861.1|  PREDICTED: protein notum homolog isoform X2        135   3e-52   Cucumis melo [Oriental melon]
ref|XP_006413980.1|  hypothetical protein EUTSA_v10025385mg             135   4e-52   
ref|XP_006587657.1|  PREDICTED: protein notum homolog isoform X3        136   4e-52   
ref|XP_010536220.1|  PREDICTED: protein notum homolog isoform X1        138   4e-52   Tarenaya hassleriana [spider flower]
ref|XP_009398466.1|  PREDICTED: protein notum homolog                   139   4e-52   
ref|XP_008238013.1|  PREDICTED: protein notum homolog isoform X3        142   4e-52   
ref|XP_009132797.1|  PREDICTED: protein notum homolog                   135   4e-52   Brassica rapa
ref|NP_001151183.1|  LOC100284816 precursor                             143   4e-52   Zea mays [maize]
ref|XP_004172255.1|  PREDICTED: protein notum homolog                   138   4e-52   
ref|XP_008238011.1|  PREDICTED: protein notum homolog isoform X1        141   5e-52   Prunus mume [ume]
gb|EMT14315.1|  hypothetical protein F775_08483                         147   5e-52   
gb|KJB24941.1|  hypothetical protein B456_004G175900                    135   5e-52   Gossypium raimondii
ref|XP_010266383.1|  PREDICTED: uncharacterized protein LOC104603...    139   5e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010266384.1|  PREDICTED: uncharacterized protein LOC104603...    139   6e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010266380.1|  PREDICTED: uncharacterized protein LOC104603...    144   7e-52   
ref|XP_010266381.1|  PREDICTED: uncharacterized protein LOC104603...    144   8e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010235850.1|  PREDICTED: protein notum homolog isoform X1        142   1e-51   Brachypodium distachyon [annual false brome]
gb|EPS71696.1|  hypothetical protein M569_03061                         140   1e-51   Genlisea aurea
ref|XP_010676220.1|  PREDICTED: uncharacterized protein LOC104892094    139   1e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004512349.1|  PREDICTED: protein notum homolog isoform X1        132   1e-51   
gb|ACG39759.1|  carboxylic ester hydrolase                              140   2e-51   Zea mays [maize]
ref|XP_009108427.1|  PREDICTED: protein notum homolog                   132   2e-51   Brassica rapa
gb|AGT16732.1|  carboxylic ester hydrolase                              142   3e-51   Saccharum hybrid cultivar R570
emb|CDY09289.1|  BnaC03g63190D                                          132   4e-51   Brassica napus [oilseed rape]
ref|XP_004953591.1|  PREDICTED: protein notum homolog isoform X2        138   5e-51   
gb|EYU29129.1|  hypothetical protein MIMGU_mgv1a023759mg                137   5e-51   Erythranthe guttata [common monkey flower]
ref|XP_009627060.1|  PREDICTED: uncharacterized protein LOC104117690    136   5e-51   Nicotiana tomentosiformis
ref|XP_006432880.1|  hypothetical protein CICLE_v10001467mg             129   6e-51   Citrus clementina [clementine]
ref|XP_004953590.1|  PREDICTED: protein notum homolog isoform X1        137   7e-51   Setaria italica
ref|XP_006361581.1|  PREDICTED: protein notum homolog                   142   7e-51   Solanum tuberosum [potatoes]
ref|XP_009771151.1|  PREDICTED: uncharacterized protein LOC104221730    136   1e-50   Nicotiana sylvestris
ref|XP_004512351.1|  PREDICTED: protein notum homolog isoform X3        132   1e-50   Cicer arietinum [garbanzo]
ref|XP_006494119.1|  PREDICTED: protein notum homolog isoform X1        127   1e-50   
ref|XP_002454426.1|  hypothetical protein SORBIDRAFT_04g030720          135   2e-50   Sorghum bicolor [broomcorn]
gb|ABK24433.1|  unknown                                                 135   2e-50   Picea sitchensis
gb|ABK24994.1|  unknown                                                 135   3e-50   Picea sitchensis
ref|XP_006432881.1|  hypothetical protein CICLE_v10001426mg             126   3e-50   Citrus clementina [clementine]
ref|XP_006368062.1|  PREDICTED: protein notum homolog                   137   5e-50   Solanum tuberosum [potatoes]
ref|XP_007156332.1|  hypothetical protein PHAVU_003G277600g             134   6e-50   Phaseolus vulgaris [French bean]
ref|XP_004300392.1|  PREDICTED: pectin acetylesterase 8-like            123   7e-50   Fragaria vesca subsp. vesca
ref|XP_004244443.1|  PREDICTED: uncharacterized protein LOC101251798    140   9e-50   Solanum lycopersicum
ref|XP_008373439.1|  PREDICTED: protein notum homolog isoform X2        138   9e-50   Malus domestica [apple tree]
ref|XP_010327577.1|  PREDICTED: uncharacterized protein LOC101244626    137   1e-49   
ref|XP_008373438.1|  PREDICTED: protein notum homolog isoform X1        138   1e-49   Malus domestica [apple tree]
ref|XP_009797415.1|  PREDICTED: uncharacterized protein LOC104243851    136   1e-49   Nicotiana sylvestris
ref|XP_010677538.1|  PREDICTED: protein notum homolog isoform X1        137   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002303225.2|  pectinacetylesterase family protein                130   2e-49   
gb|KHG23648.1|  Notum                                                   134   2e-49   Gossypium arboreum [tree cotton]
ref|XP_008238076.1|  PREDICTED: uncharacterized protein LOC103336755    122   3e-49   Prunus mume [ume]
ref|XP_010248193.1|  PREDICTED: uncharacterized protein LOC104591101    134   3e-49   
ref|XP_011012520.1|  PREDICTED: protein notum homolog                   129   4e-49   Populus euphratica
ref|XP_009350399.1|  PREDICTED: protein notum homolog                   122   6e-49   Pyrus x bretschneideri [bai li]
ref|XP_008355284.1|  PREDICTED: uncharacterized protein LOC103418943    122   7e-49   
ref|XP_004300391.1|  PREDICTED: pectin acetylesterase 8-like            132   1e-48   Fragaria vesca subsp. vesca
ref|XP_009592441.1|  PREDICTED: uncharacterized protein LOC104089292    133   2e-48   Nicotiana tomentosiformis
ref|XP_010054026.1|  PREDICTED: uncharacterized protein LOC104442...    122   4e-48   Eucalyptus grandis [rose gum]
gb|EMT15342.1|  hypothetical protein F775_17167                         127   6e-48   
gb|KDP28067.1|  hypothetical protein JCGZ_19475                         126   6e-48   Jatropha curcas
ref|XP_003628996.1|  Carboxylic ester hydrolase                         128   7e-48   Medicago truncatula
ref|XP_003547821.1|  PREDICTED: protein notum homolog                   121   7e-48   Glycine max [soybeans]
ref|XP_008365238.1|  PREDICTED: uncharacterized protein LOC103428882    121   1e-47   
ref|XP_010677539.1|  PREDICTED: protein notum homolog isoform X2        137   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006385133.1|  pectinacetylesterase family protein                125   1e-47   Populus trichocarpa [western balsam poplar]
gb|KHN27509.1|  Protein notum like                                      120   2e-47   Glycine soja [wild soybean]
ref|XP_003547731.1|  PREDICTED: protein notum homolog isoform X1        120   2e-47   Glycine max [soybeans]
gb|KCW72718.1|  hypothetical protein EUGRSUZ_E01169                     120   2e-47   Eucalyptus grandis [rose gum]
gb|AAP72959.1|  pectin acetylesterase                                   125   2e-47   Lactuca sativa [cultivated lettuce]
ref|XP_011028476.1|  PREDICTED: protein notum homolog                   125   3e-47   Populus euphratica
ref|XP_011082152.1|  PREDICTED: protein notum homolog isoform X2        117   9e-47   
ref|XP_002519912.1|  pectin acetylesterase, putative                    122   1e-46   
gb|AFK37852.1|  unknown                                                 118   1e-46   Lotus japonicus
ref|XP_003613922.1|  Notum-like protein                                 119   1e-46   Medicago truncatula
ref|XP_004509558.1|  PREDICTED: protein notum homolog                   120   1e-46   Cicer arietinum [garbanzo]
ref|XP_007040900.1|  Pectinacetylesterase family protein                130   1e-46   
ref|XP_008347803.1|  PREDICTED: uncharacterized protein LOC103410929    117   2e-46   
gb|ADR82372.1|  pectin acetylesterase                                   122   2e-46   Populus trichocarpa [western balsam poplar]
gb|KDP28066.1|  hypothetical protein JCGZ_19474                         121   3e-46   Jatropha curcas
ref|XP_010536210.1|  PREDICTED: uncharacterized protein LOC104811251    120   4e-46   Tarenaya hassleriana [spider flower]
ref|XP_008808370.1|  PREDICTED: uncharacterized protein LOC103720...    115   5e-46   
ref|XP_008808367.1|  PREDICTED: uncharacterized protein LOC103720...    115   6e-46   
ref|XP_008808368.1|  PREDICTED: uncharacterized protein LOC103720...    115   6e-46   
ref|XP_010111521.1|  hypothetical protein L484_021346                   110   7e-46   
ref|XP_009397056.1|  PREDICTED: protein notum homolog                   116   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN27511.1|  Protein notum like                                      114   2e-45   Glycine soja [wild soybean]
ref|XP_003548585.1|  PREDICTED: protein notum homolog                   114   2e-45   
ref|XP_006359968.1|  PREDICTED: protein notum homolog                   122   3e-45   
ref|XP_010911666.1|  PREDICTED: protein notum homolog                   117   4e-45   Elaeis guineensis
ref|XP_009388128.1|  PREDICTED: protein notum homolog                   114   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003547822.1|  PREDICTED: protein notum homolog                   115   5e-45   Glycine max [soybeans]
gb|ACS68714.1|  pectinacetylesterase precursor                          130   6e-45   Sonneratia alba
ref|XP_006413981.1|  hypothetical protein EUTSA_v10024796mg             114   9e-45   
ref|XP_010942974.1|  PREDICTED: protein notum homolog                   114   1e-44   Elaeis guineensis
ref|XP_008797987.1|  PREDICTED: protein notum homolog isoform X1        113   2e-44   Phoenix dactylifera
ref|XP_010536189.1|  PREDICTED: uncharacterized protein LOC104811...    115   2e-44   Tarenaya hassleriana [spider flower]
gb|KHG09455.1|  Protein notum                                           137   2e-44   Gossypium arboreum [tree cotton]
gb|KJB25075.1|  hypothetical protein B456_004G176200                    137   2e-44   Gossypium raimondii
gb|AAM65412.1|  pectin acetylesterase                                   116   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974575.2|  putative pectinacetylesterase                         109   4e-44   
ref|XP_010494620.1|  PREDICTED: uncharacterized protein LOC104771742    116   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006280604.1|  hypothetical protein CARUB_v10026563mg             116   4e-44   Capsella rubella
ref|XP_010441760.1|  PREDICTED: uncharacterized protein LOC104724893    116   4e-44   Camelina sativa [gold-of-pleasure]
ref|NP_851135.1|  pectinacetylesterase family protein                   116   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199341.1|  pectinacetylesterase family protein                   116   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398195.1|  hypothetical protein EUTSA_v10000914mg             115   6e-44   Eutrema salsugineum [saltwater cress]
ref|XP_009128780.1|  PREDICTED: uncharacterized protein LOC103853624    115   7e-44   Brassica rapa
emb|CDX87799.1|  BnaC02g31500D                                          115   7e-44   
emb|CDY26383.1|  BnaA02g23870D                                          115   7e-44   Brassica napus [oilseed rape]
ref|XP_010481611.1|  PREDICTED: uncharacterized protein LOC104760390    115   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006424455.1|  hypothetical protein CICLE_v10030247mg             111   8e-44   
ref|NP_001190770.1|  pectinacetylesterase family protein                111   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865253.1|  pectin acetylesterase                              114   1e-43   
ref|XP_009108426.1|  PREDICTED: protein notum homolog                   114   1e-43   Brassica rapa
emb|CDY09287.1|  BnaC03g63170D                                          114   1e-43   Brassica napus [oilseed rape]
ref|XP_006283887.1|  hypothetical protein CARUB_v10005004mg             117   2e-43   Capsella rubella
gb|KDO40409.1|  hypothetical protein CISIN_1g016608mg                   105   2e-43   Citrus sinensis [apfelsine]
emb|CDX99378.1|  BnaC01g11740D                                          113   2e-43   
emb|CDX78932.1|  BnaA01g09990D                                          113   3e-43   
ref|XP_009132784.1|  PREDICTED: uncharacterized protein LOC103857370    113   3e-43   Brassica rapa
emb|CDY67801.1|  BnaAnng25210D                                          105   3e-43   Brassica napus [oilseed rape]
ref|XP_006878664.1|  hypothetical protein AMTR_s00011p00266820          157   5e-43   Amborella trichopoda
ref|XP_002867940.1|  hypothetical protein ARALYDRAFT_492921             111   1e-42   
ref|XP_009413211.1|  PREDICTED: protein notum homolog                   112   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD94756.1|  putative pectinacetylesterase protein                  111   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567585.1|  pectinacetylesterase family protein                   111   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434425.1|  PREDICTED: uncharacterized protein LOC104718...    113   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010439720.1|  PREDICTED: uncharacterized protein LOC104723107    113   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010434424.1|  PREDICTED: uncharacterized protein LOC104718...    113   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010449359.1|  PREDICTED: uncharacterized protein LOC104731629    113   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009771153.1|  PREDICTED: uncharacterized protein LOC104221731    113   8e-42   Nicotiana sylvestris
ref|XP_010235852.1|  PREDICTED: protein notum homolog isoform X2        108   2e-41   Brachypodium distachyon [annual false brome]
ref|XP_009589854.1|  PREDICTED: uncharacterized protein LOC104087...    106   4e-41   Nicotiana tomentosiformis
ref|XP_009589853.1|  PREDICTED: uncharacterized protein LOC104087...    106   5e-41   Nicotiana tomentosiformis
gb|KHG23649.1|  Notum                                                   105   1e-40   Gossypium arboreum [tree cotton]
ref|XP_010325697.1|  PREDICTED: uncharacterized protein LOC101260962    108   1e-40   
gb|EEE61621.1|  hypothetical protein OsJ_16047                        97.4    1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006363883.1|  PREDICTED: uncharacterized protein LOC102589191    107   2e-40   
gb|EEC77932.1|  hypothetical protein OsI_17271                        97.1    2e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_010314003.1|  PREDICTED: protein notum homolog isoform X1        104   2e-40   
ref|XP_010314004.1|  PREDICTED: protein notum homolog isoform X2        104   2e-40   
ref|XP_009590663.1|  PREDICTED: protein notum homolog isoform X1        103   2e-40   Nicotiana tomentosiformis
ref|XP_009590665.1|  PREDICTED: uncharacterized protein LOC104087...    103   2e-40   Nicotiana tomentosiformis
ref|XP_009590664.1|  PREDICTED: uncharacterized protein LOC104087...    103   3e-40   Nicotiana tomentosiformis
ref|XP_006365947.1|  PREDICTED: uncharacterized protein LOC102601254    103   4e-40   
ref|XP_009589915.1|  PREDICTED: uncharacterized protein LOC104087...    106   5e-40   Nicotiana tomentosiformis
ref|XP_009589914.1|  PREDICTED: uncharacterized protein LOC104087...    106   5e-40   Nicotiana tomentosiformis
ref|NP_001053773.1|  Os04g0602500                                     97.8    9e-40   
emb|CAD41867.2|  OSJNBa0041A02.14                                     97.1    2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407790.1|  PREDICTED: protein notum homolog                 99.8    3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006652763.1|  PREDICTED: protein notum homolog                   100   3e-39   
ref|XP_004244682.2|  PREDICTED: uncharacterized protein LOC101248898    105   5e-39   Solanum lycopersicum
gb|KJB25078.1|  hypothetical protein B456_004G176200                    119   6e-39   Gossypium raimondii
gb|EMS35701.1|  hypothetical protein TRIUR3_33758                       127   7e-39   Triticum urartu
ref|XP_004246220.1|  PREDICTED: uncharacterized protein LOC101249672    104   1e-38   
ref|XP_009763243.1|  PREDICTED: protein notum homolog isoform X2        101   1e-38   Nicotiana sylvestris
ref|XP_009763242.1|  PREDICTED: protein notum homolog isoform X1        100   2e-38   Nicotiana sylvestris
ref|XP_010240371.1|  PREDICTED: uncharacterized protein LOC100827...  97.4    3e-38   
ref|XP_003580427.1|  PREDICTED: uncharacterized protein LOC100827...  97.1    4e-38   Brachypodium distachyon [annual false brome]
gb|ADE77373.1|  unknown                                               97.1    5e-38   Picea sitchensis
ref|XP_006367726.1|  PREDICTED: uncharacterized protein LOC102600035    102   6e-38   Solanum tuberosum [potatoes]
dbj|BAJ97261.1|  predicted protein                                    95.1    7e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004246219.1|  PREDICTED: protein notum homolog                   100   8e-38   
ref|XP_009408703.1|  PREDICTED: protein notum homolog                 95.1    1e-37   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA36176.1|  TPA: pectinacetylesterase                            99.4    2e-37   
ref|XP_004495819.1|  PREDICTED: uncharacterized protein LOC101503...    113   2e-37   
ref|XP_009407792.1|  PREDICTED: protein notum homolog                 93.6    3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010914804.1|  PREDICTED: protein notum homolog isoform X2        112   3e-37   
ref|XP_007051327.1|  Pectinacetylesterase family protein                113   4e-37   
gb|KHG26188.1|  Protein notum                                           109   4e-37   Gossypium arboreum [tree cotton]
ref|XP_010914803.1|  PREDICTED: protein notum homolog isoform X1        111   5e-37   Elaeis guineensis
ref|XP_004958440.1|  PREDICTED: protein notum homolog                   110   6e-37   Setaria italica
ref|XP_008807933.1|  PREDICTED: protein notum homolog                   111   7e-37   Phoenix dactylifera
ref|XP_009603755.1|  PREDICTED: protein notum homolog isoform X2      94.0    8e-37   Nicotiana tomentosiformis
ref|XP_006361594.1|  PREDICTED: protein notum homolog                 90.5    8e-37   
ref|XP_009626489.1|  PREDICTED: protein notum homolog isoform X1      93.2    8e-37   Nicotiana tomentosiformis
ref|XP_009603747.1|  PREDICTED: protein notum homolog isoform X1      93.6    1e-36   Nicotiana tomentosiformis
gb|AGT17273.1|  hypothetical protein SHCRBa_020_L15_F_100             97.8    1e-36   Saccharum hybrid cultivar R570
ref|XP_010914805.1|  PREDICTED: protein notum homolog                   109   1e-36   Elaeis guineensis
tpg|DAA36173.1|  TPA: hypothetical protein ZEAMMB73_990456            99.4    1e-36   
ref|NP_001060382.1|  Os07g0634600                                       110   1e-36   
ref|XP_003562611.1|  PREDICTED: protein notum homolog                   110   2e-36   Brachypodium distachyon [annual false brome]
gb|KJB81154.1|  hypothetical protein B456_013G131600                    106   2e-36   Gossypium raimondii
gb|AFN53693.1|  pectinacetylesterase                                    101   2e-36   Linum usitatissimum
ref|XP_002461086.1|  hypothetical protein SORBIDRAFT_02g040470          110   2e-36   Sorghum bicolor [broomcorn]
ref|XP_008667853.1|  PREDICTED: hypothetical protein isoform X1       99.0    2e-36   Zea mays [maize]
gb|EMT00101.1|  hypothetical protein F775_14945                       95.5    2e-36   
ref|XP_009778395.1|  PREDICTED: protein notum homolog                 95.1    3e-36   Nicotiana sylvestris
gb|KJB81155.1|  hypothetical protein B456_013G131600                    105   3e-36   Gossypium raimondii
ref|XP_009607289.1|  PREDICTED: protein notum homolog                 94.7    3e-36   Nicotiana tomentosiformis
gb|KJB81156.1|  hypothetical protein B456_013G131600                    105   3e-36   Gossypium raimondii
ref|XP_009797875.1|  PREDICTED: protein notum homolog isoform X1      94.0    4e-36   Nicotiana sylvestris
ref|XP_009797876.1|  PREDICTED: protein notum homolog isoform X2      94.0    4e-36   Nicotiana sylvestris
gb|KJB81153.1|  hypothetical protein B456_013G131600                    105   4e-36   Gossypium raimondii
ref|XP_008369575.1|  PREDICTED: protein notum homolog isoform X2        105   4e-36   Malus domestica [apple tree]
ref|XP_009359821.1|  PREDICTED: protein notum homolog                   105   4e-36   Pyrus x bretschneideri [bai li]
ref|XP_011470038.1|  PREDICTED: pectin acetylesterase 3 isoform X1      111   5e-36   Fragaria vesca subsp. vesca
ref|XP_004288665.1|  PREDICTED: pectin acetylesterase 3 isoform X2      111   5e-36   
ref|XP_006658006.1|  PREDICTED: protein notum homolog                   108   6e-36   
ref|XP_004244767.2|  PREDICTED: protein notum homolog                 94.4    6e-36   
ref|XP_010914807.1|  PREDICTED: protein notum homolog isoform X1        112   7e-36   
ref|XP_010914809.1|  PREDICTED: uncharacterized protein LOC105040...    112   7e-36   
ref|XP_010914808.1|  PREDICTED: uncharacterized protein LOC105040...    112   8e-36   
ref|XP_006302294.1|  hypothetical protein CARUB_v10020343mg             106   8e-36   
ref|XP_002892509.1|  hypothetical protein ARALYDRAFT_311997             102   9e-36   
ref|XP_009799834.1|  PREDICTED: protein notum homolog                 89.4    9e-36   
ref|XP_009600038.1|  PREDICTED: protein notum homolog                 89.0    9e-36   
gb|KCW85008.1|  hypothetical protein EUGRSUZ_B01829                     110   9e-36   
gb|KFK43264.1|  hypothetical protein AALP_AA1G101100                    100   1e-35   
ref|XP_003518126.1|  PREDICTED: protein notum homolog                   110   1e-35   
ref|XP_010042497.1|  PREDICTED: protein notum homolog isoform X1        110   1e-35   
ref|NP_001141895.1|  uncharacterized protein LOC100274042 precursor     108   1e-35   
ref|XP_002318919.2|  hypothetical protein POPTR_0013s00280g             108   1e-35   
gb|AFK38038.1|  unknown                                                 105   1e-35   
ref|XP_009591733.1|  PREDICTED: protein notum homolog                 99.8    1e-35   
ref|XP_002512590.1|  pectin acetylesterase, putative                    107   2e-35   
ref|XP_006302295.1|  hypothetical protein CARUB_v10020343mg             106   2e-35   
emb|CAA18628.1|  putative pectinacetylesterase protein                  111   2e-35   
ref|XP_002279030.1|  PREDICTED: protein notum homolog                   105   2e-35   
ref|XP_009619780.1|  PREDICTED: uncharacterized protein LOC104111729  92.4    2e-35   
emb|CAN62190.1|  hypothetical protein VITISV_020113                     105   3e-35   
emb|CBI39680.3|  unnamed protein product                                105   3e-35   
ref|XP_006306028.1|  hypothetical protein CARUB_v10011324mg             100   3e-35   
ref|XP_009110820.1|  PREDICTED: uncharacterized protein LOC103836327  98.6    3e-35   
emb|CDY31081.1|  BnaA08g26310D                                        98.6    3e-35   
ref|XP_006480336.1|  PREDICTED: protein notum homolog                   105   3e-35   
ref|XP_006423958.1|  hypothetical protein CICLE_v10028674mg             105   3e-35   
ref|XP_008807936.1|  PREDICTED: protein notum homolog isoform X2        108   4e-35   
gb|KHN14241.1|  Protein notum like                                      108   4e-35   
gb|KDP23324.1|  hypothetical protein JCGZ_23157                         103   4e-35   
ref|XP_002894676.1|  hypothetical protein ARALYDRAFT_474842             101   5e-35   
ref|XP_006589089.1|  PREDICTED: protein notum homolog isoform X2        108   5e-35   
ref|XP_006604776.1|  PREDICTED: protein notum homolog isoform X1        105   5e-35   
gb|KJB82698.1|  hypothetical protein B456_013G211000                    103   5e-35   
ref|XP_009759657.1|  PREDICTED: uncharacterized protein LOC104212153  87.4    5e-35   
ref|XP_009794027.1|  PREDICTED: uncharacterized protein LOC104240572  91.7    6e-35   
ref|XP_003521640.1|  PREDICTED: protein notum homolog                   105   6e-35   
ref|XP_006382250.1|  hypothetical protein POPTR_0005s00330g             106   6e-35   
gb|KJB82697.1|  hypothetical protein B456_013G211000                    103   6e-35   
ref|NP_172426.2|  pectinacetylesterase family protein                   101   7e-35   
ref|NP_176072.3|  pectinacetylesterase family protein                   101   7e-35   
ref|XP_010458242.1|  PREDICTED: uncharacterized protein LOC104739548  99.0    7e-35   
gb|AAC33215.1|  Similar to pectinacetylesterase                         101   7e-35   
gb|AAM74495.1|  At1g57590/T8L23_6                                       101   7e-35   
gb|AAG50747.1|AC079733_15  pectinacetylesterase precursor, putative     101   7e-35   
ref|XP_003536008.1|  PREDICTED: protein notum homolog isoform X1        107   7e-35   
gb|KJB82695.1|  hypothetical protein B456_013G211000                    103   8e-35   
ref|XP_010475792.1|  PREDICTED: uncharacterized protein LOC104755150  99.0    8e-35   
ref|XP_011023896.1|  PREDICTED: protein notum homolog                   107   8e-35   
ref|XP_011039058.1|  PREDICTED: protein notum homolog isoform X1        106   8e-35   
ref|XP_007031285.1|  Pectinacetylesterase family protein                102   8e-35   
ref|XP_007145083.1|  hypothetical protein PHAVU_007G208200g             108   8e-35   
gb|EMS59699.1|  hypothetical protein TRIUR3_12152                       108   1e-34   
ref|XP_003536006.1|  PREDICTED: uncharacterized protein LOC100810716    105   1e-34   
gb|KDO86755.1|  hypothetical protein CISIN_1g014548mg                   105   1e-34   
ref|XP_006444638.1|  hypothetical protein CICLE_v10020385mg             104   2e-34   
gb|EYU19373.1|  hypothetical protein MIMGU_mgv1a006907mg                102   2e-34   
gb|EYU19372.1|  hypothetical protein MIMGU_mgv1a006907mg                102   2e-34   
gb|KHN14201.1|  Protein notum like                                      103   2e-34   
gb|KJB41749.1|  hypothetical protein B456_007G118400                    104   2e-34   
ref|XP_011087572.1|  PREDICTED: protein notum homolog isoform X1        103   2e-34   
ref|XP_010490120.1|  PREDICTED: uncharacterized protein LOC104767848  97.8    2e-34   
ref|XP_009335553.1|  PREDICTED: uncharacterized protein LOC103928...    105   2e-34   
gb|KJB41748.1|  hypothetical protein B456_007G118400                    104   2e-34   
ref|XP_010070108.1|  PREDICTED: protein notum homolog                   103   2e-34   
ref|XP_006589537.1|  PREDICTED: protein notum homolog isoform X2      96.7    2e-34   
ref|XP_003535610.2|  PREDICTED: protein notum homolog isoform X1      96.7    2e-34   
gb|EYU37449.1|  hypothetical protein MIMGU_mgv1a011392mg              95.5    2e-34   
ref|XP_010920599.1|  PREDICTED: protein notum homolog isoform X1        105   2e-34   
gb|KCW90689.1|  hypothetical protein EUGRSUZ_A02777                   99.4    3e-34   
ref|XP_010920600.1|  PREDICTED: protein notum homolog isoform X2        105   3e-34   
gb|KCW90690.1|  hypothetical protein EUGRSUZ_A02777                   99.4    3e-34   
gb|EYU37450.1|  hypothetical protein MIMGU_mgv1a012163mg              94.7    3e-34   
ref|XP_007163281.1|  hypothetical protein PHAVU_001G221400g             104   3e-34   
ref|XP_006492439.1|  PREDICTED: protein notum homolog                   103   3e-34   
gb|KDO86754.1|  hypothetical protein CISIN_1g014548mg                   104   3e-34   
gb|KEH43170.1|  pectinacetylesterase family protein                     103   3e-34   
ref|XP_006444639.1|  hypothetical protein CICLE_v10020385mg             103   3e-34   
gb|AFK35535.1|  unknown                                                 101   3e-34   
ref|XP_009366012.1|  PREDICTED: protein notum homolog                   102   4e-34   
dbj|BAJ90066.1|  predicted protein                                      105   4e-34   
ref|XP_010524828.1|  PREDICTED: protein notum homolog                   106   4e-34   
ref|XP_008363955.1|  PREDICTED: protein notum homolog                   102   4e-34   
emb|CDY39939.1|  BnaA09g15210D                                        97.4    4e-34   
ref|XP_008807935.1|  PREDICTED: protein notum homolog isoform X1        105   4e-34   
gb|EMS47505.1|  hypothetical protein TRIUR3_18301                       106   4e-34   
emb|CDY58759.1|  BnaA04g27440D                                          110   4e-34   
ref|XP_009138739.1|  PREDICTED: protein notum homolog isoform X2        110   4e-34   
ref|XP_009138738.1|  PREDICTED: protein notum homolog isoform X1        110   4e-34   
gb|EMT00867.1|  hypothetical protein F775_21765                         105   5e-34   
gb|KHG13045.1|  Protein notum                                           103   5e-34   
ref|XP_004495849.1|  PREDICTED: protein notum homolog isoform X1        102   5e-34   
ref|XP_004494486.1|  PREDICTED: protein notum homolog isoform X2        102   6e-34   
ref|XP_004494485.1|  PREDICTED: protein notum homolog isoform X1        102   6e-34   
ref|XP_002464971.1|  hypothetical protein SORBIDRAFT_01g029710          102   6e-34   
ref|XP_004494487.1|  PREDICTED: protein notum homolog isoform X3        102   6e-34   
gb|KHG08983.1|  Protein notum                                           100   6e-34   
ref|XP_009148769.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.0    6e-34   
ref|XP_010255386.1|  PREDICTED: uncharacterized protein LOC104596068    101   7e-34   
ref|XP_007143429.1|  hypothetical protein PHAVU_007G071700g           95.9    7e-34   
emb|CAA18629.1|  putative pectinacetylesterase                        95.9    7e-34   
ref|XP_006351092.1|  PREDICTED: protein notum homolog                 88.6    9e-34   
ref|XP_004496556.1|  PREDICTED: protein notum homolog                 97.1    9e-34   
ref|XP_010511331.1|  PREDICTED: protein notum homolog                   102   9e-34   
ref|XP_010094916.1|  hypothetical protein L484_022666                 99.4    9e-34   
dbj|BAJ88825.1|  predicted protein                                      100   9e-34   
ref|XP_010318089.1|  PREDICTED: protein notum homolog                 90.1    1e-33   
ref|XP_010493505.1|  PREDICTED: protein notum homolog isoform X2        102   1e-33   
ref|XP_004494501.1|  PREDICTED: uncharacterized protein LOC101497...    103   1e-33   
emb|CDX95291.1|  BnaC09g15790D                                        97.1    1e-33   
gb|KEH32394.1|  pectinacetylesterase family protein                     102   1e-33   
ref|XP_010493504.1|  PREDICTED: protein notum homolog isoform X1        102   1e-33   
ref|XP_009382361.1|  PREDICTED: uncharacterized protein LOC103970...  96.7    1e-33   
ref|XP_008784716.1|  PREDICTED: uncharacterized protein LOC103703587    104   1e-33   
ref|XP_004983741.1|  PREDICTED: protein notum homolog isoform X1      98.6    1e-33   
ref|XP_009382365.1|  PREDICTED: uncharacterized protein LOC103970...  96.7    1e-33   
ref|XP_009382363.1|  PREDICTED: protein notum homolog isoform X3      96.3    1e-33   
ref|XP_003555771.1|  PREDICTED: uncharacterized protein LOC100793403    104   1e-33   
ref|XP_009382362.1|  PREDICTED: uncharacterized protein LOC103970...  96.3    1e-33   
ref|XP_003626088.1|  Pectin acetylesterase                              101   1e-33   
ref|XP_009113357.1|  PREDICTED: protein notum homolog                 96.7    1e-33   
gb|KHG30410.1|  Protein notum                                           100   1e-33   
ref|XP_009382364.1|  PREDICTED: uncharacterized protein LOC103970...  96.3    1e-33   
emb|CDY32190.1|  BnaCnng06990D                                        98.6    1e-33   
ref|XP_008227764.1|  PREDICTED: protein notum homolog isoform X1      97.1    1e-33   
ref|XP_004983743.1|  PREDICTED: protein notum homolog isoform X3      98.6    1e-33   
emb|CDP15161.1|  unnamed protein product                                104   2e-33   
gb|KJB49686.1|  hypothetical protein B456_008G133500                    100   2e-33   
ref|XP_002513692.1|  pectin acetylesterase, putative                  99.8    2e-33   
gb|KFK27676.1|  hypothetical protein AALP_AA8G414200                    102   2e-33   
ref|XP_004983742.1|  PREDICTED: protein notum homolog isoform X2      98.2    2e-33   
ref|XP_004302322.1|  PREDICTED: pectin acetylesterase 12-like           100   2e-33   
gb|KHN12141.1|  Protein notum like                                    98.2    2e-33   
ref|XP_002447050.1|  hypothetical protein SORBIDRAFT_06g027560        85.1    2e-33   
gb|KJB52758.1|  hypothetical protein B456_008G276500                  99.4    2e-33   
gb|KJB49688.1|  hypothetical protein B456_008G133500                    100   2e-33   
ref|XP_008388415.1|  PREDICTED: uncharacterized protein LOC103450...    102   2e-33   
ref|XP_009784099.1|  PREDICTED: protein notum homolog                 89.0    2e-33   
gb|KJB52757.1|  hypothetical protein B456_008G276500                  99.4    2e-33   
ref|XP_008388417.1|  PREDICTED: uncharacterized protein LOC103450...    102   2e-33   
ref|XP_006287831.1|  hypothetical protein CARUB_v10001048mg             102   2e-33   
ref|XP_006606122.1|  PREDICTED: protein notum homolog isoform X1      98.2    2e-33   
ref|XP_003626089.1|  Pectin acetylesterase                              101   2e-33   
ref|XP_007145058.1|  hypothetical protein PHAVU_007G206300g             102   2e-33   
ref|XP_003609911.1|  Pectin acetylesterase                              101   2e-33   
gb|ABK26312.1|  unknown                                                 100   2e-33   
ref|XP_007038710.1|  Pectinacetylesterase family protein isoform 2      100   2e-33   
ref|XP_010421192.1|  PREDICTED: protein notum homolog isoform X2        101   2e-33   
ref|XP_006293476.1|  hypothetical protein CARUB_v10023292mg             102   2e-33   
ref|XP_010454669.1|  PREDICTED: protein notum homolog                   101   2e-33   
ref|XP_010421191.1|  PREDICTED: protein notum homolog isoform X1        101   2e-33   
ref|XP_002515160.1|  pectin acetylesterase, putative                    104   2e-33   
emb|CBI37039.3|  unnamed protein product                                100   2e-33   
ref|XP_006378039.1|  hypothetical protein POPTR_0010s00700g           99.0    2e-33   
ref|XP_002315478.2|  hypothetical protein POPTR_0010s00700g           99.4    2e-33   
ref|XP_010060906.1|  PREDICTED: uncharacterized protein LOC104448...  99.4    2e-33   
ref|XP_008360207.1|  PREDICTED: protein notum homolog isoform X2      97.8    3e-33   
ref|XP_002280816.3|  PREDICTED: protein notum homolog                   100   3e-33   
ref|XP_010060898.1|  PREDICTED: uncharacterized protein LOC104448...  99.0    3e-33   
ref|XP_006363882.1|  PREDICTED: uncharacterized protein LOC102588866  86.7    3e-33   
ref|XP_010546781.1|  PREDICTED: protein notum homolog                   103   3e-33   
gb|ABR16604.1|  unknown                                               97.1    3e-33   
ref|XP_008360208.1|  PREDICTED: protein notum homolog isoform X3      97.8    3e-33   
gb|KJB49685.1|  hypothetical protein B456_008G133500                  99.8    3e-33   
gb|EMT30528.1|  hypothetical protein F775_25893                         105   3e-33   
ref|XP_009626490.1|  PREDICTED: protein notum homolog isoform X2      87.4    3e-33   
ref|XP_008360206.1|  PREDICTED: protein notum homolog isoform X1      97.4    3e-33   
ref|XP_007038709.1|  Pectinacetylesterase family protein isoform 1    99.8    3e-33   
gb|KHN26210.1|  Protein notum like                                      103   3e-33   
ref|XP_009335552.1|  PREDICTED: protein notum homolog isoform X1        103   3e-33   
ref|XP_009601364.1|  PREDICTED: protein notum homolog                 87.0    4e-33   
ref|XP_003551008.1|  PREDICTED: protein notum homolog                 98.6    4e-33   
ref|XP_009805042.1|  PREDICTED: protein notum homolog                   100   4e-33   
gb|AFK45877.1|  unknown                                                 100   4e-33   
ref|XP_007205243.1|  hypothetical protein PRUPE_ppa006114mg             100   4e-33   
ref|XP_006402417.1|  hypothetical protein EUTSA_v10005997mg             103   4e-33   
ref|XP_010240825.1|  PREDICTED: protein notum homolog                   101   4e-33   
ref|XP_010244217.1|  PREDICTED: protein notum homolog                 89.4    5e-33   
ref|XP_004968648.1|  PREDICTED: protein notum homolog                   105   5e-33   
ref|XP_009401967.1|  PREDICTED: uncharacterized protein LOC103985...    100   5e-33   
ref|XP_009353455.1|  PREDICTED: protein notum homolog                 96.7    5e-33   
ref|XP_008388414.1|  PREDICTED: protein notum homolog                   100   5e-33   
ref|XP_008227765.1|  PREDICTED: protein notum homolog isoform X2      96.7    5e-33   
ref|XP_009388076.1|  PREDICTED: protein notum homolog                 99.4    5e-33   
ref|XP_004248530.1|  PREDICTED: protein notum homolog isoform X2      99.8    5e-33   
ref|XP_006421942.1|  hypothetical protein CICLE_v10005117mg           99.8    6e-33   
ref|XP_006840405.1|  hypothetical protein AMTR_s00045p00148030        99.0    6e-33   
ref|XP_004296984.1|  PREDICTED: pectin acetylesterase 10-like         99.4    6e-33   
ref|XP_006355154.1|  PREDICTED: protein notum homolog                 87.8    6e-33   
ref|XP_007154510.1|  hypothetical protein PHAVU_003G124700g           97.4    6e-33   
gb|KHN14181.1|  Protein notum like                                      102   6e-33   
gb|EYU37448.1|  hypothetical protein MIMGU_mgv1a007102mg              87.4    6e-33   
ref|XP_009401969.1|  PREDICTED: uncharacterized protein LOC103985...    100   7e-33   
ref|XP_007221559.1|  hypothetical protein PRUPE_ppa006038mg           96.7    7e-33   
ref|XP_006358515.1|  PREDICTED: protein notum homolog                 98.6    7e-33   
emb|CDY49986.1|  BnaC03g34430D                                        98.6    7e-33   
ref|XP_003626125.1|  Notum-like protein                                 103   7e-33   
ref|XP_006359967.1|  PREDICTED: protein notum homolog                 90.1    8e-33   
ref|XP_007154511.1|  hypothetical protein PHAVU_003G124700g           97.1    8e-33   
ref|XP_006338904.1|  PREDICTED: protein notum homolog isoform X1      99.8    8e-33   
ref|NP_974826.1|  pectinacetylesterase family protein                 99.8    8e-33   
gb|EYU19551.1|  hypothetical protein MIMGU_mgv1a007656mg              98.6    8e-33   
ref|XP_004234401.1|  PREDICTED: uncharacterized protein LOC101253061  95.9    8e-33   
ref|NP_197775.3|  pectinacetylesterase family protein                   100   9e-33   
ref|XP_011084421.1|  PREDICTED: protein notum homolog                 97.1    9e-33   
ref|NP_974827.1|  pectinacetylesterase family protein                 99.8    9e-33   
ref|XP_006353290.1|  PREDICTED: protein notum homolog                 95.5    9e-33   
emb|CDY44262.1|  BnaC02g41550D                                        98.6    1e-32   
ref|XP_006392395.1|  hypothetical protein EUTSA_v10023485mg           97.4    1e-32   
ref|XP_006577186.1|  PREDICTED: protein notum homolog isoform X2        101   1e-32   
emb|CBI37040.3|  unnamed protein product                                100   1e-32   
ref|XP_009600844.1|  PREDICTED: protein notum homolog                 97.4    1e-32   
ref|XP_008363956.1|  PREDICTED: protein notum homolog                   103   1e-32   
gb|ABG33770.1|  pectin acetylesterase precursor                       98.2    1e-32   
ref|XP_010327277.1|  PREDICTED: protein notum homolog isoform X1      99.8    1e-32   
emb|CDY11398.1|  BnaA09g39640D                                          105   1e-32   
ref|XP_010999344.1|  PREDICTED: protein notum homolog isoform X1      96.7    1e-32   
ref|XP_010999345.1|  PREDICTED: protein notum homolog isoform X2      96.7    1e-32   



>emb|CDP15690.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   158 bits (400),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L   +ILLRTE FFVDITYV+SAVAKGAVCLDGSPPAYH DRG G GIN+WL+H EGG W
Sbjct  13   LVNVLILLRTEAFFVDITYVESAVAKGAVCLDGSPPAYHLDRGFGAGINSWLVHIEGGGW  72

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            CNNVTTCL RK+TRLGSS +M KQ+AFSG+L N P
Sbjct  73   CNNVTTCLDRKNTRLGSSKQMAKQLAFSGILANKP  107


 Score =   102 bits (253),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDVEAVNP TNLH+RGARVFVAVIEDLLA
Sbjct  110  NPDFYNWNRVKVRYCDGSSFTGDVEAVNPATNLHYRGARVFVAVIEDLLA  159



>ref|XP_011082149.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082150.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082151.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=398

 Score =   161 bits (408),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L F MI+LRTE F+VDITYV+SAVAKGAVCLDGSPPAYH DRG G GINNWL+H EGG W
Sbjct  12   LVFMMIVLRTESFYVDITYVRSAVAKGAVCLDGSPPAYHLDRGYGTGINNWLVHIEGGGW  71

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            CNNVTTCLARK+ RLGSS  MVKQ+AFSG+L N
Sbjct  72   CNNVTTCLARKNNRLGSSKYMVKQLAFSGILNN  104


 Score = 96.3 bits (238),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDVEAVNP T LH+RGARVF+AV+EDLLA
Sbjct  109  NPDFYNWNRVKVRYCDGASFTGDVEAVNPVTKLHYRGARVFLAVMEDLLA  158



>ref|XP_010644665.1| PREDICTED: uncharacterized protein LOC100245856 [Vitis vinifera]
 emb|CBI29219.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   157 bits (398),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            LAF +ILL+TEGF+V ITYV SAVAKGAVCLDGSPPAYH D+G G GINNWL+H EGG W
Sbjct  13   LAFSLILLKTEGFYVGITYVDSAVAKGAVCLDGSPPAYHMDKGFGAGINNWLVHIEGGGW  72

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            CNN +TCLAR+D RLGSS +MVKQ+AFSG+L N
Sbjct  73   CNNASTCLARRDNRLGSSKQMVKQIAFSGILSN  105


 Score = 99.8 bits (247),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN+IKVRYCDG+SFTGDVEAV+PKTNLH+RGARVF+AVIEDL+A
Sbjct  110  NPDFYNWNKIKVRYCDGASFTGDVEAVDPKTNLHYRGARVFLAVIEDLMA  159



>ref|XP_011073252.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=398

 Score =   163 bits (413),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            +Q+W V+ +   MI+LRTE FFVDITYVQSAVAKGAVCLDGSPPAYH D+GSG GINNWL
Sbjct  5    LQQWSVF-VVCLMIVLRTESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWL  63

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            +H EGG WCNNVTTCLAR  TRLGSS  M KQ+AFSG+  N P
Sbjct  64   VHVEGGGWCNNVTTCLARTKTRLGSSKLMAKQIAFSGIFSNKP  106


 Score = 93.6 bits (231),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVE V+P T L++RGARVFVAVIEDLLA
Sbjct  109  NPDFYNWNRIKVRYCDGASFTGDVEVVDPATKLYYRGARVFVAVIEDLLA  158



>ref|XP_011073171.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=422

 Score =   163 bits (413),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            +Q+W V+ +   MI+LRTE FFVDITYVQSAVAKGAVCLDGSPPAYH D+GSG GINNWL
Sbjct  29   LQQWSVF-VVCLMIVLRTESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWL  87

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            +H EGG WCNNVTTCLAR  TRLGSS  M KQ+AFSG+  N P
Sbjct  88   VHVEGGGWCNNVTTCLARTKTRLGSSKLMAKQIAFSGIFSNKP  130


 Score = 93.6 bits (231),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVE V+P T L++RGARVFVAVIEDLLA
Sbjct  133  NPDFYNWNRIKVRYCDGASFTGDVEVVDPATKLYYRGARVFVAVIEDLLA  182



>gb|ACF05806.1| PAE [Litchi chinensis]
Length=399

 Score =   151 bits (381),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +ILL+TEGF V ITYV++AVAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKTEGFDVGITYVENAVAKGAVCLDGSPPAYHLDKGFGAGINNWLVHIEGGGWCNNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            TTCL+RK+TRLGSS KMVK VAFSG+L N
Sbjct  77   TTCLSRKNTRLGSSKKMVKVVAFSGMLSN  105


 Score =   101 bits (251),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAVNP TNLHFRGARVF+A+IEDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVEAVNPATNLHFRGARVFLAIIEDLLA  159



>ref|XP_008808358.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=397

 Score =   156 bits (395),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            +Y L   +I L+ EG+FVDITYV+SAVAKGAVCLDGSPPAYH   G G G+NNWL+H EG
Sbjct  10   IYALICLLIFLKAEGYFVDITYVESAVAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            G WCNNVTTCLARK TRLGSS +MVKQ+AFSG+L N
Sbjct  70   GGWCNNVTTCLARKSTRLGSSRQMVKQIAFSGILNN  105


 Score = 93.6 bits (231),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDV+ VNP TNLH+RGARV++AV+EDLLA
Sbjct  110  NPDFYNWNKVKVRYCDGSSFTGDVKRVNPTTNLHYRGARVWLAVMEDLLA  159



>gb|KCW72721.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   150 bits (378),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G NNWL
Sbjct  6    LRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            I FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N
Sbjct  65   ILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSN  105


 Score = 98.2 bits (243),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN+IKVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA++EDL++
Sbjct  110  NPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMS  159



>gb|KCW72726.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=373

 Score =   150 bits (378),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G NNWL
Sbjct  6    LRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            I FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N
Sbjct  65   ILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSN  105


 Score = 98.2 bits (243),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN+IKVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA++EDL++
Sbjct  110  NPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMS  159



>gb|KCW72722.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   150 bits (378),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G NNWL
Sbjct  6    LRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            I FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N
Sbjct  65   ILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSN  105


 Score = 98.2 bits (243),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN+IKVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA++EDL++
Sbjct  110  NPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMS  159



>ref|XP_010056136.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW72724.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
 gb|KCW72725.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=399

 Score =   150 bits (378),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G NNWL
Sbjct  6    LRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            I FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N
Sbjct  65   ILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSN  105


 Score = 97.8 bits (242),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN+IKVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA++EDL++
Sbjct  110  NPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMS  159



>gb|KCW72723.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   150 bits (378),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G NNWL
Sbjct  6    LRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            I FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N
Sbjct  65   ILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSN  105


 Score = 97.8 bits (242),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN+IKVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA++EDL++
Sbjct  110  NPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMS  159



>ref|XP_010942978.1| PREDICTED: uncharacterized protein LOC105060830 isoform X2 [Elaeis 
guineensis]
Length=371

 Score =   152 bits (384),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            +Y L   +I L+ EG+FVDITYV+SA+AKGAVCLDGSPPAYH   G G G+NNWL+H EG
Sbjct  10   IYALICLLIFLKAEGYFVDITYVESALAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            G WCNNVTTCLARK++RLGSS  M KQ+AFSG+L N
Sbjct  70   GGWCNNVTTCLARKNSRLGSSRHMAKQIAFSGILNN  105


 Score = 95.1 bits (235),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE VNP TNLH+RGARV++AV+EDLLA
Sbjct  110  NPDFYNWNKVKVRYCDGSSFTGDVERVNPATNLHYRGARVWLAVMEDLLA  159



>ref|XP_010942975.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
 ref|XP_010942976.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=397

 Score =   152 bits (383),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            +Y L   +I L+ EG+FVDITYV+SA+AKGAVCLDGSPPAYH   G G G+NNWL+H EG
Sbjct  10   IYALICLLIFLKAEGYFVDITYVESALAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            G WCNNVTTCLARK++RLGSS  M KQ+AFSG+L N
Sbjct  70   GGWCNNVTTCLARKNSRLGSSRHMAKQIAFSGILNN  105


 Score = 95.1 bits (235),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE VNP TNLH+RGARV++AV+EDLLA
Sbjct  110  NPDFYNWNKVKVRYCDGSSFTGDVERVNPATNLHYRGARVWLAVMEDLLA  159



>ref|XP_010942979.1| PREDICTED: uncharacterized protein LOC105060830 isoform X3 [Elaeis 
guineensis]
Length=353

 Score =   152 bits (383),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            +Y L   +I L+ EG+FVDITYV+SA+AKGAVCLDGSPPAYH   G G G+NNWL+H EG
Sbjct  10   IYALICLLIFLKAEGYFVDITYVESALAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            G WCNNVTTCLARK++RLGSS  M KQ+AFSG+L N
Sbjct  70   GGWCNNVTTCLARKNSRLGSSRHMAKQIAFSGILNN  105


 Score = 94.7 bits (234),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE VNP TNLH+RGARV++AV+EDLLA
Sbjct  110  NPDFYNWNKVKVRYCDGSSFTGDVERVNPATNLHYRGARVWLAVMEDLLA  159



>gb|EYU29130.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=395

 Score =   151 bits (382),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  33   LAFFMILL--RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGG  206
            L  +M+++  R E FFVDITYV+SAVAKGAVCLDGS PAYHFD+GSG GINNWL+H EGG
Sbjct  6    LLIYMVIIVGRGESFFVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGG  65

Query  207  AWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
             WCNN TTCLAR++ RLGSS +M KQ+AFSG+  N P
Sbjct  66   GWCNNATTCLARRNGRLGSSKQMAKQIAFSGIFSNKP  102


 Score = 95.1 bits (235),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDVEAV+P T L++RGARVFVAVIEDLLA
Sbjct  105  NPDFYNWNRLKVRYCDGASFTGDVEAVDPATKLYYRGARVFVAVIEDLLA  154



>gb|EYU29131.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=394

 Score =   151 bits (382),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  33   LAFFMILL--RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGG  206
            L  +M+++  R E FFVDITYV+SAVAKGAVCLDGS PAYHFD+GSG GINNWL+H EGG
Sbjct  6    LLIYMVIIVGRGESFFVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGG  65

Query  207  AWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
             WCNN TTCLAR++ RLGSS +M KQ+AFSG+  N P
Sbjct  66   GWCNNATTCLARRNGRLGSSKQMAKQIAFSGIFSNKP  102


 Score = 95.1 bits (235),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDVEAV+P T L++RGARVFVAVIEDLLA
Sbjct  105  NPDFYNWNRLKVRYCDGASFTGDVEAVDPATKLYYRGARVFVAVIEDLLA  154



>ref|XP_009616254.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=404

 Score =   146 bits (369),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            V++W+ Y L    ++ RTEG FV+ITY+ S +AKGAVCLDGS PAYH D+G G G+N+WL
Sbjct  8    VKQWI-YSLLTLSMIFRTEGLFVNITYLLSGMAKGAVCLDGSSPAYHHDKGFGTGVNSWL  66

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            I  EGG WCNNVTTCL+RK+TRLGSS +MVKQ+AFSG+L N P
Sbjct  67   IQMEGGGWCNNVTTCLSRKNTRLGSSKQMVKQLAFSGILSNKP  109


 Score = 99.4 bits (246),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGARVF+AV+EDLLA
Sbjct  112  NPDFYNWNRVKVRYCDGSSFTGDVQAVNPITNLHFRGARVFLAVMEDLLA  161



>gb|KDO40418.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
 gb|KDO40419.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=264

 Score =   147 bits (371),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            TTCL RK TRLGSS +MVK VAFSG+L N
Sbjct  77   TTCLERKKTRLGSSKQMVKVVAFSGMLSN  105


 Score = 98.2 bits (243),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAVNP  NLHFRGARVF AV+EDL+A
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMA  159



>ref|XP_009794297.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=402

 Score =   146 bits (368),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            V++W+ Y L    ++ R EG FV+ITY+ S VAK AVCLDGSPPAYH D+G G G+N+WL
Sbjct  6    VRQWI-YSLLTMSMIFRNEGLFVNITYLLSGVAKEAVCLDGSPPAYHHDKGFGTGVNSWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            I  EGG WCNNVTTCL+RK+TRLGSS +MVKQ+AFSG+L N P
Sbjct  65   IQMEGGGWCNNVTTCLSRKNTRLGSSKQMVKQLAFSGILSNKP  107


 Score = 99.4 bits (246),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGARVF+AV+EDLLA
Sbjct  110  NPDFYNWNRVKVRYCDGSSFTGDVQAVNPITNLHFRGARVFLAVMEDLLA  159



>ref|XP_010056129.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
 ref|XP_010056130.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
Length=445

 Score =   149 bits (375),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 3/99 (3%)
 Frame = +3

Query  18   WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  197
            WVV  +    ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHF++G G G NNWL+ F
Sbjct  17   WVVLSI---QILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQF  73

Query  198  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            EGG WCNNVTTCLAR+DTRLGSS +MVK+VAFSG+L N+
Sbjct  74   EGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNN  112


 Score = 96.3 bits (238),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAV+P T LHFRGAR FVA+IEDLL+
Sbjct  116  NPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDLLS  165



>gb|KCW72720.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=420

 Score =   149 bits (375),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 3/99 (3%)
 Frame = +3

Query  18   WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  197
            WVV  +    ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHF++G G G NNWL+ F
Sbjct  20   WVVLSI---QILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQF  76

Query  198  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            EGG WCNNVTTCLAR+DTRLGSS +MVK+VAFSG+L N+
Sbjct  77   EGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNN  115


 Score = 96.3 bits (238),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAV+P T LHFRGAR FVA+IEDLL+
Sbjct  119  NPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDLLS  168



>ref|XP_010056132.1| PREDICTED: protein notum homolog isoform X3 [Eucalyptus grandis]
 gb|KCW72716.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72717.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=439

 Score =   149 bits (375),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 3/99 (3%)
 Frame = +3

Query  18   WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  197
            WVV  +    ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHF++G G G NNWL+ F
Sbjct  11   WVVLSI---QILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQF  67

Query  198  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            EGG WCNNVTTCLAR+DTRLGSS +MVK+VAFSG+L N+
Sbjct  68   EGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNN  106


 Score = 96.3 bits (238),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAV+P T LHFRGAR FVA+IEDLL+
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDLLS  159



>ref|XP_010056131.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=448

 Score =   149 bits (375),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 3/99 (3%)
 Frame = +3

Query  18   WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  197
            WVV  +    ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHF++G G G NNWL+ F
Sbjct  20   WVVLSI---QILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQF  76

Query  198  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            EGG WCNNVTTCLAR+DTRLGSS +MVK+VAFSG+L N+
Sbjct  77   EGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNN  115


 Score = 96.3 bits (238),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAV+P T LHFRGAR FVA+IEDLL+
Sbjct  119  NPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDLLS  168



>ref|XP_006432878.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
 gb|ESR46118.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
Length=276

 Score =   147 bits (370),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            TTCL RK TRLGSS +MVK VAFSG+L N
Sbjct  77   TTCLERKKTRLGSSKQMVKVVAFSGMLSN  105


 Score = 97.8 bits (242),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAVNP  NLHFRGARVF AV+EDL+A
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMA  159



>gb|KDO40416.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
 gb|KDO40417.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=324

 Score =   146 bits (369),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            TTCL RK TRLGSS +MVK VAFSG+L N
Sbjct  77   TTCLERKKTRLGSSKQMVKVVAFSGMLSN  105


 Score = 97.4 bits (241),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAVNP  NLHFRGARVF AV+EDL+A
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMA  159



>gb|KDO40412.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=373

 Score =   146 bits (369),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            TTCL RK TRLGSS +MVK VAFSG+L N
Sbjct  77   TTCLERKKTRLGSSKQMVKVVAFSGMLSN  105


 Score = 97.8 bits (242),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAVNP  NLHFRGARVF AV+EDL+A
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMA  159



>ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis]
 gb|KDO40413.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=399

 Score =   146 bits (369),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            TTCL RK TRLGSS +MVK VAFSG+L N
Sbjct  77   TTCLERKKTRLGSSKQMVKVVAFSGMLSN  105


 Score = 97.4 bits (241),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAVNP  NLHFRGARVF AV+EDL+A
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMA  159



>gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Erythranthe guttata]
Length=390

 Score =   151 bits (382),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             +ILLRTEG +V+ITYVQ+AVAKGAVCLDGSPPAYH DRG G G+NNWL+  EGG WCNN
Sbjct  10   LVILLRTEGLYVNITYVQTAVAKGAVCLDGSPPAYHLDRGFGAGVNNWLVQIEGGGWCNN  69

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            VTTCLARK  RLGSS +M+KQ+AFS +L + P
Sbjct  70   VTTCLARKTNRLGSSKQMIKQLAFSAILSDKP  101


 Score = 92.0 bits (227),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+K+RYCDGSSFTGDVEAV+P T L++RGARVFVAV+E+LLA
Sbjct  104  NPDFYNWNRVKIRYCDGSSFTGDVEAVDPVTKLYYRGARVFVAVMEELLA  153



>ref|XP_004509524.1| PREDICTED: uncharacterized protein LOC101493258 isoform X3 [Cicer 
arietinum]
Length=303

 Score =   142 bits (358),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V ITYVQSAVAKGAVCLDGSPPAYHFD+G G GI+NW++HFEGG WCNNV+TCL
Sbjct  22   KAEGVAVPITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDNWIVHFEGGGWCNNVSTCL  81

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
             R+DTRLGSS KM KQ++FSG   N
Sbjct  82   DRRDTRLGSSKKMDKQLSFSGFFSN  106


 Score =   101 bits (251),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAV+P TNLHFRGAR+FVAVIEDLLA
Sbjct  111  NPDFYDWNRIKVRYCDGASFTGDVEAVDPATNLHFRGARIFVAVIEDLLA  160



>gb|KDO40410.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=437

 Score =   146 bits (368),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  55   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  114

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            TTCL RK TRLGSS +MVK VAFSG+L N
Sbjct  115  TTCLERKKTRLGSSKQMVKVVAFSGMLSN  143


 Score = 97.1 bits (240),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAVNP  NLHFRGARVF AV+EDL+A
Sbjct  148  NPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMA  197



>ref|XP_006363875.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=402

 Score =   147 bits (370),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            VQ+W+ Y      I+ RTEG FV+ITYV S VAKGAVCLDGSPPAYH D+G G G+N+WL
Sbjct  6    VQQWI-YSFVTLSIVFRTEGLFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            I  EGG WCNN++TCL+RK+TRLGSS +MV+ +AFSG+L N P
Sbjct  65   IQMEGGGWCNNISTCLSRKNTRLGSSKQMVENLAFSGILSNLP  107


 Score = 96.3 bits (238),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KV YCDGSSFTGDV+AVNP TNLHFRGARVF+AV+EDLLA
Sbjct  110  NPDFYNWNRVKVGYCDGSSFTGDVQAVNPITNLHFRGARVFLAVMEDLLA  159



>ref|XP_004509522.1| PREDICTED: uncharacterized protein LOC101493258 isoform X1 [Cicer 
arietinum]
 ref|XP_004509523.1| PREDICTED: uncharacterized protein LOC101493258 isoform X2 [Cicer 
arietinum]
Length=400

 Score =   141 bits (356),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V ITYVQSAVAKGAVCLDGSPPAYHFD+G G GI+NW++HFEGG WCNNV+TCL
Sbjct  22   KAEGVAVPITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDNWIVHFEGGGWCNNVSTCL  81

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
             R+DTRLGSS KM KQ++FSG   N
Sbjct  82   DRRDTRLGSSKKMDKQLSFSGFFSN  106


 Score =   100 bits (250),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAV+P TNLHFRGAR+FVAVIEDLLA
Sbjct  111  NPDFYDWNRIKVRYCDGASFTGDVEAVDPATNLHFRGARIFVAVIEDLLA  160



>gb|AFK37998.1| unknown [Lotus japonicus]
Length=269

 Score =   139 bits (351),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V IT+VQSAVAKGAVCLDGSPPAYHF +G G GINNW++HFEGGAWCNNVTTCL
Sbjct  21   KAEGVAVPITFVQSAVAKGAVCLDGSPPAYHFHKGFGAGINNWIVHFEGGAWCNNVTTCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            AR+DTRLGSS KM + ++FSG   N
Sbjct  81   ARRDTRLGSSKKMSQTLSFSGFFSN  105


 Score =   102 bits (254),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+PKTNLHFRG R+FVAV+EDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNLHFRGGRIFVAVVEDLLA  159



>ref|XP_010056135.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
Length=392

 Score =   144 bits (363),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            ++ W+   L+   ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G NNWL
Sbjct  6    LRTWLCVILSI-QILLKSEAINVSITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            I  EGG WCNNVTTCLAR+DTR+GSS +MVK+++FSG+L N
Sbjct  65   IFVEGGGWCNNVTTCLARRDTRVGSSKQMVKELSFSGILSN  105


 Score = 98.2 bits (243),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN+IKVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA++EDL++
Sbjct  110  NPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMS  159



>ref|XP_010529277.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=401

 Score =   147 bits (370),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++LLRTEG FV+ITYV++A+AKGAVCLDGSPPAYH D+GSG GINNWLI  EGG WCNNV
Sbjct  17   VVLLRTEGLFVNITYVKTAMAKGAVCLDGSPPAYHLDKGSGTGINNWLIQLEGGGWCNNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            T C+AR  TRLGSS +M KQ+AFS +L N 
Sbjct  77   TNCIARMHTRLGSSKQMAKQIAFSAILSNR  106


 Score = 94.7 bits (234),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+K+RYCDGSSFTGDV+ V+P TNLHFRGARV++AV+EDLLA
Sbjct  110  NPDFYNWNRVKIRYCDGSSFTGDVQTVDPATNLHFRGARVWLAVMEDLLA  159



>gb|KDP28068.1| hypothetical protein JCGZ_19476 [Jatropha curcas]
Length=400

 Score =   145 bits (366),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            + KW+       + + + EG +V ITYV++AVAKGAVCLDGSPPAYH D+G G GINNWL
Sbjct  6    LSKWLNLLACLLLFVSKIEGLYVGITYVRNAVAKGAVCLDGSPPAYHLDKGFGTGINNWL  65

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            +HFEGG WCNNVTTCL+RK+TRLGSS +M  Q+AFSG+L N 
Sbjct  66   VHFEGGGWCNNVTTCLSRKNTRLGSSKQMATQIAFSGILNNR  107


 Score = 96.3 bits (238),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+K+RYCDGSSFTGDV+ VNP TNLHFRGAR+++AV+EDLLA
Sbjct  111  NPDFYNWNRVKIRYCDGSSFTGDVQKVNPATNLHFRGARIWLAVVEDLLA  160



>ref|XP_007158098.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
 gb|ESW30092.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
Length=400

 Score =   143 bits (360),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            +++W+   L   ++ L  E  +V ITY+Q+AVAKGAVCLDGSPP YHFDRGSG GINNWL
Sbjct  6    IRQWLNL-LVCALLSLMAEASYVPITYLQNAVAKGAVCLDGSPPGYHFDRGSGTGINNWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            + FEGG WCNNVTTCL+RK   LGSS +M KQ+AFSG++ N P+
Sbjct  65   VAFEGGGWCNNVTTCLSRKTNHLGSSKQMAKQIAFSGIMSNRPM  108


 Score = 98.2 bits (243),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP T LHFRGAR+F AV+EDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRGARIFAAVMEDLLA  159



>ref|XP_011028479.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028480.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028481.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
Length=509

 Score =   139 bits (351),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+GSG GIN+WLIHFEGG WCNNVT+CL
Sbjct  103  KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCL  162

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +RK T LGSS  M +Q+AFSG++ N
Sbjct  163  SRKKTHLGSSKLMGQQIAFSGIMNN  187


 Score =   101 bits (251),  Expect(2) = 6e-55, Method: Composition-based stats.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDGSSFTGDV+AVNP TNLHFRGAR+++AVIEDLL
Sbjct  192  NPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEDLL  240



>ref|XP_011028482.1| PREDICTED: uncharacterized protein LOC105128479 isoform X2 [Populus 
euphratica]
Length=481

 Score =   139 bits (350),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+GSG GIN+WLIHFEGG WCNNVT+CL
Sbjct  103  KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCL  162

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +RK T LGSS  M +Q+AFSG++ N
Sbjct  163  SRKKTHLGSSKLMGQQIAFSGIMNN  187


 Score =   100 bits (250),  Expect(2) = 9e-55, Method: Composition-based stats.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDGSSFTGDV+AVNP TNLHFRGAR+++AVIEDLL
Sbjct  192  NPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEDLL  240



>gb|AFK45147.1| unknown [Lotus japonicus]
Length=394

 Score =   138 bits (347),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V  T+VQSAVAKGAVCLDGSPPAYHF +G G GINNW++HFEGGAWCNNVTTCL
Sbjct  21   KAEGVAVPTTFVQSAVAKGAVCLDGSPPAYHFHKGFGAGINNWIVHFEGGAWCNNVTTCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            AR+DTRLGSS KM + ++FSG   N
Sbjct  81   ARRDTRLGSSKKMSQTLSFSGFFSN  105


 Score =   102 bits (254),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+PKTNLHFRG R+FVAV+EDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNLHFRGGRIFVAVVEDLLA  159



>ref|XP_010434420.1| PREDICTED: protein notum homolog [Camelina sativa]
 ref|XP_010434421.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   144 bits (364),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  12   QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            ++W+V  L   +++++TEG FV+ITYV++AVAKGAVCLDGSPPAYH DRGSG GIN+WLI
Sbjct  5    KQWLVL-LVCSLVMMKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLI  63

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N
Sbjct  64   QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSN  103


 Score = 95.5 bits (236),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGAR+++AV+++LLA
Sbjct  108  NPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLA  157



>ref|XP_010439718.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   144 bits (362),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  12   QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            ++W+V  L   +++++TEG FV+ITYV++AVAKGAVCLDGSPPAYH DRGSG G+N+WLI
Sbjct  5    KQWLVL-LVCSLVIMKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGVNSWLI  63

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N
Sbjct  64   QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSN  103


 Score = 95.9 bits (237),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGAR+++AV+++LLA
Sbjct  108  NPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLA  157



>ref|NP_193677.2| putative pectinacetylesterase [Arabidopsis thaliana]
 sp|Q6DBP4.1|PAE8_ARATH RecName: Full=Pectin acetylesterase 8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAT70429.1| At4g19420 [Arabidopsis thaliana]
 gb|AAU45212.1| At4g19420 [Arabidopsis thaliana]
 gb|AEE84180.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=397

 Score =   143 bits (361),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            +++W++Y L   ++++ TEG FV+IT+V++AVAKGAVCLDGSPPAYH DRGSG GIN+WL
Sbjct  4    LKQWLIY-LVCSLVIMNTEGLFVNITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWL  62

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            I  EGG WCNNVT C++R  TRLGSS KMV+ +AFS +L N
Sbjct  63   IQLEGGGWCNNVTNCVSRMHTRLGSSKKMVENLAFSAILSN  103


 Score = 95.9 bits (237),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDVEAVNP TNLHFRGARV++AV+++LLA
Sbjct  108  NPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARVWLAVMQELLA  157



>ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis]
Length=399

 Score =   142 bits (358),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            TEG FV+ITYV++AVAKGAVCLDGSPPAYH D+G G GIN+WL+HFEGG WCNN+TTCL+
Sbjct  22   TEGLFVEITYVKNAVAKGAVCLDGSPPAYHLDKGFGTGINSWLVHFEGGGWCNNITTCLS  81

Query  240  RKDTRLGSSTKMVKQVAFSGLLGNH  314
            RK+TRLGSS +M  Q+AFSG++ N 
Sbjct  82   RKNTRLGSSKQMGPQIAFSGIMSNR  106


 Score = 97.1 bits (240),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+K+RYCDGSSFTGDV+AVNP TNLHFRGAR+++AVIE+LLA
Sbjct  110  NPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEELLA  159



>ref|XP_010325633.1| PREDICTED: uncharacterized protein LOC101257588 isoform X2 [Solanum 
lycopersicum]
Length=397

 Score =   148 bits (374),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            VQ+W+ Y L  F I+  TE  FV+ITYV S VAKGAVCLDGSPPAYH D+G G G+N+WL
Sbjct  6    VQQWI-YSLVTFSIIFGTEALFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            I  EGG WCNNVTTCL+RK+TRLGSS +MV+ +AFSG+L N P
Sbjct  65   IQMEGGGWCNNVTTCLSRKNTRLGSSKQMVENLAFSGILSNKP  107


 Score = 90.9 bits (224),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KV YCDGSSFTGDV+ VNP T LHFRGARVF+AV+E+LLA
Sbjct  110  NPDFYNWNRVKVGYCDGSSFTGDVQEVNPITKLHFRGARVFLAVMEELLA  159



>ref|XP_010325632.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=402

 Score =   148 bits (374),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            VQ+W+ Y L  F I+  TE  FV+ITYV S VAKGAVCLDGSPPAYH D+G G G+N+WL
Sbjct  6    VQQWI-YSLVTFSIIFGTEALFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWL  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            I  EGG WCNNVTTCL+RK+TRLGSS +MV+ +AFSG+L N P
Sbjct  65   IQMEGGGWCNNVTTCLSRKNTRLGSSKQMVENLAFSGILSNKP  107


 Score = 90.9 bits (224),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KV YCDGSSFTGDV+ VNP T LHFRGARVF+AV+E+LLA
Sbjct  110  NPDFYNWNRVKVGYCDGSSFTGDVQEVNPITKLHFRGARVFLAVMEELLA  159



>ref|XP_010244169.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=401

 Score =   138 bits (348),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            +Y L + ++ L   GF V ITY+QSAVAKGAVCLDGSPPAYH   G G G+NNWL+ FEG
Sbjct  13   LYFLIWTLVTLGANGFNVGITYLQSAVAKGAVCLDGSPPAYHMSPGFGAGVNNWLVFFEG  72

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            G+WCNNVT+CLARK+TRLGSS +M K+V+FSG+L N
Sbjct  73   GSWCNNVTSCLARKNTRLGSSKQMTKEVSFSGILSN  108


 Score =   100 bits (248),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN+IKVRYCDGSSFTGDVEAVNP TNLHFRG R+F+AVIEDLLA
Sbjct  113  NPDFYNWNKIKVRYCDGSSFTGDVEAVNPATNLHFRGQRIFLAVIEDLLA  162



>emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata]
Length=399

 Score =   140 bits (354),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++LL+ EG  V IT+V++AVAKGAVCLDGSPPAYHF +GSG GINNW++HFEGG WCNNV
Sbjct  17   VLLLKAEGVPVGITFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            T+CL+R+DTRLGSS KM  Q++FSG   N
Sbjct  77   TSCLSRRDTRLGSSKKMDTQLSFSGFFSN  105


 Score = 97.1 bits (240),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+P TNLHFRG+RVF AV++DLLA
Sbjct  110  NPDFYDWNRIKVRYCDGSSFTGDVEAVDPATNLHFRGSRVFAAVVDDLLA  159



>ref|XP_011028483.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
 ref|XP_011028484.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
Length=427

 Score =   139 bits (351),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+GSG GIN+WLIHFEGG WCNNVT+CL
Sbjct  21   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +RK T LGSS  M +Q+AFSG++ N
Sbjct  81   SRKKTHLGSSKLMGQQIAFSGIMNN  105


 Score = 97.4 bits (241),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDGSSFTGDV+AVNP TNLHFRGAR+++AVIEDLL
Sbjct  110  NPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEDLL  158



>gb|KHN41567.1| Protein notum like [Glycine soja]
Length=399

 Score =   137 bits (345),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +TEG  V IT+V++AVAKGAVCLDGSPPAYHF++GSG GINNW++HFEGG WCNNVTTCL
Sbjct  21   QTEGVPVGITFVENAVAKGAVCLDGSPPAYHFNKGSGAGINNWIVHFEGGGWCNNVTTCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +R+DTRLGSS KM   ++FSG   N
Sbjct  81   SRRDTRLGSSKKMDTSLSFSGFFSN  105


 Score = 99.8 bits (247),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+PKTNLHFRGARVF  V+EDLLA
Sbjct  110  NPDFYDWNRIKVRYCDGSSFTGDVEAVDPKTNLHFRGARVFAVVVEDLLA  159



>ref|XP_010449357.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   140 bits (354),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +3

Query  12   QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            ++W+V  L   +++++TEG FV+ITYV++AVAKGAVCLDGSPPAYH  RGSG G+N+WLI
Sbjct  5    KQWLVL-LVCSLVIMKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLHRGSGTGVNSWLI  63

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N
Sbjct  64   QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSN  103


 Score = 95.5 bits (236),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGAR+++AV+++LLA
Sbjct  108  NPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLA  157



>ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=401

 Score =   140 bits (352),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  54   LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTC  233
             +T+G +V ITYVQSAVAKGAVCLDGSPPAYH+DRG G GIN+WLI  EGG WCNNVT+C
Sbjct  20   FKTQGVYVPITYVQSAVAKGAVCLDGSPPAYHWDRGYGTGINSWLIQLEGGGWCNNVTSC  79

Query  234  LARKDTRLGSSTKMVKQVAFSGLLGN  311
            L RK+T LGSS +MVKQ+ FSG+L N
Sbjct  80   LVRKNTHLGSSKRMVKQIPFSGILNN  105


 Score = 96.3 bits (238),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV AVNP TNLHFRGARV++AV+EDLLA
Sbjct  110  NPDFYNWNRVKVRYCDGSSFTGDVAAVNPVTNLHFRGARVWLAVMEDLLA  159



>ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine 
max]
 ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine 
max]
 ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine 
max]
Length=399

 Score =   136 bits (343),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +TEG  V IT+V++AVAKGAVCLDGSPPAYHF +GSG GINNW++HFEGG WCNNVTTCL
Sbjct  21   QTEGVPVGITFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNNVTTCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +R+DTRLGSS KM   ++FSG   N
Sbjct  81   SRRDTRLGSSKKMDTSLSFSGFFSN  105


 Score = 99.8 bits (247),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+PKTNLHFRGARVF  V+EDLLA
Sbjct  110  NPDFYDWNRIKVRYCDGSSFTGDVEAVDPKTNLHFRGARVFAVVVEDLLA  159



>ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus]
Length=539

 Score =   139 bits (349),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = +3

Query  27   YGLAFFMI-----LLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            +GL  F +      L+ +   V ITYVQ AV KGAVCLDGSPPAYHF  G G GINNWLI
Sbjct  6    FGLWLFFVASVQFFLKAQCINVGITYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLI  65

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
              EGG WCNNVTTCL R+DTRLGSS KMV Q+AFSG+L N P
Sbjct  66   QLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKP  107


 Score = 97.1 bits (240),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+  TNLHFRGARVF A+I++LLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVDSATNLHFRGARVFRAIIDNLLA  159



>gb|KHN41756.1| Protein notum like [Glycine soja]
Length=449

 Score =   138 bits (348),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            +E  +V IT VQ+AVAKGAVCLDGSPPAYHFD+G G GINNWL+ FEGG WCNNVTTCLA
Sbjct  22   SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  240  RKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            RK  RLGSS +M KQ+AFSG+L N  +
Sbjct  82   RKTNRLGSSKQMAKQIAFSGILNNRAM  108


 Score = 97.1 bits (240),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP T LHFRGAR+F AV+EDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRGARIFNAVMEDLLA  159



>ref|XP_006573491.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=447

 Score =   138 bits (348),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            +E  +V IT VQ+AVAKGAVCLDGSPPAYHFD+G G GINNWL+ FEGG WCNNVTTCLA
Sbjct  22   SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  240  RKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            RK  RLGSS +M KQ+AFSG+L N  +
Sbjct  82   RKTNRLGSSKQMAKQIAFSGILNNRAM  108


 Score = 97.1 bits (240),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP T LHFRGAR+F AV+EDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRGARIFNAVMEDLLA  159



>ref|XP_006573492.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=400

 Score =   138 bits (348),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            +E  +V IT VQ+AVAKGAVCLDGSPPAYHFD+G G GINNWL+ FEGG WCNNVTTCLA
Sbjct  22   SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  240  RKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            RK  RLGSS +M KQ+AFSG+L N  +
Sbjct  82   RKTNRLGSSKQMAKQIAFSGILNNRAM  108


 Score = 97.1 bits (240),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP T LHFRGAR+F AV+EDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRGARIFNAVMEDLLA  159



>ref|XP_010054028.1| PREDICTED: uncharacterized protein LOC104442333 isoform X2 [Eucalyptus 
grandis]
 gb|KCW78411.1| hypothetical protein EUGRSUZ_D02577 [Eucalyptus grandis]
Length=400

 Score =   139 bits (350),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQ-SAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGA  209
            L F + LL+  G  V ITYV+ SAVA+GAVCLDGSPPAYH DRG G GINNWL+H EGG 
Sbjct  13   LLFLVALLQARGVPVRITYVRNSAVARGAVCLDGSPPAYHLDRGFGTGINNWLVHIEGGG  72

Query  210  WCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            WCNNVTTCLARK+TRLGSS +M K++ FSG+L N
Sbjct  73   WCNNVTTCLARKNTRLGSSKQMAKEIPFSGILSN  106


 Score = 95.9 bits (237),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGD+EAVNP TNLHFRGARV+ AV+EDLL+
Sbjct  111  NPDFYNWNRIKVRYCDGASFTGDIEAVNPATNLHFRGARVWQAVMEDLLS  160



>ref|XP_010244170.1| PREDICTED: uncharacterized protein LOC104588061 [Nelumbo nucifera]
Length=399

 Score =   140 bits (352),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++ L+  G  V ITYV++AVAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WCNNV
Sbjct  17   LVALKVNGVNVGITYVETAVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCNNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            TTCLARK+TRLGSS +M+ ++AFSG+L N
Sbjct  77   TTCLARKNTRLGSSKQMLTEIAFSGILSN  105


 Score = 95.1 bits (235),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+KVRYCDG+SFTGDVEAV+P TNLH+RGARV++AVIEDLL
Sbjct  110  NPDFYNWNRVKVRYCDGASFTGDVEAVDPTTNLHYRGARVWLAVIEDLL  158



>ref|XP_008238012.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=400

 Score =   141 bits (356),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            ++ LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G GINNWL+H EG
Sbjct  10   LFLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            G WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N  +
Sbjct  70   GGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKM  108


 Score = 93.2 bits (230),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDV AVNP T L+FRGAR+F AVIEDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVAAVNPATGLYFRGARIFRAVIEDLLA  159



>ref|XP_002867938.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44197.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   139 bits (349),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  54   LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTC  233
            ++TEG FV+ITYV++AVAKGAVCLDGSPPAYH DRGSG GIN+WLI  EGG WCNNVT C
Sbjct  1    MKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNC  60

Query  234  LARKDTRLGSSTKMVKQVAFSGLLGN  311
            ++R  TRLGSS KMV+ +AFS +L N
Sbjct  61   VSRMHTRLGSSKKMVENLAFSAILSN  86


 Score = 95.9 bits (237),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGARV++AV+++LLA
Sbjct  91   NPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLA  140



>ref|XP_007156330.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28324.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=397

 Score =   137 bits (345),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++LL+ EG  V IT+V++AVAKGAVCLDGS PAYHF +GSG GINNW++HFEGG WCNNV
Sbjct  15   VLLLKAEGVPVGITFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNNV  74

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            T+CL+R+DTRLGSS KM  Q++FSG   N
Sbjct  75   TSCLSRRDTRLGSSKKMDTQLSFSGFFSN  103


 Score = 97.4 bits (241),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            N DFY WNRIKVRYCDGSSFTGDVEAV+P+TNLHFRGARVF AV+EDLLA
Sbjct  108  NQDFYDWNRIKVRYCDGSSFTGDVEAVDPRTNLHFRGARVFAAVVEDLLA  157



>ref|XP_006385136.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62933.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=391

 Score =   137 bits (344),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  24   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +RK T LGSS  M +Q+AFSG++ N
Sbjct  84   SRKKTHLGSSKLMGQQIAFSGIMNN  108


 Score = 97.4 bits (241),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDGSSFTGDV+AVNP TNLHFRGAR+++AVIEDLL
Sbjct  113  NPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEDLL  161



>ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=417

 Score =   137 bits (344),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++LL+ EG  V IT+V++AVAKGAVCLDGS PAYHF +GSG GINNW++HFEGG WCNNV
Sbjct  35   VLLLKAEGVPVGITFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNNV  94

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            T+CL+R+DTRLGSS KM  Q++FSG   N
Sbjct  95   TSCLSRRDTRLGSSKKMDTQLSFSGFFSN  123


 Score = 97.4 bits (241),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            N DFY WNRIKVRYCDGSSFTGDVEAV+P+TNLHFRGARVF AV+EDLLA
Sbjct  128  NQDFYDWNRIKVRYCDGSSFTGDVEAVDPRTNLHFRGARVFAAVVEDLLA  177



>ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=430

 Score =   137 bits (344),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  24   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +RK T LGSS  M +Q+AFSG++ N
Sbjct  84   SRKKTHLGSSKLMGQQIAFSGIMNN  108


 Score = 97.4 bits (241),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDGSSFTGDV+AVNP TNLHFRGAR+++AVIEDLL
Sbjct  113  NPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEDLL  161



>ref|XP_006385140.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62937.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=325

 Score =   137 bits (344),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  24   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +RK T LGSS  M +Q+AFSG++ N
Sbjct  84   SRKKTHLGSSKLMGQQIAFSGIMNN  108


 Score = 97.4 bits (241),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDGSSFTGDV+AVNP TNLHFRGAR+++AVIEDLL
Sbjct  113  NPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEDLL  161



>ref|XP_003628995.1| Notum-like protein [Medicago truncatula]
Length=396

 Score =   132 bits (331),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             ++L   EG  V IT+VQSAVAKGAVCLDGSPPAYHFD+G   GI+NW++HFEGG WCNN
Sbjct  20   LLLLKAAEGVTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNN  79

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             TTCL R DTRLGSS KM K ++FSG   +
Sbjct  80   ATTCLDRIDTRLGSSKKMDKTLSFSGFFSS  109


 Score =   102 bits (253),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+PKTNLH+RG R+FVAVIEDLLA
Sbjct  114  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNLHYRGGRIFVAVIEDLLA  163



>ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=399

 Score =   136 bits (343),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  21   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +RK T LGSS  M +Q+AFSG++ N
Sbjct  81   SRKKTHLGSSKLMGQQIAFSGIMNN  105


 Score = 97.1 bits (240),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDGSSFTGDV+AVNP TNLHFRGAR+++AVIEDLL
Sbjct  110  NPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEDLL  158



>gb|AET03471.2| pectinacetylesterase family protein [Medicago truncatula]
Length=424

 Score =   131 bits (330),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             ++L   EG  V IT+VQSAVAKGAVCLDGSPPAYHFD+G   GI+NW++HFEGG WCNN
Sbjct  48   LLLLKAAEGVTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNN  107

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             TTCL R DTRLGSS KM K ++FSG   +
Sbjct  108  ATTCLDRIDTRLGSSKKMDKTLSFSGFFSS  137


 Score =   102 bits (253),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+PKTNLH+RG R+FVAVIEDLLA
Sbjct  142  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNLHYRGGRIFVAVIEDLLA  191



>ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=402

 Score =   136 bits (343),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  24   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            +RK T LGSS  M +Q+AFSG++ N
Sbjct  84   SRKKTHLGSSKLMGQQIAFSGIMNN  108


 Score = 97.1 bits (240),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDGSSFTGDV+AVNP TNLHFRGAR+++AVIEDLL
Sbjct  113  NPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEDLL  161



>gb|KEH20327.1| pectinacetylesterase family protein [Medicago truncatula]
Length=393

 Score =   131 bits (330),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             ++L   EG  V IT+VQSAVAKGAVCLDGSPPAYHFD+G   GI+NW++HFEGG WCNN
Sbjct  17   LLLLKAAEGVTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNN  76

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             TTCL R DTRLGSS KM K ++FSG   +
Sbjct  77   ATTCLDRIDTRLGSSKKMDKTLSFSGFFSS  106


 Score =   102 bits (253),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+PKTNLH+RG R+FVAVIEDLLA
Sbjct  111  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNLHYRGGRIFVAVIEDLLA  160



>ref|XP_007209211.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 ref|XP_007209212.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10410.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10411.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
Length=400

 Score =   140 bits (352),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            ++ LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G GINNWL+H EG
Sbjct  10   LFLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            G WCNNVT CL RK+TRLGSS +M+K +AFSG+L N  +
Sbjct  70   GGWCNNVTNCLGRKNTRLGSSKQMLKAIAFSGILSNRKM  108


 Score = 93.2 bits (230),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDV AVNP T L+FRGAR+F AVIEDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVAAVNPATGLYFRGARIFRAVIEDLLA  159



>gb|ACJ85294.1| unknown [Medicago truncatula]
 gb|AFK37076.1| unknown [Medicago truncatula]
Length=393

 Score =   131 bits (330),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             ++L  TEG  V IT+VQSAVAKGAVCLDGSPPAYHFD+G   GI+NW++HFEGG WCNN
Sbjct  17   LLLLKATEGVTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNN  76

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             TTCL R DTRLG S KM K ++FSG   +
Sbjct  77   ATTCLDRIDTRLGPSKKMDKTLSFSGFFSS  106


 Score =   101 bits (252),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+PKTNLH+RG R+FVAVIEDLLA
Sbjct  111  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNLHYRGGRIFVAVIEDLLA  160



>emb|CDX99377.1| BnaC01g11750D [Brassica napus]
Length=452

 Score =   136 bits (343),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +3

Query  12   QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            ++WV+  +    IL + EG FV+IT+V++AVA+GAVCLDGSPPAYH  RGSG GIN+WLI
Sbjct  60   KQWVILVVCSLAIL-KAEGLFVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLI  118

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N
Sbjct  119  QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSN  158


 Score = 96.3 bits (238),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGARV++AV+++LLA
Sbjct  163  NPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLA  212



>gb|EEC73846.1| hypothetical protein OsI_08601 [Oryza sativa Indica Group]
Length=291

 Score =   144 bits (362),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  30   GLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGA  209
             L   ++ L  +G FVDITYV SAVAKGAVCLDGSPPAYH  RG G G+N+WL+HFEGG 
Sbjct  12   ALVCALVFLTVDGDFVDITYVASAVAKGAVCLDGSPPAYHLARGFGSGVNSWLVHFEGGG  71

Query  210  WCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            WC+NVTTCL RK TRLGSS +M KQ+AFSG+L N P
Sbjct  72   WCSNVTTCLQRKRTRLGSSKQMAKQIAFSGILSNTP  107


 Score = 88.6 bits (218),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE V+P T LH+RGARV+ AV++DLLA
Sbjct  110  NPDFYNWNKVKVRYCDGSSFTGDVEKVDPATKLHYRGARVWQAVMDDLLA  159



>emb|CDX78933.1| BnaA01g10000D [Brassica napus]
Length=452

 Score =   136 bits (342),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +3

Query  12   QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            ++W+V  +    IL + EG FV+IT+V++AVA+GAVCLDGSPPAYH  RGSG GIN+WLI
Sbjct  60   KQWLVLVVCSLAIL-KAEGLFVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLI  118

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N
Sbjct  119  QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSN  158


 Score = 96.3 bits (238),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGARV++AV+++LLA
Sbjct  163  NPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLA  212



>ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group]
Length=397

 Score =   144 bits (362),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++ L  +G FVDITYV SAVAKGAVCLDGSPPAYH  RG G G+N+WL+HFEGG WC+NV
Sbjct  17   LVFLTVDGDFVDITYVASAVAKGAVCLDGSPPAYHLARGFGSGVNSWLVHFEGGGWCSNV  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            TTCL RK TRLGSS +M KQ+AFSG+L N P
Sbjct  77   TTCLQRKRTRLGSSKQMAKQIAFSGILSNTP  107


 Score = 88.6 bits (218),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE V+P T LH+RGARV+ AV++DLLA
Sbjct  110  NPDFYNWNKVKVRYCDGSSFTGDVEKVDPATKLHYRGARVWQAVMDDLLA  159



>ref|XP_006587655.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=453

 Score =   136 bits (343),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            +E  +V IT VQ+AVAKGAVCLDGSPPAYHFDRG G GINNWL+ FEGG WCNNVTTCLA
Sbjct  22   SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  240  RKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            RK  RLGSS +M K +AFSG+L N  +
Sbjct  82   RKTNRLGSSKQMAKLIAFSGILNNREM  108


 Score = 95.5 bits (236),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP T LHFRG R+F AV+EDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRGGRIFNAVMEDLLA  159



>ref|XP_006587656.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=450

 Score =   136 bits (343),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            +E  +V IT VQ+AVAKGAVCLDGSPPAYHFDRG G GINNWL+ FEGG WCNNVTTCLA
Sbjct  22   SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  240  RKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            RK  RLGSS +M K +AFSG+L N  +
Sbjct  82   RKTNRLGSSKQMAKLIAFSGILNNREM  108


 Score = 95.5 bits (236),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP T LHFRG R+F AV+EDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRGGRIFNAVMEDLLA  159



>ref|XP_008238015.1| PREDICTED: protein notum homolog isoform X5 [Prunus mume]
Length=311

 Score =   142 bits (358),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            ++ LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G GINNWL+H EG
Sbjct  10   LFLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            G WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N  +
Sbjct  70   GGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKM  108


 Score = 89.7 bits (221),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPK-TNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDV AVNP+ T L+FRGAR+F AVIEDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVAAVNPQATGLYFRGARIFRAVIEDLLA  160



>ref|XP_008451860.1| PREDICTED: protein notum homolog isoform X1 [Cucumis melo]
Length=401

 Score =   135 bits (341),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = +3

Query  3    LGVQK---WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  173
            +G +K   W+ + +A     L+ +   V ITYVQ A  KGAVCLDGSPPAYHF  G G G
Sbjct  4    MGCEKFGLWLFF-VASVQFFLKAQCINVGITYVQDAGIKGAVCLDGSPPAYHFSDGFGSG  62

Query  174  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            INNWLI  EGG WCNNVTTCL R+DTRLGSS KMV Q+AFSG+L N P
Sbjct  63   INNWLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKP  110


 Score = 96.3 bits (238),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+P TNLHFRGARVF A+I++LLA
Sbjct  113  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDNLLA  162



>ref|XP_010266386.1| PREDICTED: uncharacterized protein LOC104603916 isoform X3 [Nelumbo 
nucifera]
Length=361

 Score =   139 bits (351),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +I L+  G +V ITY++S+VAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WC NV
Sbjct  58   LITLKVNGLYVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTNV  117

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            TTCL RK+T LGSS KMV ++AFSG+L N+
Sbjct  118  TTCLFRKNTHLGSSKKMVTEIAFSGILSNN  147


 Score = 92.0 bits (227),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNRIKVRYCDG+SFTGD+E V+P TNLH+RGAR+++AVIEDLL
Sbjct  151  NPDFYNWNRIKVRYCDGASFTGDLEKVDPVTNLHYRGARIWLAVIEDLL  199



>ref|XP_008238014.1| PREDICTED: protein notum homolog isoform X4 [Prunus mume]
Length=315

 Score =   142 bits (357),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            ++ LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G GINNWL+H EG
Sbjct  10   LFLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            G WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N  +
Sbjct  70   GGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKM  108


 Score = 89.7 bits (221),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPK-TNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDV AVNP+ T L+FRGAR+F AVIEDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVAAVNPQATGLYFRGARIFRAVIEDLLA  160



>ref|XP_008451861.1| PREDICTED: protein notum homolog isoform X2 [Cucumis melo]
Length=398

 Score =   135 bits (341),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = +3

Query  3    LGVQK---WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  173
            +G +K   W+ + +A     L+ +   V ITYVQ A  KGAVCLDGSPPAYHF  G G G
Sbjct  1    MGCEKFGLWLFF-VASVQFFLKAQCINVGITYVQDAGIKGAVCLDGSPPAYHFSDGFGSG  59

Query  174  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            INNWLI  EGG WCNNVTTCL R+DTRLGSS KMV Q+AFSG+L N P
Sbjct  60   INNWLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKP  107


 Score = 96.3 bits (238),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+P TNLHFRGARVF A+I++LLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDNLLA  159



>ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
 gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
Length=397

 Score =   135 bits (341),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  15   KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            KWV + L   +++L TE  +V+IT+V++AVAKGAVCLDGSPPAYH DRG G GIN+WLI 
Sbjct  6    KWV-FLLVCSLVILETEALYVNITFVRNAVAKGAVCLDGSPPAYHLDRGFGTGINSWLIQ  64

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             EGG WCNNVT C++R  TRLGSS +MV+++AFS +L N
Sbjct  65   LEGGGWCNNVTNCVSRMHTRLGSSKRMVEKLAFSAILSN  103


 Score = 95.9 bits (237),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGARV++AV+++LLA
Sbjct  108  NPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLA  157



>ref|XP_006587657.1| PREDICTED: protein notum homolog isoform X3 [Glycine max]
 gb|KHN11801.1| Protein notum like [Glycine soja]
Length=400

 Score =   136 bits (342),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            +E  +V IT VQ+AVAKGAVCLDGSPPAYHFDRG G GINNWL+ FEGG WCNNVTTCLA
Sbjct  22   SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  240  RKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            RK  RLGSS +M K +AFSG+L N  +
Sbjct  82   RKTNRLGSSKQMAKLIAFSGILNNREM  108


 Score = 95.5 bits (236),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP T LHFRG R+F AV+EDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRGGRIFNAVMEDLLA  159



>ref|XP_010536220.1| PREDICTED: protein notum homolog isoform X1 [Tarenaya hassleriana]
Length=399

 Score =   138 bits (348),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            E  FVDITYVQ AVAKGAVCLDGSPPAYH DRGSG GINNWLI  EGG WCNNVT C+AR
Sbjct  23   EALFVDITYVQKAVAKGAVCLDGSPPAYHLDRGSGTGINNWLIQLEGGGWCNNVTNCVAR  82

Query  243  KDTRLGSSTKMVKQVAFSGLLGNH  314
              T LGSS +M KQ+AFS +L N 
Sbjct  83   MRTHLGSSKQMAKQIAFSAILSNR  106


 Score = 93.2 bits (230),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+K+RYCDGSSFTGDV+ V+P TNLHFRG RV++AV+EDLLA
Sbjct  110  NPDFYNWNRVKIRYCDGSSFTGDVQTVDPDTNLHFRGGRVWLAVMEDLLA  159



>ref|XP_009398466.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398467.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398468.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398469.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=395

 Score =   139 bits (351),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + E  FVDITYV+SA+ KGAVCLDGSPPAYH   G G G+NNWL+H EGG WCNN+TTCL
Sbjct  20   KAEANFVDITYVESAIPKGAVCLDGSPPAYHLSPGFGSGVNNWLVHLEGGGWCNNITTCL  79

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
            ARK+TRLGSS +M KQ+AFSG+L N
Sbjct  80   ARKNTRLGSSGQMAKQLAFSGILSN  104


 Score = 92.0 bits (227),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE V+P TNLH+RGARV++AV+E+LLA
Sbjct  109  NPDFYNWNKVKVRYCDGSSFTGDVERVDPATNLHYRGARVWLAVMEELLA  158



>ref|XP_008238013.1| PREDICTED: protein notum homolog isoform X3 [Prunus mume]
Length=316

 Score =   142 bits (357),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            ++ LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G GINNWL+H EG
Sbjct  10   LFLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            G WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N  +
Sbjct  70   GGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKM  108


 Score = 89.7 bits (221),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPK-TNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDV AVNP+ T L+FRGAR+F AVIEDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVAAVNPQATGLYFRGARIFRAVIEDLLA  160



>ref|XP_009132797.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   135 bits (340),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +3

Query  12   QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            ++W+V  +    IL + EG FV+IT+V++AVA+GAVCLDGSPPAYH  RGSG GIN+WLI
Sbjct  5    KQWLVLVVCSLAIL-KAEGLFVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLI  63

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N
Sbjct  64   QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSN  103


 Score = 95.9 bits (237),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDV+AVNP TNLHFRGARV++AV+++LLA
Sbjct  108  NPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLA  157



>ref|NP_001151183.1| LOC100284816 precursor [Zea mays]
 gb|ACG41900.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   143 bits (360),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  18   WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  197
            W    L + + L+  +GF VDITYV+SAVAKGAVCLDGS PAYH  RGSG G N+WL+HF
Sbjct  9    WWCCALGWALALVAADGFLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHF  68

Query  198  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPIE  323
            EGG WCNNVTTCL RK TRLGSS +M  Q+AFSG+L + P +
Sbjct  69   EGGGWCNNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDD  110


 Score = 88.2 bits (217),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE V+P T LH+RGAR++ AV++DLLA
Sbjct  111  NPDFYNWNKVKVRYCDGSSFTGDVEEVDPATKLHYRGARIWQAVMDDLLA  160



>ref|XP_004172255.1| PREDICTED: protein notum homolog [Cucumis sativus]
 gb|KGN53459.1| hypothetical protein Csa_4G056500 [Cucumis sativus]
Length=398

 Score =   138 bits (348),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = +3

Query  18   WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  197
            W+ + +A     L+ +   V ITYVQ AV KGAVCLDGSPPAYHF  G G GINNWLI  
Sbjct  9    WLFF-VASVQFFLKAQCINVGITYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLIQL  67

Query  198  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            EGG WCNNVTTCL R+DTRLGSS KMV Q+AFSG+L N P
Sbjct  68   EGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKP  107


 Score = 92.8 bits (229),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+  TNLHFRGARVF A+I++LLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVDSATNLHFRGARVFRAIIDNLLA  159



>ref|XP_008238011.1| PREDICTED: protein notum homolog isoform X1 [Prunus mume]
Length=401

 Score =   141 bits (356),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            ++ LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G GINNWL+H EG
Sbjct  10   LFLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            G WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N  +
Sbjct  70   GGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKM  108


 Score = 89.7 bits (221),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPK-TNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDV AVNP+ T L+FRGAR+F AVIEDLLA
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVAAVNPQATGLYFRGARIFRAVIEDLLA  160



>gb|EMT14315.1| hypothetical protein F775_08483 [Aegilops tauschii]
Length=400

 Score =   147 bits (370),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  30   GLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGA  209
              A  + +L  +G+FVDITYV+SAVAKGAVCLDGSPPAYH  RGSG G ++WL+HFEGG 
Sbjct  13   AFACALAVLEADGYFVDITYVESAVAKGAVCLDGSPPAYHLARGSGSGASSWLVHFEGGG  72

Query  210  WCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            WCNNVTTCL R  TRLGSS +M KQVAFSG+L N P
Sbjct  73   WCNNVTTCLQRSHTRLGSSKEMAKQVAFSGILSNAP  108


 Score = 84.3 bits (207),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  311  PSHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            P +   DFY WN+++VRYCDGSSFTG+ E V+P+TNLH+RGARV+ AV+EDLLA
Sbjct  108  PEYNPVDFYNWNKVRVRYCDGSSFTGNKEEVDPRTNLHYRGARVWQAVMEDLLA  161



>gb|KJB24941.1| hypothetical protein B456_004G175900 [Gossypium raimondii]
Length=400

 Score =   135 bits (340),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            T G +V ITYVQSAVAKGAVCLDGSPPAYH+D+G G GIN+WLI  EGG WCNNV++CL 
Sbjct  23   TNGAYVPITYVQSAVAKGAVCLDGSPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLV  82

Query  240  RKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            RK+T LGSS +MVKQ+ FSG+L N  I
Sbjct  83   RKNTHLGSSKRMVKQIPFSGILNNKRI  109


 Score = 95.9 bits (237),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDV AVNP TNLHFRGARV++AV+EDLL+
Sbjct  111  NPDFYNWNRIKVRYCDGSSFTGDVAAVNPVTNLHFRGARVWLAVMEDLLS  160



>ref|XP_010266383.1| PREDICTED: uncharacterized protein LOC104603916 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   139 bits (350),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +I L+  G +V ITY++S+VAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WC NV
Sbjct  58   LITLKVNGLYVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTNV  117

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            TTCL RK+T LGSS KMV ++AFSG+L N+
Sbjct  118  TTCLFRKNTHLGSSKKMVTEIAFSGILSNN  147


 Score = 91.7 bits (226),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNRIKVRYCDG+SFTGD+E V+P TNLH+RGAR+++AVIEDLL
Sbjct  151  NPDFYNWNRIKVRYCDGASFTGDLEKVDPVTNLHYRGARIWLAVIEDLL  199



>ref|XP_010266384.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010266385.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
Length=391

 Score =   139 bits (350),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +I L+  G +V ITY++S+VAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WC NV
Sbjct  15   LITLKVNGLYVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTNV  74

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            TTCL RK+T LGSS KMV ++AFSG+L N+
Sbjct  75   TTCLFRKNTHLGSSKKMVTEIAFSGILSNN  104


 Score = 92.0 bits (227),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNRIKVRYCDG+SFTGD+E V+P TNLH+RGAR+++AVIEDLL
Sbjct  108  NPDFYNWNRIKVRYCDGASFTGDLEKVDPVTNLHYRGARIWLAVIEDLL  156



>ref|XP_010266380.1| PREDICTED: uncharacterized protein LOC104603915 isoform X1 [Nelumbo 
nucifera]
Length=412

 Score =   144 bits (363),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   VVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFE  200
            ++Y L   +I ++  GFFV ITYV++++AKGAVCLDGSPPAYH D+G G GINNWL+H E
Sbjct  22   LLYLLICTLITMKANGFFVGITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHLE  81

Query  201  GGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            GG WC+NVT CLA KDTR GSS KM KQ+AFSG+L N
Sbjct  82   GGGWCSNVTICLAHKDTRHGSSKKMAKQIAFSGILSN  118


 Score = 86.3 bits (212),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WN+IKVRYCDGSSFTGDVEA++P  NL+ RG RV+ AV+EDLL
Sbjct  123  NPDFYNWNKIKVRYCDGSSFTGDVEAIDPANNLYLRGERVWQAVMEDLL  171



>ref|XP_010266381.1| PREDICTED: uncharacterized protein LOC104603915 isoform X2 [Nelumbo 
nucifera]
Length=399

 Score =   144 bits (363),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   VVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFE  200
            ++Y L   +I ++  GFFV ITYV++++AKGAVCLDGSPPAYH D+G G GINNWL+H E
Sbjct  9    LLYLLICTLITMKANGFFVGITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHLE  68

Query  201  GGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            GG WC+NVT CLA KDTR GSS KM KQ+AFSG+L N
Sbjct  69   GGGWCSNVTICLAHKDTRHGSSKKMAKQIAFSGILSN  105


 Score = 86.3 bits (212),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WN+IKVRYCDGSSFTGDVEA++P  NL+ RG RV+ AV+EDLL
Sbjct  110  NPDFYNWNKIKVRYCDGSSFTGDVEAIDPANNLYLRGERVWQAVMEDLL  158



>ref|XP_010235850.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
 ref|XP_010235851.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
Length=395

 Score =   142 bits (358),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  30   GLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGA  209
              A  +  L  +GFFVDITYV SAVAKGAVCLDGS PAYH  RG G G+++WL+HFEGG 
Sbjct  14   AFACALAFLGADGFFVDITYVDSAVAKGAVCLDGSAPAYHLARGFGSGVDSWLVHFEGGG  73

Query  210  WCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            WC+NVTTCL RK+TRLGSS +M KQVAFSG+L N P
Sbjct  74   WCSNVTTCLERKNTRLGSSKEMAKQVAFSGILSNTP  109


 Score = 87.4 bits (215),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +2

Query  311  PSHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            P H NPDFY WN+++VRYCDGSSFTGD E V+P T LH+RGARV+ AV+EDLLA
Sbjct  109  PDH-NPDFYNWNKVRVRYCDGSSFTGDKEEVDPTTKLHYRGARVWQAVMEDLLA  161



>gb|EPS71696.1| hypothetical protein M569_03061, partial [Genlisea aurea]
Length=395

 Score =   140 bits (352),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = +3

Query  39   FFMILL----RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGG  206
             F++L+    ++EG FV ITYV  AV KGAVCLDGSPPAYH D GSG G N+WL+H EGG
Sbjct  2    LFLVLITVSGKSEGSFVGITYVDGAVEKGAVCLDGSPPAYHLDLGSGAGANSWLVHVEGG  61

Query  207  AWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
             WCNNVTTCLAR+DTRLGSS +M  Q+AFSG+  N P
Sbjct  62   GWCNNVTTCLARRDTRLGSSRRMATQIAFSGIFSNRP  98


 Score = 90.1 bits (222),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDVEAV+P T L++RGARV  AVIEDLLA
Sbjct  101  NPDFYNWNRVKVRYCDGASFTGDVEAVDPATKLYYRGARVLGAVIEDLLA  150



>ref|XP_010676220.1| PREDICTED: uncharacterized protein LOC104892094 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   139 bits (349),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +3

Query  6    GVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNW  185
             +Q+W+   L F ++  ++EG +V IT V+SAVAKGAVCLDGS PAYH  RG G GIN+W
Sbjct  5    AIQQWMKL-LVFMVVFQKSEGLYVGITKVRSAVAKGAVCLDGSAPAYHLHRGHGTGINSW  63

Query  186  LIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            L+H EGG WCNN+TTCL RK + LGSS KM KQ+AFSG+L N+P+
Sbjct  64   LVHVEGGGWCNNITTCLERKYSHLGSSWKMDKQLAFSGILSNNPM  108


 Score = 91.3 bits (225),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDG+SFTG+VEAVNP T LHFRGAR++ AVIEDLL
Sbjct  110  NPDFYNWNRVKIRYCDGASFTGNVEAVNPITKLHFRGARIWHAVIEDLL  158



>ref|XP_004512349.1| PREDICTED: protein notum homolog isoform X1 [Cicer arietinum]
 ref|XP_004512350.1| PREDICTED: protein notum homolog isoform X2 [Cicer arietinum]
Length=487

 Score =   132 bits (332),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + E  +V I+YV +AV KGAVCLDGSPPAYHFD+G G GIN+WL+ FEGG WCNN+TTCL
Sbjct  62   KAEAAYVPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNNITTCL  121

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
             RK  RLGSS +M KQ+AFSG+L N
Sbjct  122  GRKMNRLGSSKQMAKQIAFSGILNN  146


 Score = 97.4 bits (241),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVE VNP T LHFRGARVF AV+E+LLA
Sbjct  151  NPDFYNWNRIKVRYCDGSSFTGDVEIVNPVTKLHFRGARVFNAVMEELLA  200



>gb|ACG39759.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   140 bits (354),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  18   WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  197
            W    L + + L+  +GF VDITYV+SAVAKGAVCLDGS PAYH  RGSG G  +WL+HF
Sbjct  9    WWCCALGWALALVAADGFLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGEKSWLVHF  68

Query  198  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPIE  323
            EGG WCNNVTTCL RK TRLGSS +M  Q+AFSG+L + P +
Sbjct  69   EGGGWCNNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDD  110


 Score = 88.2 bits (217),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE V+P T LH+RGAR++ AV++DLLA
Sbjct  111  NPDFYNWNKVKVRYCDGSSFTGDVEEVDPATKLHYRGARIWQAVMDDLLA  160



>ref|XP_009108427.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   132 bits (333),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +3

Query  12   QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            ++W+V  +    IL + EG  V+IT+V++AVAKGAVCLDGSPPAYH DRGSG GIN+WLI
Sbjct  5    KQWLVLVVCSLAIL-KAEGLLVNITFVRNAVAKGAVCLDGSPPAYHIDRGSGTGINSWLI  63

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
              EGG WC+NVT C++R  T+LGSS KMV+ +AFS +L N
Sbjct  64   QLEGGGWCHNVTNCISRMHTKLGSSKKMVENLAFSAILSN  103


 Score = 96.3 bits (238),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             RNPDFY WNR+KVRYCDGSSFTGDV+ VNP TNLHFRGARV++AV+++LLA
Sbjct  106  QRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMQELLA  157



>gb|AGT16732.1| carboxylic ester hydrolase [Saccharum hybrid cultivar R570]
Length=398

 Score =   142 bits (358),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            V  W    L   + L+  +G  VDITYV+SAVAKGAVCLDGS PAYH  RGSG G N+WL
Sbjct  6    VCAWWCCALVCALALVAADGLLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWL  65

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            +HFEGG WCNNVTTCL RK TRLGSS +MV Q+AFSG+L + P
Sbjct  66   VHFEGGGWCNNVTTCLQRKRTRLGSSKEMVTQIAFSGILSDTP  108


 Score = 86.3 bits (212),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE V+  T LH+RGAR++ AV+EDLLA
Sbjct  111  NPDFYNWNKVKVRYCDGSSFTGDVEEVDLTTKLHYRGARIWQAVMEDLLA  160



>emb|CDY09289.1| BnaC03g63190D [Brassica napus]
Length=397

 Score =   132 bits (333),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +3

Query  3    LGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINN  182
            +   +W+V  +    IL + EG  V+IT+V++AVAKGAVCLDGSPPAYH DRGSG GIN+
Sbjct  2    INFNQWLVLVVCSLAIL-KAEGLLVNITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINS  60

Query  183  WLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            WLI  EGG WC+NVT C++R  T+LGSS KMV+ +AFS +L N
Sbjct  61   WLIQLEGGGWCHNVTNCISRMHTKLGSSKKMVENLAFSAILSN  103


 Score = 95.1 bits (235),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             RNPDFY WNR+KVRYCDGSSFTGDV+ VNP TNLHFRGARV++AV+ +LLA
Sbjct  106  QRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMRELLA  157



>ref|XP_004953591.1| PREDICTED: protein notum homolog isoform X2 [Setaria italica]
Length=315

 Score =   138 bits (347),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  51   LLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTT  230
            L++ +   VDITYV+SAVAKGAVCLDGS PAYH  RGSG G+N+WL+HFEGG WC+NVTT
Sbjct  23   LVKVDALLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVHFEGGGWCSNVTT  82

Query  231  CLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            CL RK TRLGSS +M  Q+AFSG+L + P
Sbjct  83   CLQRKRTRLGSSKEMATQIAFSGILSDTP  111


 Score = 90.1 bits (222),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE V+P T LH+RGAR++ AV+EDLLA
Sbjct  114  NPDFYNWNKVKVRYCDGSSFTGDVEEVDPTTKLHYRGARIWQAVMEDLLA  163



>gb|EYU29129.1| hypothetical protein MIMGU_mgv1a023759mg [Erythranthe guttata]
Length=384

 Score =   137 bits (344),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             +I+LRTE  +VDITYV+SAVAKGAVCLDGSPPAYH D+GSG+G NNWLIH EGG WCNN
Sbjct  1    MIIVLRTESSYVDITYVESAVAKGAVCLDGSPPAYHLDKGSGDGTNNWLIHLEGGGWCNN  60

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            VTTC++R +  LGSS  M  +  F G+  N P
Sbjct  61   VTTCISRANGHLGSSKHMSNRTMFFGIANNDP  92


 Score = 90.9 bits (224),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+ VRYCDG+SFTGD+EAV+P TNL++RGARVFVAV+EDLL
Sbjct  95   NPDFYNWNRVVVRYCDGASFTGDIEAVDPATNLYYRGARVFVAVMEDLL  143



>ref|XP_009627060.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
 ref|XP_009627061.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
Length=402

 Score =   136 bits (343),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            EG  VDITY+QSAVAKGAVCLDGSPPAYHFD+G G G+NNW I  EGGAWCNN TTCL+R
Sbjct  23   EGHPVDITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSR  82

Query  243  KDTRLGSSTKMVKQVAFSGLLGN  311
              TRLGSS  MVK V+FSG+L N
Sbjct  83   TKTRLGSSKLMVKTVSFSGILSN  105


 Score = 90.9 bits (224),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRI++RYCDGSSFTGDVEAV+PKT +++RGAR+F AV+ED LA
Sbjct  110  NPDFYNWNRIRIRYCDGSSFTGDVEAVDPKTKVYYRGARIFSAVMEDFLA  159



>ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
 gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 gb|KDO40407.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
 gb|KDO40408.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=386

 Score =   129 bits (325),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  15   KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            +W    +   ++L    GF V ITYV++AVAKGAVCLDGSPPAYHFD+G G GINNWL+H
Sbjct  3    QWFNLLVCALIVLKAQAGFNVSITYVENAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVH  62

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
             +GGAWCNNV  C  R+D+  GSS  MVK+  F+G+L N 
Sbjct  63   IDGGAWCNNVEDCSKRRDSSYGSSKHMVKEANFTGILSNE  102


 Score = 97.8 bits (242),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR++VRYCDG+SFTGDVEAVNP+TNLHFRGARVF AV+EDLLA
Sbjct  106  NPDFYDWNRVRVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLA  155



>ref|XP_004953590.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=401

 Score =   137 bits (346),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  18   WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  197
            W     +    L++ +   VDITYV+SAVAKGAVCLDGS PAYH  RGSG G+N+WL+HF
Sbjct  12   WCCALASALSALVKVDALLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVHF  71

Query  198  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            EGG WC+NVTTCL RK TRLGSS +M  Q+AFSG+L + P
Sbjct  72   EGGGWCSNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTP  111


 Score = 89.7 bits (221),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE V+P T LH+RGAR++ AV+EDLLA
Sbjct  114  NPDFYNWNKVKVRYCDGSSFTGDVEEVDPTTKLHYRGARIWQAVMEDLLA  163



>ref|XP_006361581.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=387

 Score =   142 bits (358),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             +I+  TEG  VDITY+QSAVAKGAVCLDGSPPAYHFD+G G G+NNWLI  EGGAWCNN
Sbjct  16   LLIVFITEGHPVDITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWLIQLEGGAWCNN  75

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             TTCLAR  TRLGSS  M+K V+FSG+L N
Sbjct  76   ATTCLARTKTRLGSSKLMLKTVSFSGILSN  105


 Score = 85.1 bits (209),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRI+++YCDGSSFTGDV A +PKT + +RGAR+F AV+ED LA
Sbjct  110  NPDFYNWNRIRIKYCDGSSFTGDVAAADPKTKVFYRGARIFSAVMEDFLA  159



>ref|XP_009771151.1| PREDICTED: uncharacterized protein LOC104221730 [Nicotiana sylvestris]
Length=402

 Score =   136 bits (343),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            EG  VDITY+QSAVAKGAVCLDGSPPAYHFD+G G G+NNW I  EGGAWCNN TTCL+R
Sbjct  23   EGHPVDITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSR  82

Query  243  KDTRLGSSTKMVKQVAFSGLLGN  311
              TRLGSS  MVK V+FSG+L N
Sbjct  83   TKTRLGSSKLMVKTVSFSGILSN  105


 Score = 89.7 bits (221),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRI++RYCDGSSFTGDVEAV+P+T +++RGAR+F AV+ED LA
Sbjct  110  NPDFYNWNRIRIRYCDGSSFTGDVEAVDPRTKVYYRGARIFSAVMEDFLA  159



>ref|XP_004512351.1| PREDICTED: protein notum homolog isoform X3 [Cicer arietinum]
Length=448

 Score =   132 bits (332),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + E  +V I+YV +AV KGAVCLDGSPPAYHFD+G G GIN+WL+ FEGG WCNN+TTCL
Sbjct  23   KAEAAYVPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNNITTCL  82

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
             RK  RLGSS +M KQ+AFSG+L N
Sbjct  83   GRKMNRLGSSKQMAKQIAFSGILNN  107


 Score = 94.0 bits (232),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVE VNP T LHFRGARVF AV+E+LLA
Sbjct  112  NPDFYNWNRIKVRYCDGSSFTGDVEIVNPVTKLHFRGARVFNAVMEELLA  161



>ref|XP_006494119.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006494120.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
Length=392

 Score =   127 bits (319),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  15   KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            +W    +   +IL     F V ITYV+ AVAKGAVCLDGSPPAYHFD+G G GINNWL+H
Sbjct  9    QWFNLLVCALLILKAQACFNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVH  68

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
             +GGAWCNNV  C  R+D+  GSS  MVK+  F+G+L N 
Sbjct  69   IDGGAWCNNVADCSNRRDSSYGSSKYMVKEANFTGILSNE  108


 Score = 99.0 bits (245),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDVEAVNP+TNLHFRGARVF AV+EDLLA
Sbjct  112  NPDFYDWNRVKVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLA  161



>ref|XP_002454426.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
 gb|EES07402.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Length=398

 Score =   135 bits (339),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            +G  VDITYV+SAVAKGAVCLDGS PAYH  RGSG G N+WL+HFEGG WCNNVTTCL R
Sbjct  24   DGVLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNNVTTCLQR  83

Query  243  KDTRLGSSTKMVKQVAFSGLLGNHP  317
            K TRLGSS +M  Q+AFSG+L + P
Sbjct  84   KRTRLGSSKEMATQIAFSGILSDTP  108


 Score = 91.3 bits (225),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++KVRYCDGSSFTGDVE V+P T LHFRGAR++ AV+EDLLA
Sbjct  111  NPDFYNWNKVKVRYCDGSSFTGDVEEVDPTTKLHFRGARIWQAVMEDLLA  160



>gb|ABK24433.1| unknown [Picea sitchensis]
Length=399

 Score =   135 bits (340),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
              F VD+T V+ AVAKGAVCLDGSPP YH  RG G G+NNWL+HFEGG+WCNNVTTC AR
Sbjct  27   NAFLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTCSAR  86

Query  243  KDTRLGSSTKMVKQVAFSGLLGNH  314
              TRLGSS  M+KQV FSGLLGN+
Sbjct  87   TKTRLGSSKYMIKQVDFSGLLGNN  110


 Score = 90.1 bits (222),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  320  RNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            RNPDFY WNRIKVRYCDG+SFTGDVEAVNP   L+FRG RVF AVI DL+A
Sbjct  113  RNPDFYNWNRIKVRYCDGASFTGDVEAVNPVDKLYFRGQRVFKAVIGDLMA  163



>gb|ABK24994.1| unknown [Picea sitchensis]
Length=399

 Score =   135 bits (340),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
              F VD+T V+ AVAKGAVCLDGSPP YH  RG G G+NNWL+HFEGG+WCNNVTTC AR
Sbjct  27   NAFLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTCSAR  86

Query  243  KDTRLGSSTKMVKQVAFSGLLGNH  314
              TRLGSS  M+KQV FSGLLGN+
Sbjct  87   TKTRLGSSKYMIKQVDFSGLLGNN  110


 Score = 90.1 bits (222),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  320  RNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            RNPDFY WNRIKVRYCDG+SFTGDVEAVNP   L+FRG RVF AVI DL+A
Sbjct  113  RNPDFYNWNRIKVRYCDGASFTGDVEAVNPVDKLYFRGQRVFKAVIGDLMA  163



>ref|XP_006432881.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
 gb|ESR46121.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
Length=392

 Score =   126 bits (317),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  15   KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            +W    +   +IL     F V ITYV+ AVAKGAVCLDGSPPAYHFD+G G GINNWL+H
Sbjct  9    QWFNLLVCALLILKAQACFNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVH  68

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
             +GGAWCNNV  C  R+D+  GSS  MVK+  F+G+L N 
Sbjct  69   IDGGAWCNNVADCSNRRDSSHGSSKYMVKEANFTGILSNE  108


 Score = 99.0 bits (245),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDVEAVNP+TNLHFRGARVF AV+EDLLA
Sbjct  112  NPDFYDWNRVKVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLA  161



>ref|XP_006368062.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=329

 Score =   137 bits (345),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = +3

Query  33   LAFFMILL---RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            L FF+ LL   RTE   V+IT ++SAVAKGAVCLDG+PPAYH DRGSG G+NNW+I  EG
Sbjct  6    LLFFVCLLIFVRTESLLVNITILESAVAKGAVCLDGTPPAYHLDRGSGPGVNNWVISLEG  65

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            G WC NVT CL RK+TRLGSS KM  Q+ FSG++ N P
Sbjct  66   GGWCQNVTLCLTRKNTRLGSSAKMDHQLPFSGMMSNDP  103


 Score = 87.4 bits (215),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NP+FY WNR+ VRYCDG SFTGDVEA++P T LH+RGAR+F A++E+LLA
Sbjct  106  NPEFYNWNRVSVRYCDGGSFTGDVEAIDPGTGLHYRGARIFKAIMEELLA  155



>ref|XP_007156332.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
 gb|ESW28326.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
Length=399

 Score =   134 bits (337),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            +A  ++LL+ EG  V +T V++A++KGAVCLDGSPPAYHFD+G GEGINNW++H EGG W
Sbjct  13   VACVLLLLKAEGSLVPLTLVENALSKGAVCLDGSPPAYHFDKGDGEGINNWIVHMEGGGW  72

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            C +   CL RKDTRLGSS +MV+ + FSG+L N 
Sbjct  73   CKDADDCLGRKDTRLGSSKQMVEDLYFSGILSNE  106


 Score = 90.1 bits (222),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY W+R+K+RYCDGSSFTGDVE V+P  NL+FRGAR+F AV+EDLLA
Sbjct  110  NPDFYNWDRVKIRYCDGSSFTGDVEEVDPTNNLYFRGARIFSAVMEDLLA  159



>ref|XP_004300392.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465292.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465293.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
Length=394

 Score =   123 bits (308),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L   +ILL+ E   V++T VQSAVAKGAVCLDGSPPAYHFD+G G GINNWL+H EGG W
Sbjct  13   LVCLLILLKAESHPVELTLVQSAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGW  72

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
            C +V +C+ R     GSS  M K ++FSG+LG
Sbjct  73   CKDVESCVERTKNFRGSSKHMEKTISFSGVLG  104


 Score =   100 bits (250),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP TNLHFRG RVF+AVI+DLLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPATNLHFRGGRVFLAVIDDLLA  159



>ref|XP_004244443.1| PREDICTED: uncharacterized protein LOC101251798 [Solanum lycopersicum]
Length=392

 Score =   140 bits (352),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    GVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNW  185
            G  + ++  +   +I+L +EG  V+ITY+QSAVAKGAVCLDGSPPAYHFD+G G G+NNW
Sbjct  4    GTMQLLLRAIFTLLIVLISEGHPVEITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNW  63

Query  186  LIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             I  EGGAWCNN TTCL R  TRLGSS  MVK V+FSG+L N
Sbjct  64   FIQLEGGAWCNNATTCLERTKTRLGSSKLMVKTVSFSGILSN  105


 Score = 83.6 bits (205),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRI++RYCDGSSFTGDV A +P+T + +RGAR+F AV++D LA
Sbjct  110  NPDFYNWNRIRIRYCDGSSFTGDVAAADPRTKVFYRGARIFSAVMDDFLA  159



>ref|XP_008373439.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
 ref|XP_008373440.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
Length=438

 Score =   138 bits (347),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++LL+     V ITYV SAVAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WCNN+
Sbjct  17   VMLLKAAALPVGITYVHSAVAKGAVCLDGSPPAYHLDKGYGSGINNWLVHIEGGGWCNNI  76

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            TTCL RK+ RLGSS KM+K++AFSG+L +  I
Sbjct  77   TTCLVRKNNRLGSSKKMLKEIAFSGILNSRHI  108


 Score = 85.5 bits (210),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDV AVN  T L FRGAR+F AVIE+LLA
Sbjct  110  NPDFYNWNRVKVRYCDGASFTGDVAAVNLATGLFFRGARIFRAVIEELLA  159



>ref|XP_010327577.1| PREDICTED: uncharacterized protein LOC101244626 [Solanum lycopersicum]
Length=398

 Score =   137 bits (345),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
            F+I + TEG  V+IT ++SAVAKGAVCLDG+PPAYH DRGSG G+N+W+I  EGG WC N
Sbjct  12   FLIFVTTEGLLVNITILESAVAKGAVCLDGTPPAYHLDRGSGSGVNSWVISLEGGGWCQN  71

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            VT+CL RK+TRLGSS KM  Q+ FSG++ N P
Sbjct  72   VTSCLTRKNTRLGSSAKMDHQLPFSGMMSNDP  103


 Score = 86.3 bits (212),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NP+F++WNR+ VRYCDG SFTGDVEA++P T LH+RGAR+F A++E+LLA
Sbjct  106  NPEFHSWNRVSVRYCDGGSFTGDVEAIDPATRLHYRGARIFKAIMEELLA  155



>ref|XP_008373438.1| PREDICTED: protein notum homolog isoform X1 [Malus domestica]
Length=466

 Score =   138 bits (347),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++LL+     V ITYV SAVAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WCNN+
Sbjct  45   VMLLKAAALPVGITYVHSAVAKGAVCLDGSPPAYHLDKGYGSGINNWLVHIEGGGWCNNI  104

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            TTCL RK+ RLGSS KM+K++AFSG+L +  I
Sbjct  105  TTCLVRKNNRLGSSKKMLKEIAFSGILNSRHI  136


 Score = 85.5 bits (210),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDV AVN  T L FRGAR+F AVIE+LLA
Sbjct  138  NPDFYNWNRVKVRYCDGASFTGDVAAVNLATGLFFRGARIFRAVIEELLA  187



>ref|XP_009797415.1| PREDICTED: uncharacterized protein LOC104243851 [Nicotiana sylvestris]
Length=388

 Score =   136 bits (343),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 78/102 (76%), Gaps = 3/102 (3%)
 Frame = +3

Query  21   VVYGLAFF---MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            V + L FF   +I+ RTE   V+IT ++SAVAKG VCLDG+PPAYH DRGSG G++NW+I
Sbjct  2    VTHCLFFFISLLIICRTESLLVNITILESAVAKGGVCLDGTPPAYHLDRGSGTGLDNWVI  61

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
              EGG WC N+T CL RK++RLGSS KM KQVAFSG++ N P
Sbjct  62   SIEGGGWCQNITHCLQRKNSRLGSSAKMGKQVAFSGIMSNDP  103


 Score = 87.0 bits (214),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NP+FY WNR+ VRYCDG SFTGDVEAV+P T LH+RGAR+F A++ DLLA
Sbjct  106  NPEFYNWNRVSVRYCDGGSFTGDVEAVDPATGLHYRGARIFEAIMADLLA  155



>ref|XP_010677538.1| PREDICTED: protein notum homolog isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   137 bits (346),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +3

Query  3    LGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINN  182
            +   +W+ + ++  M+L+   GF V ITYVQ AVAKG VCLDGSPPAYHFD+G G GI+N
Sbjct  1    MHCSQWLQFLVSVLMLLI-VNGFQVPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHN  59

Query  183  WLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            WLIH EGGAWCNN TTCL R  TRLGSS  M KQ  FSG+L N 
Sbjct  60   WLIHMEGGAWCNNATTCLERTKTRLGSSKLMTKQYTFSGILSNQ  103


 Score = 85.5 bits (210),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            +PDFY WNRIKVRYCDGSSFTGDVEAV+PK  +++RGAR++ A+++DLLA
Sbjct  107  SPDFYNWNRIKVRYCDGSSFTGDVEAVDPKAKVYYRGARLWRAIMDDLLA  156



>ref|XP_002303225.2| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ABK93778.1| unknown [Populus trichocarpa]
 gb|ABK95483.1| unknown [Populus trichocarpa]
 gb|EEE78204.2| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   130 bits (326),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +3

Query  15   KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            KW+   + + + LL+TEG  + +T VQ+AVA+GAVCLDGSPP YHF++GSG GINNWL+H
Sbjct  8    KWLCL-IVYILTLLKTEGASIPMTIVQAAVARGAVCLDGSPPGYHFEKGSGSGINNWLVH  66

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             EGG WC +V +C++R+DT  GSS KM K + FSG+LG+
Sbjct  67   MEGGGWCESVESCVSRRDTYKGSSLKMEKTMGFSGILGS  105


 Score = 92.4 bits (228),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIK+RYCDGSSFTGDVEAV+PKT L+FRG R++ AVI+DLLA
Sbjct  110  NPDFYNWNRIKIRYCDGSSFTGDVEAVDPKTKLYFRGERIWQAVIDDLLA  159



>gb|KHG23648.1| Notum [Gossypium arboreum]
Length=395

 Score =   134 bits (336),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            T G +V ITYVQSAVAKGAVCLDG+PPAYH+D+G G GIN+WLI  EGG WCNNV++CL 
Sbjct  23   TNGAYVPITYVQSAVAKGAVCLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLV  82

Query  240  RKDTRLGSSTKMVKQVAFSGLLGN  311
            RK+T LGSS +MVKQ+ FSG+L N
Sbjct  83   RKNTHLGSSKRMVKQIPFSGILNN  106


 Score = 88.2 bits (217),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            N  FY WNRIKVRYCDGSSFTGDV AVNP  NLHFRGARV++AV+EDLL+
Sbjct  106  NKHFYNWNRIKVRYCDGSSFTGDVAAVNPVANLHFRGARVWLAVMEDLLS  155



>ref|XP_008238076.1| PREDICTED: uncharacterized protein LOC103336755 [Prunus mume]
Length=289

 Score =   122 bits (305),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + E   V IT V++AVAKGAVCLDGS PAYHFD+G G GINNWL+H EGG WCN+V TCL
Sbjct  21   KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNSVETCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
             RK+T  GSS KM K ++FSG+L N
Sbjct  81   DRKNTHYGSSNKMEKSMSFSGVLSN  105


 Score = 99.8 bits (247),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAVNP TNLHFRGARVF A+I+DLLA
Sbjct  110  NPDFYNWNRIKVRYCDGASFTGDVEAVNPATNLHFRGARVFRAIIDDLLA  159



>ref|XP_010248193.1| PREDICTED: uncharacterized protein LOC104591101 [Nelumbo nucifera]
Length=394

 Score =   134 bits (338),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            ++ L + ++++   G+FV ITYV +AVAKGAVCLDGSPPAYH   G G G+NNWLI  EG
Sbjct  10   LFLLIWTLVIVGANGYFVGITYVDNAVAKGAVCLDGSPPAYHMAPGFGSGVNNWLILLEG  69

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            GAWCNN TTCLARK+TRLGSS +MVKQ++FSG L +
Sbjct  70   GAWCNNATTCLARKNTRLGSSKEMVKQLSFSGFLSD  105


 Score = 87.0 bits (214),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDF+ WN++KVRYCDGSSFTGDVEAV+P TNL++RG R+F AV++DLL
Sbjct  110  NPDFFNWNKVKVRYCDGSSFTGDVEAVDPATNLYYRGQRIFNAVVDDLL  158



>ref|XP_011012520.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   129 bits (324),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +3

Query  15   KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            KW+   + + + LL+TEG  + +T VQ+AVA+GAVCLDGSPP YHF++GSG GINNWL+H
Sbjct  8    KWLCL-IVYTLTLLKTEGASIPMTIVQTAVARGAVCLDGSPPGYHFEKGSGSGINNWLVH  66

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
             EGG WC +V +C++R+DT  GSS KM K + FSG+LG+ 
Sbjct  67   MEGGGWCESVESCVSRRDTYKGSSLKMEKTMGFSGILGSK  106


 Score = 92.4 bits (228),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIK+RYCDGSSFTGDVEAV+PKT L+FRG R++ AVI+DLLA
Sbjct  110  NPDFYNWNRIKIRYCDGSSFTGDVEAVDPKTKLYFRGERIWQAVIDDLLA  159



>ref|XP_009350399.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=398

 Score =   122 bits (306),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + E   V IT V++AVAKGAVCLDGS PAYHFD+G G GINNWL+H EGG WCN+V TCL
Sbjct  21   KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHIEGGGWCNSVATCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
             RK+   GSSTKM K ++FSG+LGN
Sbjct  81   DRKNNYRGSSTKMEKTMSFSGVLGN  105


 Score = 98.6 bits (244),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  305  G*PSHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            G     NPDFY WNRIKVRYCDGSSFTGDVEAV+P TNLHFRGARVF A+I+DLLA
Sbjct  104  GNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDDLLA  159



>ref|XP_008355284.1| PREDICTED: uncharacterized protein LOC103418943 [Malus domestica]
Length=398

 Score =   122 bits (305),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + E   V IT V++AVAKGAVCLDGS PAYHFD+G G GINNWL+H EGG WCN+V TCL
Sbjct  21   KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNSVATCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
             RK+   GSSTKM K ++FSG+LGN
Sbjct  81   DRKNNYRGSSTKMEKTMSFSGVLGN  105


 Score = 98.6 bits (244),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  305  G*PSHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            G     NPDFY WNRIKVRYCDGSSFTGDVEAV+P TNLHFRGARVF A+I+DLLA
Sbjct  104  GNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDDLLA  159



>ref|XP_004300391.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465290.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465291.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
Length=399

 Score =   132 bits (333),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  48   ILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVT  227
            +LL+  G  V IT +Q+AVAKGAVCLDGSPPAYH+D+G G G+NNWL+H EGG WC+NVT
Sbjct  18   LLLKATGVPVGITILQTAVAKGAVCLDGSPPAYHWDKGFGSGLNNWLVHIEGGGWCHNVT  77

Query  228  TCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
             CL RK+TRLGSS KM+K++ FSG+L N 
Sbjct  78   NCLGRKNTRLGSSKKMLKEIPFSGILSNR  106


 Score = 87.0 bits (214),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NP FY WNRIKVRYCDGSSFTGDV AV+P T L+FRGARVF AV+ DLLA
Sbjct  110  NPGFYNWNRIKVRYCDGSSFTGDVAAVDPATGLYFRGARVFRAVMADLLA  159



>ref|XP_009592441.1| PREDICTED: uncharacterized protein LOC104089292 [Nicotiana tomentosiformis]
Length=394

 Score =   133 bits (334),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            RTE   V+IT ++SAVA GAVCLDG+PPAYH DRGSG G+NNW+I  EGG WC N+T CL
Sbjct  19   RTESLLVNITILESAVATGAVCLDGTPPAYHLDRGSGTGLNNWVISIEGGGWCQNITHCL  78

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNHP  317
             RK++RLGSS KM KQVAFSG++ N P
Sbjct  79   ERKNSRLGSSAKMGKQVAFSGIMSNDP  105


 Score = 85.9 bits (211),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NP+FY WNR+ VRYCDG SFTGDVEAV+P T LH+RGAR+F A++ DLL+
Sbjct  108  NPEFYNWNRVSVRYCDGGSFTGDVEAVDPATGLHYRGARIFKAIMADLLS  157



>ref|XP_010054026.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010054027.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
Length=434

 Score =   122 bits (305),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 76/128 (59%), Gaps = 35/128 (27%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQ-SAVAKGA-------------------------------  116
            L F + LL+  G  V ITYV+ SAVA+GA                               
Sbjct  13   LLFLVALLQARGVPVRITYVRNSAVARGAGKGLIVWGQKMNASLHIRGLRVSFYVLVLDS  72

Query  117  ---VCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQV  287
               VCLDGSPPAYH DRG G GINNWL+H EGG WCNNVTTCLARK+TRLGSS +M K++
Sbjct  73   CDVVCLDGSPPAYHLDRGFGTGINNWLVHIEGGGWCNNVTTCLARKNTRLGSSKQMAKEI  132

Query  288  AFSGLLGN  311
             FSG+L N
Sbjct  133  PFSGILSN  140


 Score = 96.3 bits (238),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGD+EAVNP TNLHFRGARV+ AV+EDLL+
Sbjct  145  NPDFYNWNRIKVRYCDGASFTGDIEAVNPATNLHFRGARVWQAVMEDLLS  194



>gb|EMT15342.1| hypothetical protein F775_17167 [Aegilops tauschii]
Length=403

 Score =   127 bits (319),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            +   VDITYV+SAVAKGAVCLDGSPPAYH   GSG G+++WL+HFEGGAWCNN TTCL R
Sbjct  27   DDHLVDITYVESAVAKGAVCLDGSPPAYHLAPGSGSGVSSWLVHFEGGAWCNNATTCLHR  86

Query  243  KDTRLGSSTKMVKQVAFSGLLGN  311
              T LGSS +M +Q AF+G+L N
Sbjct  87   SRTPLGSSKEMARQAAFTGILSN  109


 Score = 90.5 bits (223),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  314  SHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            S  NPDFY WN++KVRYCDGSSFTGD E V+P TN+H+RGARV+ AVIEDLLA
Sbjct  111  SDYNPDFYNWNKVKVRYCDGSSFTGDKEEVDPSTNVHYRGARVWQAVIEDLLA  163



>gb|KDP28067.1| hypothetical protein JCGZ_19475 [Jatropha curcas]
Length=394

 Score =   126 bits (317),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            + +W  Y LAF +IL +TEG  + I  +++A AKGAVCLDGS PAYHF +G G GINNW+
Sbjct  6    LSQWC-YLLAFMLILFKTEGGSIPIVLIENAKAKGAVCLDGSAPAYHFQKGEGTGINNWI  64

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPI  320
            +H EGG WC+++ +CLAR++T  GSS+KM K + FSG+LG+  +
Sbjct  65   VHMEGGGWCDDIESCLARRNTYKGSSSKMNKTMGFSGILGSKQV  108


 Score = 90.9 bits (224),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIK+RYCDGSSFTGDVE V+PKTNL+FRG RV+ AVI++LLA
Sbjct  110  NPDFYNWNRIKIRYCDGSSFTGDVEEVDPKTNLYFRGERVWQAVIDELLA  159



>ref|XP_003628996.1| Carboxylic ester hydrolase [Medicago truncatula]
 gb|AET03472.1| pectinacetylesterase family protein [Medicago truncatula]
Length=406

 Score =   128 bits (321),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +3

Query  15   KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            KW+   L   ++ L+T+G +V +T ++SAV+KGAVCLDGSPPAYHFD+G  EG NNW++H
Sbjct  8    KWLS-TLLCALLFLKTQGQYVPLTRLESAVSKGAVCLDGSPPAYHFDQGHDEGANNWIVH  66

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
             EGG WC+NVT CL R+D+RLGSS +M +Q  FSG L ++
Sbjct  67   IEGGGWCHNVTYCLYRRDSRLGSSHEMEEQTYFSGYLSDN  106


 Score = 89.4 bits (220),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDVE V+P T L++RGAR+F AV+E+LLA
Sbjct  110  NPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTKLYYRGARIFSAVMEELLA  159



>ref|XP_003547821.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26083.1| Protein notum like [Glycine soja]
Length=398

 Score =   121 bits (303),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V +  V++A +KGAVCLDGSPPAYHFD+G GEGIN+W++H EGG WCNN+ +CL
Sbjct  21   KAEGSLVPLILVENAESKGAVCLDGSPPAYHFDKGFGEGINSWIVHIEGGGWCNNIESCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNH  314
             RKDTRLGSS +M + + FSG+L N 
Sbjct  81   DRKDTRLGSSKQM-EDIYFSGILSNE  105


 Score = 95.9 bits (237),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDVE V+P TNLHFRGAR+F AVIE+LLA
Sbjct  109  NPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVIEELLA  158



>ref|XP_008365238.1| PREDICTED: uncharacterized protein LOC103428882 [Malus domestica]
Length=311

 Score =   121 bits (303),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + E   V +T V++AVAKGAVCLDGS PAYHFD+G G GINNWL+H EGG WCN V  CL
Sbjct  21   KAESHPVALTLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNTVEDCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNHP  317
             RK    GSSTKM K ++FSG+LGN P
Sbjct  81   DRKSNYRGSSTKMEKTMSFSGVLGNKP  107


 Score = 95.9 bits (237),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+P TNLHFRGARVF A+I+ LLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDXLLA  159



>ref|XP_010677539.1| PREDICTED: protein notum homolog isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   137 bits (346),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +3

Query  3    LGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINN  182
            +   +W+ + ++  M+L+   GF V ITYVQ AVAKG VCLDGSPPAYHFD+G G GI+N
Sbjct  1    MHCSQWLQFLVSVLMLLI-VNGFQVPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHN  59

Query  183  WLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            WLIH EGGAWCNN TTCL R  TRLGSS  M KQ  FSG+L N 
Sbjct  60   WLIHMEGGAWCNNATTCLERTKTRLGSSKLMTKQYTFSGILSNQ  103


 Score = 79.0 bits (193),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            +PDFY WNRIKVRYCDGSSFTGDVEAV+P   +++RGAR++ A+++DLLA
Sbjct  107  SPDFYNWNRIKVRYCDGSSFTGDVEAVDP-AKVYYRGARLWRAIMDDLLA  155



>ref|XP_006385133.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62930.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   125 bits (315),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             +ILL+ EG  + IT V++AV+ GAVCLDGSPP YHFD+GSG GI+NWL+H EGG WC +
Sbjct  16   ILILLKAEGASIPITIVETAVSSGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCES  75

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            V +C++R+DT  GSS+KM K + FSG+LG+ 
Sbjct  76   VESCVSRRDTFRGSSSKMEKTMGFSGILGSK  106


 Score = 90.5 bits (223),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+P+T L+FRG RV+ AVI++LLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPETKLYFRGERVWQAVIDELLA  159



>gb|KHN27509.1| Protein notum like [Glycine soja]
Length=398

 Score =   120 bits (302),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V +T V++A +KGAVCLDGSPPAYHFD+G GEGI+NW++H EGG WCNNV +CL
Sbjct  21   KAEGSSVPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNNVESCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNH  314
             RK+TRLGSS +M K + FS +L N 
Sbjct  81   ERKNTRLGSSKQM-KDIYFSAILSNE  105


 Score = 95.1 bits (235),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDVE V+P TNLHFRGAR+F AV+E+LLA
Sbjct  109  NPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVMEELLA  158



>ref|XP_003547731.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
 ref|XP_006599118.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=398

 Score =   120 bits (302),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V +T V++A +KGAVCLDGSPPAYHFD+G GEGI+NW++H EGG WCNNV +CL
Sbjct  21   KAEGSSVPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNNVESCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNH  314
             RK+TRLGSS +M K + FS +L N 
Sbjct  81   ERKNTRLGSSKQM-KDIYFSAILSNE  105


 Score = 95.1 bits (235),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDVE V+P TNLHFRGAR+F AV+E+LLA
Sbjct  109  NPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVMEELLA  158



>gb|KCW72718.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72719.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=403

 Score =   120 bits (300),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  108  KGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQV  287
            + AVCLDGSPPAYHF++G G G NNWL+ FEGG WCNNVTTCLAR+DTRLGSS +MVK+V
Sbjct  2    RPAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNNVTTCLARRDTRLGSSKEMVKEV  61

Query  288  AFSGLLGNH  314
            AFSG+L N+
Sbjct  62   AFSGILSNN  70


 Score = 95.9 bits (237),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAV+P T LHFRGAR FVA+IEDLL+
Sbjct  74   NPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDLLS  123



>gb|AAP72959.1| pectin acetylesterase [Lactuca sativa]
Length=395

 Score =   125 bits (315),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  12   QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
             +W+   L   + LL TE + V +T++ SAVAKGAVCLDGS PAYH D+G G GI+NWL+
Sbjct  7    DRWLCIFLVCTLSLLCTEAYDVGLTFLNSAVAKGAVCLDGSAPAYHIDKGFGAGIDNWLV  66

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             FEGG WCNN T CL R+DTRLGSS KM+    FSG+  N
Sbjct  67   FFEGGGWCNNATNCLTRRDTRLGSSKKMLTTETFSGMFHN  106


 Score = 90.1 bits (222),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDG+SFTGDVEAV+P T L++RGAR+F AV++DLLA
Sbjct  111  NPDFYDWNRIKVRYCDGASFTGDVEAVDPNTKLYYRGARIFRAVVDDLLA  160



>ref|XP_011028476.1| PREDICTED: protein notum homolog [Populus euphratica]
 ref|XP_011028477.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   125 bits (313),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             +IL + EG  + IT V++AV++GAVCLDGSPP YHFD+GSG GI+NWL+H EGG WC +
Sbjct  16   ILILFKAEGASIPITIVETAVSRGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCES  75

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            V +C++R+DT  GSS+KM K + FSG+LG+ 
Sbjct  76   VESCVSRRDTFRGSSSKMEKTMGFSGILGSK  106


 Score = 90.1 bits (222),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+P+T L+FRG RV+ AVI++LLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPETKLYFRGERVWQAVIDELLA  159



>ref|XP_011082152.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=378

 Score =   117 bits (294),  Expect(3) = 9e-47, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  117  VCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFS  296
            VCLDGSPPAYH DRG G GINNWL+H EGG WCNNVTTCLARK+ RLGSS  MVKQ+AFS
Sbjct  20   VCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNNVTTCLARKNNRLGSSKYMVKQLAFS  79

Query  297  GLLGN  311
            G+L N
Sbjct  80   GILNN  84


 Score = 95.9 bits (237),  Expect(3) = 9e-47, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDVEAVNP T LH+RGARVF+AV+EDLLA
Sbjct  89   NPDFYNWNRVKVRYCDGASFTGDVEAVNPVTKLHYRGARVFLAVMEDLLA  138


 Score = 20.8 bits (42),  Expect(3) = 9e-47, Method: Compositional matrix adjust.
 Identities = 8/10 (80%), Positives = 9/10 (90%), Gaps = 0/10 (0%)
 Frame = +1

Query  88   MFRVLWQKEQ  117
            MF VLW+KEQ
Sbjct  1    MFGVLWRKEQ  10



>ref|XP_002519912.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42516.1| pectin acetylesterase, putative [Ricinus communis]
Length=452

 Score =   122 bits (307),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  27   YGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGG  206
            Y L + ++LL+ EG  + IT V++A A+GAVCLDGSPPAYH+D+G G G NNW++H EGG
Sbjct  69   YFLVYMLLLLKIEGASIPITIVETAKARGAVCLDGSPPAYHYDKGYGTGANNWIVHMEGG  128

Query  207  AWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
             WC+++ +C  RKDT  GSS KM K + FSG+LG
Sbjct  129  GWCDDLESCSQRKDTYKGSSLKMEKTMGFSGILG  162


 Score = 90.5 bits (223),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIK++YCDGSSFTGDVE V+ KTNLHFRG R++ AVI+DLLA
Sbjct  168  NPDFYNWNRIKIKYCDGSSFTGDVEVVDAKTNLHFRGERIWQAVIDDLLA  217



>gb|AFK37852.1| unknown [Lotus japonicus]
Length=399

 Score =   118 bits (296),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            +TEG  V +  ++ AV+KGAVCLDG+PPAYHFD GSGEG+NNW++  EGG WCNNVT CL
Sbjct  21   KTEGGIVPLIRLEKAVSKGAVCLDGTPPAYHFDEGSGEGVNNWIVFLEGGGWCNNVTDCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNH  314
             RKDTR GSS +M +   F+G L  +
Sbjct  81   LRKDTRRGSSDQMTEPRFFNGFLSEN  106


 Score = 94.7 bits (234),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRI VRYCDG+SFTGDVE V+P TNLHFRGARVFVAVIE+LLA
Sbjct  110  NPDFYNWNRILVRYCDGASFTGDVEEVDPATNLHFRGARVFVAVIEELLA  159



>ref|XP_003613922.1| Notum-like protein [Medicago truncatula]
 gb|AES96880.1| pectinacetylesterase family protein [Medicago truncatula]
Length=394

 Score =   119 bits (299),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            E  FV  T VQ+AVAKGAVCLDGSPPAY+FD+G G+G N+WL+H EGG WC+NVT CL R
Sbjct  25   EADFVPTTIVQNAVAKGAVCLDGSPPAYNFDKGYGKGSNSWLVHMEGGGWCHNVTNCLGR  84

Query  243  KDTRLGSSTKMVKQVAFSGLLGN  311
              TRLGSS +M K +AFSG+L +
Sbjct  85   MTTRLGSSKQMNKTLAFSGILND  107


 Score = 94.0 bits (232),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIK+RYCDGSSFTGDVEAV+P T LHFRGAR+F AV+E+LLA
Sbjct  112  NPDFYNWNRIKIRYCDGSSFTGDVEAVDPVTKLHFRGARIFEAVMEELLA  161



>ref|XP_004509558.1| PREDICTED: protein notum homolog [Cicer arietinum]
Length=397

 Score =   120 bits (301),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++ L  EG FV +T +++AV+KGAVCLDGSPP +HFD G G+G+NNW++H EGG WC+NV
Sbjct  15   LLSLHAEGNFVPMTRLENAVSKGAVCLDGSPPTFHFDEGHGDGVNNWIVHIEGGGWCHNV  74

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
              CL RK++RLGSS  M ++  FSG L N+
Sbjct  75   QDCLGRKNSRLGSSDHMKEKSYFSGYLSNN  104


 Score = 92.8 bits (229),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDVE V+P T LHFRGAR+F AV+E+LLA
Sbjct  108  NPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTKLHFRGARIFSAVMEELLA  157



>ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=399

 Score =   130 bits (328),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  15   KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            +W+   +   +ILL+ EG  V ITY+QSAVAKGAVCLDGSPPAYHFD GSG G+NNWL+H
Sbjct  8    QWLSLLVCCLLILLKAEGGSVGITYLQSAVAKGAVCLDGSPPAYHFDPGSGAGVNNWLVH  67

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
             EGG WC +V  CL+R++T LGSS +MVKQ  FSGLL + 
Sbjct  68   MEGGGWCEDVERCLSRRNTDLGSSEQMVKQFGFSGLLSSQ  107


 Score = 82.4 bits (202),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEA  P  NL FRG R++ A+IEDLLA
Sbjct  111  NPDFYNWNRIKVRYCDGSSFTGDVEA--PVNNLFFRGNRIWEAIIEDLLA  158



>ref|XP_008347803.1| PREDICTED: uncharacterized protein LOC103410929 [Malus domestica]
Length=401

 Score =   117 bits (292),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + E   V +T V++AVAKGAVCLDGS  AYHFD+G G GINNWL+H EGG WCN V  CL
Sbjct  24   KAESHPVALTLVENAVAKGAVCLDGSAXAYHFDKGFGAGINNWLVHVEGGGWCNTVEDCL  83

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNHP  317
             RK    GSSTKM K ++FSG+LGN P
Sbjct  84   DRKSNYRGSSTKMEKTMSFSGVLGNKP  110


 Score = 95.5 bits (236),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+P TNLHFRGARVF A+I+ LLA
Sbjct  113  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDXLLA  162



>gb|ADR82372.1| pectin acetylesterase [Populus trichocarpa]
Length=394

 Score =   122 bits (305),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  42   FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  221
             +ILL+ EG  + IT +++AV+ GAVCLDGS P YHFD+GSG GI+NWL+H EGG WC +
Sbjct  16   ILILLKAEGASIPITIIETAVSSGAVCLDGSQPGYHFDKGSGSGIDNWLVHMEGGGWCES  75

Query  222  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            V +C++R+DT  GSS+KM K + FSG+LG+ 
Sbjct  76   VESCVSRRDTFRGSSSKMEKTMGFSGILGSK  106


 Score = 90.5 bits (223),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAV+P+T L+FRG RV+ AVI++LLA
Sbjct  110  NPDFYNWNRIKVRYCDGSSFTGDVEAVDPETKLYFRGERVWQAVIDELLA  159



>gb|KDP28066.1| hypothetical protein JCGZ_19474 [Jatropha curcas]
Length=395

 Score =   121 bits (303),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    GVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNW  185
            G  +W  Y L F ++LL+TEG  + IT V++A  +GAVCLDGSPPAYHFD+G G G NNW
Sbjct  5    GSVQWFSYLLVFMLLLLKTEGGSIPITIVETAKTRGAVCLDGSPPAYHFDKGYGSGANNW  64

Query  186  LIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            ++H EGG WC+++ +CL R+DT  GSS KM K + FSG+LG+
Sbjct  65   IVHMEGGGWCDDIESCLERRDTYKGSSLKMEKTMGFSGILGS  106


 Score = 90.5 bits (223),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIK++YCDGSSFTGDVEAV+PKT L+FRG R++ AVI+DLLA
Sbjct  111  NPDFYNWNRIKIKYCDGSSFTGDVEAVDPKTKLYFRGERIWRAVIDDLLA  160



>ref|XP_010536210.1| PREDICTED: uncharacterized protein LOC104811251 [Tarenaya hassleriana]
Length=391

 Score =   120 bits (302),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 72/102 (71%), Gaps = 6/102 (6%)
 Frame = +3

Query  12   QKW--VVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNW  185
            Q+W  +V  LA  MI        V ITY+ SAVAKGAVCLDGSPPAYHFD+GSG G+NNW
Sbjct  5    QQWRSIVVVLALLMIGAGA----VPITYLDSAVAKGAVCLDGSPPAYHFDKGSGSGVNNW  60

Query  186  LIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            ++H EGG WCN++ +C  RK+T  GSS  M K   FSG+LG+
Sbjct  61   IVHMEGGGWCNDIASCSERKNTMKGSSKFMNKDFGFSGILGS  102


 Score = 90.9 bits (224),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPSNKLFFRGARVWRAVIDDLMA  156



>ref|XP_008808370.1| PREDICTED: uncharacterized protein LOC103720446 isoform X3 [Phoenix 
dactylifera]
Length=401

 Score =   115 bits (289),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +3

Query  18   WV-VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            W+ ++ L   +I ++ EGF V +T VQSAVAKGAVCLDGSPPAYHF  G G G+NNWL+H
Sbjct  12   WIYLFILLELLISMKVEGFDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVH  71

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
             EGG WC NV  C  R     GSS K +KQ++FSG+LG
Sbjct  72   MEGGGWCRNVEECKERTKNFRGSS-KYMKQLSFSGILG  108


 Score = 95.5 bits (236),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++K+RYCDGSSFTGD+EAVNP TNLHFRGARV+ A+I+DLLA
Sbjct  114  NPDFYNWNKVKIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIIDDLLA  163



>ref|XP_008808367.1| PREDICTED: uncharacterized protein LOC103720446 isoform X1 [Phoenix 
dactylifera]
Length=399

 Score =   115 bits (289),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +3

Query  18   WV-VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            W+ ++ L   +I ++ EGF V +T VQSAVAKGAVCLDGSPPAYHF  G G G+NNWL+H
Sbjct  12   WIYLFILLELLISMKVEGFDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVH  71

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
             EGG WC NV  C  R     GSS K +KQ++FSG+LG
Sbjct  72   MEGGGWCRNVEECKERTKNFRGSS-KYMKQLSFSGILG  108


 Score = 95.1 bits (235),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++K+RYCDGSSFTGD+EAVNP TNLHFRGARV+ A+I+DLLA
Sbjct  114  NPDFYNWNKVKIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIIDDLLA  163



>ref|XP_008808368.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008808369.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
Length=396

 Score =   115 bits (289),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +3

Query  18   WV-VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  194
            W+ ++ L   +I ++ EGF V +T VQSAVAKGAVCLDGSPPAYHF  G G G+NNWL+H
Sbjct  9    WIYLFILLELLISMKVEGFDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVH  68

Query  195  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
             EGG WC NV  C  R     GSS K +KQ++FSG+LG
Sbjct  69   MEGGGWCRNVEECKERTKNFRGSS-KYMKQLSFSGILG  105


 Score = 95.1 bits (235),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++K+RYCDGSSFTGD+EAVNP TNLHFRGARV+ A+I+DLLA
Sbjct  111  NPDFYNWNKVKIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIIDDLLA  160



>ref|XP_010111521.1| hypothetical protein L484_021346 [Morus notabilis]
 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis]
Length=386

 Score =   110 bits (275),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  108  KGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQV  287
            + + CLDGSPPAYHF  G G G+NNWL+  EGG WCNNVTTCLARK+TRLGSS  MVK++
Sbjct  26   QDSFCLDGSPPAYHFSHGFGSGVNNWLVQIEGGGWCNNVTTCLARKNTRLGSSKAMVKEL  85

Query  288  AFSGLLGN  311
            +FSG+L N
Sbjct  86   SFSGILSN  93


 Score =   100 bits (248),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP TNLHFRGARVF+A+IEDL A
Sbjct  98   NPDFYDWNRIKVRYCDGSSFTGDVEAVNPATNLHFRGARVFLAIIEDLQA  147



>ref|XP_009397056.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009397057.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   116 bits (291),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +3

Query  18   WVVYGLAFFMIL--LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            W+   + F+ +L  L  + + V +T + SAVAKGAVCLDGSPPAYHF  GSG G NNWL+
Sbjct  9    WIYPFICFYFLLASLEVDAYDVPMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLV  68

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            H EGG WC NV  CL RK+   GSS  M K ++FSG+LGN
Sbjct  69   HMEGGGWCRNVEECLERKNNFRGSSNHM-KPLSFSGILGN  107


 Score = 92.8 bits (229),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNRIK+RYCDGSSFTGDVE V+P TNLH+RGARV++A++EDLL
Sbjct  112  NPDFYNWNRIKIRYCDGSSFTGDVERVDPATNLHYRGARVWLAIMEDLL  160



>gb|KHN27511.1| Protein notum like [Glycine soja]
Length=398

 Score =   114 bits (284),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V +T V+++  KGAVCLDGSPPAYHFD+G G+GINNW++H EGG WCNNVT+CL
Sbjct  21   KAEGSSVPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNNVTSCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNH  314
             RK+T LGSS  M   ++F  +L N 
Sbjct  81   DRKNTTLGSSNHM-SDISFYAILSNQ  105


 Score = 95.1 bits (235),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDVE V+P TNLHFRGAR+F AV+E+LLA
Sbjct  109  NPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVMEELLA  158



>ref|XP_003548585.1| PREDICTED: protein notum homolog [Glycine max]
Length=398

 Score =   114 bits (284),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V +T V+++  KGAVCLDGSPPAYHFD+G G+GINNW++H EGG WCNNVT+CL
Sbjct  21   KAEGSSVPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNNVTSCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNH  314
             RK+T LGSS  M   ++F  +L N 
Sbjct  81   DRKNTTLGSSNHM-SDISFYAILSNQ  105


 Score = 95.1 bits (235),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDVE V+P TNLHFRGAR+F AV+E+LLA
Sbjct  109  NPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVMEELLA  158



>ref|XP_006359968.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=369

 Score =   122 bits (306),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +3

Query  51   LLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTT  230
             + TE   V++T +Q+AVAKGAVCLDGSPPAYH DRGSG G+NNW+I  EGG WC NV  
Sbjct  1    FVTTESSLVNLTILQTAVAKGAVCLDGSPPAYHLDRGSGTGVNNWVISVEGGGWCQNVAQ  60

Query  231  CLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            CL RK+++ GSS KM  QV FSG+L N 
Sbjct  61   CLLRKNSKYGSSAKMENQVFFSGMLSNE  88


 Score = 85.9 bits (211),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NP+FY WNR+ VRYCDG SFTGDVEA++P T LH+RGAR+F A++E+LLA
Sbjct  92   NPEFYNWNRVFVRYCDGGSFTGDVEAIDPGTGLHYRGARIFKAIMEELLA  141



>ref|XP_010911666.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=388

 Score =   117 bits (292),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 5/113 (4%)
 Frame = +3

Query  3    LGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINN  182
            +GV++     L   +I L  EGF V +T VQ AVAKGAVCLDGSPPAYHF  G G G++N
Sbjct  2    IGVKRGAWIYLIVLLISLTVEGFDVPLTLVQDAVAKGAVCLDGSPPAYHFAPGFGSGVDN  61

Query  183  WLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPIEIRTSTP  341
            WL+H EGG WC+NV  C  R     GSS K ++Q++FSG+LGN     +TS+P
Sbjct  62   WLVHMEGGGWCSNVEECKQRTKNFRGSS-KYMEQLSFSGILGNK----QTSSP  109


 Score = 91.3 bits (225),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            +PDFY WN++K+RYCDGSSFTGD+EAVNP TNLHFRGARV+ A++++LLA
Sbjct  108  SPDFYNWNKVKIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIMDELLA  157



>ref|XP_009388128.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   114 bits (284),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 67/99 (68%), Gaps = 3/99 (3%)
 Frame = +3

Query  18   WVVYGLAFFMIL--LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  191
            W+   + FF +L  L  +   V +T + SAVAKGAVCLDGSPPAYHF  GSG G NNWL+
Sbjct  9    WIYPVICFFFLLASLEVDALGVPMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLV  68

Query  192  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
            H EGG WC NV  CL RK+   GSS  M K ++FSG+LG
Sbjct  69   HMEGGGWCRNVEECLERKNNFRGSSNHM-KPLSFSGILG  106


 Score = 93.6 bits (231),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+K+RYCDGSSFTGDVE V+P TNLH+RGARV++A++EDLLA
Sbjct  112  NPDFYNWNRVKIRYCDGSSFTGDVERVDPATNLHYRGARVWLAIMEDLLA  161



>ref|XP_003547822.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26082.1| Protein notum like [Glycine soja]
Length=398

 Score =   115 bits (289),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EG  V +T V++A +KGAVCLDGSPPAYHFD G  EGI NW++H EGG WCNNV +CL
Sbjct  21   KAEGSLVPLTLVKNAESKGAVCLDGSPPAYHFDNGFEEGIKNWIVHIEGGGWCNNVESCL  80

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNH  314
             RKD+RLGSS +M + + FS +L N 
Sbjct  81   YRKDSRLGSSKQM-EDLYFSAILSNE  105


 Score = 92.0 bits (227),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDGSSFTGDVE V+  TNLHFRGAR+F AV+E+LLA
Sbjct  109  NPDFYNWNRVKVRYCDGSSFTGDVEEVDQTTNLHFRGARIFSAVMEELLA  158



>gb|ACS68714.1| pectinacetylesterase precursor [Sonneratia alba]
 gb|ACS68785.1| pectinacetylesterase precursor, partial [Sonneratia alba]
Length=128

 Score =   130 bits (327),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            EGF V ITY+  AVAKGAVCLDGSPPAYHF  G G GINNWL+ FEGG WCN+VT CLAR
Sbjct  2    EGFPVKITYLTEAVAKGAVCLDGSPPAYHFSEGFGAGINNWLVFFEGGGWCNDVTNCLAR  61

Query  243  KDTRLGSSTKMVKQVAFSGLLGN  311
            +DTRLGSS  M K+++FSG+  N
Sbjct  62   RDTRLGSSKHMTKELSFSGIFSN  84


 Score = 77.4 bits (189),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARV  442
            NPDFY WNR+K+RYCDG+S+TGDVEAV+PKT L+FRGAR+
Sbjct  89   NPDFYNWNRVKIRYCDGASYTGDVEAVDPKTKLYFRGARI  128



>ref|XP_006413981.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
 gb|ESQ55434.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
Length=564

 Score =   114 bits (286),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G GINNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGINNWIVHMEGGGWCTDVASCIKRKGTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 92.4 bits (228),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMA  156



>ref|XP_010942974.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=391

 Score =   114 bits (284),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            EGF V +T VQSAVAKGAVCLDGSPPAYHF  G G G+NNWL+H EGG WC NV  C  R
Sbjct  25   EGFDVPLTLVQSAVAKGAVCLDGSPPAYHFTPGFGSGVNNWLVHMEGGGWCRNVEECKER  84

Query  243  KDTRLGSSTKMVKQVAFSGLLGN  311
                 GSS K +KQ++FSG+LGN
Sbjct  85   TKNFRGSS-KYMKQLSFSGILGN  106


 Score = 92.8 bits (229),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++K+RYCDGSSFTGDVEAV+P TNLHFRGARV+ A+++DLLA
Sbjct  111  NPDFYNWNKVKIRYCDGSSFTGDVEAVDPATNLHFRGARVWRAIMDDLLA  160



>ref|XP_008797987.1| PREDICTED: protein notum homolog isoform X1 [Phoenix dactylifera]
Length=391

 Score =   113 bits (283),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + EGF V +T VQ+AVAKGAVCLDGSPPAYHF  G G G+NNWL+H EGG WC+NV  C 
Sbjct  23   KVEGFDVPLTLVQAAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCSNVEECK  82

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGNH  314
             R     GSS K +KQ++FSG+LGN 
Sbjct  83   ERTGNFRGSS-KYMKQLSFSGILGNQ  107


 Score = 92.8 bits (229),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WN++K+RYCDGSSFTGD+EAVNP TNLHFRGARV+ A++++LLA
Sbjct  111  NPDFYNWNKVKIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIMDELLA  160



>ref|XP_010536189.1| PREDICTED: uncharacterized protein LOC104811235 isoform X1 [Tarenaya 
hassleriana]
Length=391

 Score =   115 bits (289),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+ SAVA+GAVCLDGSPPAYHFD+G G G+NNW++H EGG WCN++ +C  RK+T 
Sbjct  24   VPITYLNSAVARGAVCLDGSPPAYHFDKGFGSGVNNWIVHMEGGGWCNDIASCSERKNTM  83

Query  255  LGSSTKMVKQVAFSGLLGNH  314
             GSS  M K   FSG+LG+ 
Sbjct  84   KGSSKLMNKDFGFSGILGSQ  103


 Score = 90.1 bits (222),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVEAVNP   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDVEAVNPSNKLFFRGARVWRAVIDDLMA  156



>gb|KHG09455.1| Protein notum [Gossypium arboreum]
Length=397

 Score =   137 bits (344),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +ILL++EG  V ITY+Q AVAKGAVCLDGSPPAYHFD+GSG G++NW++H EGG WC +V
Sbjct  19   VILLKSEGASVGITYLQDAVAKGAVCLDGSPPAYHFDKGSGTGVDNWIVHMEGGGWCEDV  78

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLL  305
             TCL+RK+T LGSS +MVKQ  FSGLL
Sbjct  79   PTCLSRKNTDLGSSKQMVKQFGFSGLL  105


 Score = 68.6 bits (166),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD  AV+   NL F+G  ++  +I DLLA
Sbjct  112  NPDFYNWNRIKVRYCDGSSFTGD--AVDRANNLFFKGNSIWEFIIADLLA  159



>gb|KJB25075.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25076.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25077.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25079.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25080.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
Length=397

 Score =   137 bits (344),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            +ILL++EG  V ITY+Q AVAKGAVCLDGSPPAYHFD+GSG G++NW++H EGG WC +V
Sbjct  19   VILLKSEGASVGITYLQDAVAKGAVCLDGSPPAYHFDKGSGAGVDNWIVHMEGGGWCEDV  78

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLL  305
             TCL+RK+T LGSS +MVKQ  FSGLL
Sbjct  79   PTCLSRKNTDLGSSKQMVKQFGFSGLL  105


 Score = 68.6 bits (166),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD  AV+   NL F+G  ++  +I DLLA
Sbjct  112  NPDFYNWNRIKVRYCDGSSFTGD--AVDRANNLFFKGNSIWEFIIADLLA  159



>gb|AAM65412.1| pectin acetylesterase [Arabidopsis thaliana]
Length=391

 Score =   116 bits (290),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKLMNKDFGFSGILG  101


 Score = 89.0 bits (219),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRGARVWRAVIDDLMA  156



>ref|NP_974575.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE84179.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=365

 Score =   109 bits (272),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  114  AVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAF  293
            AVCLDGSPPAYH DRGSG GIN+WLI  EGG WCNNVT C++R  TRLGSS KMV+ +AF
Sbjct  6    AVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVSRMHTRLGSSKKMVENLAF  65

Query  294  SGLLGN  311
            S +L N
Sbjct  66   SAILSN  71


 Score = 95.9 bits (237),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+KVRYCDG+SFTGDVEAVNP TNLHFRGARV++AV+++LLA
Sbjct  76   NPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARVWLAVMQELLA  125



>ref|XP_010494620.1| PREDICTED: uncharacterized protein LOC104771742 [Camelina sativa]
Length=391

 Score =   116 bits (290),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKLMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRGARVWRAVIDDLMA  156



>ref|XP_006280604.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
 gb|EOA13502.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
Length=391

 Score =   116 bits (290),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKLMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMA  156



>ref|XP_010441760.1| PREDICTED: uncharacterized protein LOC104724893 [Camelina sativa]
Length=391

 Score =   116 bits (290),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKLMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRGARVWRAVIDDLMA  156



>ref|NP_851135.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AAL07047.1| putative pectin acetylesterase [Arabidopsis thaliana]
 gb|AAN12894.1| putative pectin acetylesterase [Arabidopsis thaliana]
 gb|AED95225.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=370

 Score =   116 bits (290),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKLMNKDFGFSGILG  101


 Score = 88.2 bits (217),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPTHKLFFRGARVWRAVIDDLMA  156



>ref|NP_199341.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 sp|Q9FH82.1|PAE11_ARATH RecName: Full=Pectin acetylesterase 11; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10249.1| pectin acetylesterase [Arabidopsis thaliana]
 gb|AAL15296.1| AT5g45280/K9E15_6 [Arabidopsis thaliana]
 gb|AED95226.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   116 bits (290),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKLMNKDFGFSGILG  101


 Score = 88.2 bits (217),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPTHKLFFRGARVWRAVIDDLMA  156



>ref|XP_006398195.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
 gb|ESQ39648.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
Length=391

 Score =   115 bits (289),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKSTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMA  156



>ref|XP_009128780.1| PREDICTED: uncharacterized protein LOC103853624 [Brassica rapa]
Length=391

 Score =   115 bits (288),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMA  156



>emb|CDX87799.1| BnaC02g31500D [Brassica napus]
Length=391

 Score =   115 bits (288),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMA  156



>emb|CDY26383.1| BnaA02g23870D [Brassica napus]
Length=391

 Score =   115 bits (288),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMA  156



>ref|XP_010481611.1| PREDICTED: uncharacterized protein LOC104760390 [Camelina sativa]
Length=391

 Score =   115 bits (287),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +3

Query  81   ITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLG  260
            ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T  G
Sbjct  26   ITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTMKG  85

Query  261  SSTKMVKQVAFSGLLG  308
            SS  M K   FSG+LG
Sbjct  86   SSKLMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRGARVWRAVIDDLMA  156



>ref|XP_006424455.1| hypothetical protein CICLE_v10030247mg [Citrus clementina]
 gb|ESR37695.1| hypothetical protein CICLE_v10030247mg [Citrus clementina]
Length=292

 Score =   111 bits (278),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 4/90 (4%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  224
            ++LL+ +GF V ITYV++    G  CLDG PPAYHFD+G G GINNWL+  EGG WCN+V
Sbjct  17   LMLLKAQGFSVPITYVEN----GVFCLDGRPPAYHFDKGFGAGINNWLVFIEGGGWCNDV  72

Query  225  TTCLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            TTC  R +T  GSS KM ++V F+G+L N 
Sbjct  73   TTCHVRANTGFGSSKKMGEEVNFTGILSNE  102


 Score = 92.4 bits (228),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNRI+V+YCDG+SFTGD+EAV+P TNLHFRGARVF+AV++DLL
Sbjct  106  NPDFYNWNRIEVKYCDGASFTGDLEAVDPATNLHFRGARVFLAVMKDLL  154



>ref|NP_001190770.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AEE84178.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=517

 Score =   111 bits (278),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C  RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 91.7 bits (226),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AV++DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVVDDLMA  156



>ref|XP_002865253.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41512.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   114 bits (286),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGANNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKLMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMA  156



>ref|XP_009108426.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDX76482.1| BnaA08g09180D [Brassica napus]
Length=391

 Score =   114 bits (286),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C ARK+T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCSARKNTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMA  156



>emb|CDY09287.1| BnaC03g63170D [Brassica napus]
Length=391

 Score =   114 bits (286),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C ARK+T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCSARKNTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMA  156



>ref|XP_006283887.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
 gb|EOA16785.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
Length=391

 Score =   117 bits (292),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +CLARK+T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCLARKNTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 85.9 bits (211),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRGARV+ AV++DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVAAVNPSNKLFFRGARVWRAVVDDLMA  156



>gb|KDO40409.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=372

 Score =   105 bits (261),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  114  AVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAF  293
            AVCLDGSPPAYHFD+G G GINNWL+H +GGAWCNNV  C  R+D+  GSS  MVK+  F
Sbjct  22   AVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNNVEDCSKRRDSSYGSSKHMVKEANF  81

Query  294  SGLLGNH  314
            +G+L N 
Sbjct  82   TGILSNE  88


 Score = 97.8 bits (242),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR++VRYCDG+SFTGDVEAVNP+TNLHFRGARVF AV+EDLLA
Sbjct  92   NPDFYDWNRVRVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLA  141



>emb|CDX99378.1| BnaC01g11740D [Brassica napus]
Length=391

 Score =   113 bits (283),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L   M+++ T    V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG W
Sbjct  12   LVLSMVVIGTGA--VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGW  69

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
            C +V +C+ RK T  GSS  M K   FSG+LG
Sbjct  70   CTDVASCIKRKGTMKGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMA  156



>emb|CDX78932.1| BnaA01g09990D [Brassica napus]
Length=391

 Score =   113 bits (283),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L   M+++ T    V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG W
Sbjct  12   LVLSMVVIGTGA--VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGW  69

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
            C +V +C+ RK T  GSS  M K   FSG+LG
Sbjct  70   CTDVASCIKRKGTMKGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMA  156



>ref|XP_009132784.1| PREDICTED: uncharacterized protein LOC103857370 [Brassica rapa]
Length=391

 Score =   113 bits (283),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L   M+++ T    V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG W
Sbjct  12   LVLSMVVIGTGA--VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGW  69

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
            C +V +C+ RK T  GSS  M K   FSG+LG
Sbjct  70   CTDVASCIKRKGTMKGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMA  156



>emb|CDY67801.1| BnaAnng25210D, partial [Brassica napus]
Length=383

 Score =   105 bits (263),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  114  AVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAF  293
            AVCLDGSPPAYH DRGSG GIN+WLI  EGG WC+NVT C++R  T+LGSS KMV+ +AF
Sbjct  24   AVCLDGSPPAYHIDRGSGTGINSWLIQLEGGGWCHNVTNCISRMHTKLGSSKKMVENLAF  83

Query  294  SGLLGN  311
            S +L N
Sbjct  84   SAILSN  89


 Score = 95.9 bits (237),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             RNPDFY WNR+KVRYCDGSSFTGDV+ VNP TNLHFRGARV++AV+++LLA
Sbjct  92   QRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMQELLA  143



>ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
 gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
Length=398

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L F +I L+ +GFFVDITYV +AVAKGAVCLDGSPPAYH D+GSG GINNWL+H EGG W
Sbjct  12   LVFLVISLKADGFFVDITYVTTAVAKGAVCLDGSPPAYHLDKGSGSGINNWLVHVEGGGW  71

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            C+NVTTC +RK+TRLGSS +MVKQ+AFSGLLGN
Sbjct  72   CSNVTTCFSRKNTRLGSSNQMVKQLAFSGLLGN  104


 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  254  VGVFNENGKAGCFFRAPG*PSHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  433
            +G  N+  K   F    G  +  NPDFY WNR+KVRYCDG+SFTGDVE V+P T LHFRG
Sbjct  86   LGSSNQMVKQLAFSGLLGNKASMNPDFYNWNRVKVRYCDGASFTGDVEEVDPATKLHFRG  145

Query  434  ARVFVAVIEDLLA  472
             R+++AVIEDLLA
Sbjct  146  GRIWLAVIEDLLA  158



>ref|XP_002867940.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44199.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   111 bits (277),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C  RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 88.6 bits (218),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AVI+DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMA  156



>ref|XP_009413211.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=397

 Score =   112 bits (280),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 1/103 (1%)
 Frame = +3

Query  3    LGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINN  182
            LG +   +  +   +  L   GF V +T ++ AV +GAVCLDGSPPAYHF  G G G+NN
Sbjct  9    LGARICPLVCVCCLLAALVVNGFDVPMTLLEGAVDEGAVCLDGSPPAYHFSPGFGSGMNN  68

Query  183  WLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGN  311
            WL+H EGG WC NV  CLAR+DT  GSS K +K ++FSG+LGN
Sbjct  69   WLVHMEGGGWCTNVQDCLARRDTFRGSS-KYMKPLSFSGILGN  110


 Score = 87.0 bits (214),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  305  G*PSHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            G   + NPDFY WN++K+RYCDGSSFTGDV+ V+P T L+FRGA++++AVIE+LLA
Sbjct  109  GNSQNSNPDFYNWNKVKIRYCDGSSFTGDVDEVDPATKLYFRGAKIWLAVIEELLA  164



>dbj|BAD94756.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
Length=285

 Score =   111 bits (278),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C  RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 87.8 bits (216),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AV++DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVVDDLMA  156



>ref|NP_567585.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 sp|Q940J8.1|PAE7_ARATH RecName: Full=Pectin acetylesterase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK96722.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAL47339.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAM64921.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 dbj|BAF00825.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AEE84177.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   111 bits (277),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C  RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 87.8 bits (216),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRGARV+ AV++DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVVDDLMA  156



>ref|XP_010434425.1| PREDICTED: uncharacterized protein LOC104718381 isoform X2 [Camelina 
sativa]
Length=379

 Score =   113 bits (282),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 85.5 bits (210),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRGARV+ AV++DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRGARVWRAVVDDLMA  156



>ref|XP_010439720.1| PREDICTED: uncharacterized protein LOC104723107 [Camelina sativa]
Length=391

 Score =   113 bits (282),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 85.5 bits (210),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRGARV+ AV++DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRGARVWRAVVDDLMA  156



>ref|XP_010434424.1| PREDICTED: uncharacterized protein LOC104718381 isoform X1 [Camelina 
sativa]
Length=391

 Score =   113 bits (282),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 85.5 bits (210),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRGARV+ AV++DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRGARVWRAVVDDLMA  156



>ref|XP_010449359.1| PREDICTED: uncharacterized protein LOC104731629 [Camelina sativa]
Length=391

 Score =   113 bits (282),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTM  83

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS  M K   FSG+LG
Sbjct  84   KGSSKFMNKDFGFSGILG  101


 Score = 85.5 bits (210),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRGARV+ AV++DL+A
Sbjct  107  NPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRGARVWRAVVDDLMA  156



>ref|XP_009771153.1| PREDICTED: uncharacterized protein LOC104221731 [Nicotiana sylvestris]
Length=532

 Score =   113 bits (283),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 63/100 (63%), Gaps = 0/100 (0%)
 Frame = +3

Query  24   VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            +YG  F     +     V+ T + SA+ KGAVCLDGSPPAY  DRGSG G+NNWLIH EG
Sbjct  159  IYGTPFDYFSSQCTILIVNTTILHSAIEKGAVCLDGSPPAYLIDRGSGYGVNNWLIHIEG  218

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPIE  323
            G WC+ ++ C+ R  TR GSS  M  Q  F G+L N P E
Sbjct  219  GGWCSTISECIKRTGTRYGSSIHMEDQYYFQGILSNKPNE  258


 Score = 83.6 bits (205),  Expect(2) = 8e-42, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 3/51 (6%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            + NPDF  WNR+KV+YCDG+SFTGDVE V   T LHFRGARVF+A++EDLL
Sbjct  257  NENPDFLNWNRVKVKYCDGASFTGDVEEV---TGLHFRGARVFLAIMEDLL  304



>ref|XP_010235852.1| PREDICTED: protein notum homolog isoform X2 [Brachypodium distachyon]
Length=353

 Score =   108 bits (270),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  117  VCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFS  296
            +CLDGS PAYH  RG G G+++WL+HFEGG WC+NVTTCL RK+TRLGSS +M KQVAFS
Sbjct  1    MCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSNVTTCLERKNTRLGSSKEMAKQVAFS  60

Query  297  GLLGNHP  317
            G+L N P
Sbjct  61   GILSNTP  67


 Score = 87.8 bits (216),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +2

Query  311  PSHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            P H NPDFY WN+++VRYCDGSSFTGD E V+P T LH+RGARV+ AV+EDLLA
Sbjct  67   PDH-NPDFYNWNKVRVRYCDGSSFTGDKEEVDPTTKLHYRGARVWQAVMEDLLA  119



>ref|XP_009589854.1| PREDICTED: uncharacterized protein LOC104087156 isoform X2 [Nicotiana 
tomentosiformis]
Length=300

 Score =   106 bits (265),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +3

Query  42   FMILLRT------EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            F++LL T      +   V+ T + +A+ KGAVCLDGS PAY  DRGSG G+NNWL+H EG
Sbjct  5    FIVLLLTVSQVSADFLIVNTTILHNAIGKGAVCLDGSAPAYLIDRGSGYGVNNWLVHIEG  64

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPIE  323
            G WC+ ++ C+ R  TR GSS  M  Q  F G+L N P E
Sbjct  65   GGWCSTISECIERTGTRYGSSIHMEDQYYFQGILSNKPNE  104


 Score = 88.6 bits (218),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            + NPDF+ WNR+KV+YCDG+SFTGDV+ V+P T LHFRGARVF+A++EDLL
Sbjct  103  NENPDFFNWNRVKVKYCDGASFTGDVQEVDPVTGLHFRGARVFLAIMEDLL  153



>ref|XP_009589853.1| PREDICTED: uncharacterized protein LOC104087156 isoform X1 [Nicotiana 
tomentosiformis]
Length=381

 Score =   106 bits (264),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +3

Query  42   FMILLRT------EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  203
            F++LL T      +   V+ T + +A+ KGAVCLDGS PAY  DRGSG G+NNWL+H EG
Sbjct  5    FIVLLLTVSQVSADFLIVNTTILHNAIGKGAVCLDGSAPAYLIDRGSGYGVNNWLVHIEG  64

Query  204  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPIE  323
            G WC+ ++ C+ R  TR GSS  M  Q  F G+L N P E
Sbjct  65   GGWCSTISECIERTGTRYGSSIHMEDQYYFQGILSNKPNE  104


 Score = 88.2 bits (217),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            + NPDF+ WNR+KV+YCDG+SFTGDV+ V+P T LHFRGARVF+A++EDLL
Sbjct  103  NENPDFFNWNRVKVKYCDGASFTGDVQEVDPVTGLHFRGARVFLAIMEDLL  153



>gb|KHG23649.1| Notum [Gossypium arboreum]
Length=381

 Score =   105 bits (262),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  120  CLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSG  299
            CLDG+PPAYH+D+G G GIN+WLI  EGG WCNNV++CL RK+T LGSS +MVKQ+ FSG
Sbjct  29   CLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLVRKNTHLGSSKRMVKQIPFSG  88

Query  300  LLGN  311
            +L N
Sbjct  89   ILNN  92


 Score = 88.2 bits (217),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            N  FY WNRIKVRYCDGSSFTGDV AVNP  NLHFRGARV++AV+EDLL+
Sbjct  92   NKHFYNWNRIKVRYCDGSSFTGDVAAVNPVANLHFRGARVWLAVMEDLLS  141



>ref|XP_010325697.1| PREDICTED: uncharacterized protein LOC101260962 [Solanum lycopersicum]
Length=608

 Score =   108 bits (269),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  72   FVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDT  251
            +++IT + SA A+GAVCLDGSPPAYH DRG G G+++W+I+ +GG WCNN++ CL R   
Sbjct  248  YINITVLHSATAQGAVCLDGSPPAYHLDRGHGTGLHSWVIYLDGGGWCNNISDCLNRSTK  307

Query  252  RLGSSTKMVKQVAFSGLLGN  311
             LGSSTKM +Q  F G+L N
Sbjct  308  FLGSSTKMKRQSFFGGILHN  327


 Score = 85.1 bits (209),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  314  SHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDL  466
            S  NP+F+ WNR++V+YCDG+SFTGDVE +NP+  L+FRGAR+F A++EDL
Sbjct  329  SKENPEFHNWNRVRVKYCDGASFTGDVEQINPENKLYFRGARIFKAIMEDL  379



>gb|EEE61621.1| hypothetical protein OsJ_16047 [Oryza sativa Japonica Group]
Length=670

 Score = 97.4 bits (241),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            VD+ +++SAV+ GAVCLDGSPP YHF  GSG G NNWL+H EGG WC N   C  R+   
Sbjct  305  VDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECSVRQGNF  364

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS K ++ ++FSG++G
Sbjct  365  RGSS-KFMRPLSFSGIIG  381


 Score = 95.9 bits (237),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVE V   TNLHFRGARV+ A+IEDLLA
Sbjct  387  NPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNAIIEDLLA  436



>ref|XP_006363883.1| PREDICTED: uncharacterized protein LOC102589191 [Solanum tuberosum]
Length=476

 Score =   107 bits (266),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +3

Query  54   LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTC  233
            ++T+   V+IT ++SA A+GAVCLDGSPPAYH  RG G G++NW+I+ +GG WC ++  C
Sbjct  1    MKTDDLNVNITILESATAQGAVCLDGSPPAYHLHRGHGTGLDNWIIYLDGGGWCESIPEC  60

Query  234  LARKDTRLGSSTKMVKQVAFSGLLGN  311
            L R  T LGS+ KM +Q  FSG+L N
Sbjct  61   LYRTTTYLGSTKKMGQQAFFSGILHN  86


 Score = 85.9 bits (211),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  314  SHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDL  466
            S +NP+F+ WNR++V+YCDGSSFTGDVE V+P+  L+FRGAR+F A++EDL
Sbjct  88   SKQNPEFHNWNRVRVKYCDGSSFTGDVEQVHPENKLYFRGARIFKAIMEDL  138



>gb|EEC77932.1| hypothetical protein OsI_17271 [Oryza sativa Indica Group]
Length=530

 Score = 97.1 bits (240),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            VD+ +++SAV+ GAVCLDGSPP YHF  GSG G NNWL+H EGG WC N   C  R+   
Sbjct  165  VDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECSVRQGNF  224

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS K ++ ++FSG++G
Sbjct  225  RGSS-KFMRPLSFSGIIG  241


 Score = 95.5 bits (236),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVE V   TNLHFRGARV+ A+IEDLLA
Sbjct  247  NPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNAIIEDLLA  296



>ref|XP_010314003.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=404

 Score =   104 bits (259),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
              +FVDIT VQ+AV+KGAVCLDGSPPAYH D G G G+ NW+I   GGAWC N T CL R
Sbjct  41   HAYFVDITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAWCRNTTDCLNR  100

Query  243  KDTRLGSSTKMVKQVAFSGLLGNHPIE  323
              T LGSST M+  + F G+      E
Sbjct  101  SKTDLGSSTLMLPFI-FLGIFSKSKTE  126


 Score = 88.2 bits (217),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  320  RNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             NPDFY WN++ VRYCDG +FTGD+E V+P TNLHFRGAR+F A+IEDLLA
Sbjct  126  ENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDAIIEDLLA  176



>ref|XP_010314004.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=401

 Score =   104 bits (259),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
              +FVDIT VQ+AV+KGAVCLDGSPPAYH D G G G+ NW+I   GGAWC N T CL R
Sbjct  38   HAYFVDITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAWCRNTTDCLNR  97

Query  243  KDTRLGSSTKMVKQVAFSGLLGNHPIE  323
              T LGSST M+  + F G+      E
Sbjct  98   SKTDLGSSTLMLPFI-FLGIFSKSKTE  123


 Score = 88.2 bits (217),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  320  RNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             NPDFY WN++ VRYCDG +FTGD+E V+P TNLHFRGAR+F A+IEDLLA
Sbjct  123  ENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDAIIEDLLA  173



>ref|XP_009590663.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=401

 Score =   103 bits (257),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
              +FVD T VQ+A++KGAVCLDGSPPAYH DRG G G+ NW+I   GGAWC N+T CL R
Sbjct  38   HAYFVDTTIVQNALSKGAVCLDGSPPAYHLDRGFGHGVRNWIILLSGGAWCRNITDCLNR  97

Query  243  KDTRLGSSTKMV  278
              T LGSS  M 
Sbjct  98   SKTDLGSSKHMT  109


 Score = 89.0 bits (219),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  320  RNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             NPDFY WN++ VRYCDG  FTGD+E+++P TNLHFRGAR+F AVIEDLLA
Sbjct  123  ENPDFYNWNKVFVRYCDGGGFTGDIESIDPATNLHFRGARIFDAVIEDLLA  173



>ref|XP_009590665.1| PREDICTED: uncharacterized protein LOC104087809 isoform X3 [Nicotiana 
tomentosiformis]
Length=339

 Score =   103 bits (256),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  66   GFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARK  245
             +FVD T VQ+A++KGAVCLDGSPPAYH DRG G G+ NW+I   GGAWC N+T CL R 
Sbjct  39   AYFVDTTIVQNALSKGAVCLDGSPPAYHLDRGFGHGVRNWIILLSGGAWCRNITDCLNRS  98

Query  246  DTRLGSSTKMV  278
             T LGSS  M 
Sbjct  99   KTDLGSSKHMT  109


 Score = 89.0 bits (219),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  320  RNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             NPDFY WN++ VRYCDG  FTGD+E+++P TNLHFRGAR+F AVIEDLLA
Sbjct  123  ENPDFYNWNKVFVRYCDGGGFTGDIESIDPATNLHFRGARIFDAVIEDLLA  173



>ref|XP_009590664.1| PREDICTED: uncharacterized protein LOC104087809 isoform X2 [Nicotiana 
tomentosiformis]
Length=375

 Score =   103 bits (257),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
              +FVD T VQ+A++KGAVCLDGSPPAYH DRG G G+ NW+I   GGAWC N+T CL R
Sbjct  38   HAYFVDTTIVQNALSKGAVCLDGSPPAYHLDRGFGHGVRNWIILLSGGAWCRNITDCLNR  97

Query  243  KDTRLGSSTKM  275
              T LGSS  M
Sbjct  98   SKTDLGSSKHM  108


 Score = 88.6 bits (218),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  320  RNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             NPDFY WN++ VRYCDG  FTGD+E+++P TNLHFRGAR+F AVIEDLLA
Sbjct  123  ENPDFYNWNKVFVRYCDGGGFTGDIESIDPATNLHFRGARIFDAVIEDLLA  173



>ref|XP_006365947.1| PREDICTED: uncharacterized protein LOC102601254 [Solanum tuberosum]
Length=401

 Score =   103 bits (256),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
              +FVD T VQ++V+KGAVCLDGSPPAYH DRG G G+ NW+I   GGAWC N T CL R
Sbjct  38   HAYFVDKTIVQNSVSKGAVCLDGSPPAYHLDRGFGHGLRNWIILLSGGAWCRNTTDCLNR  97

Query  243  KDTRLGSSTKMV  278
              T LGSST M+
Sbjct  98   SKTDLGSSTLML  109


 Score = 88.2 bits (217),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  320  RNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             NPDFY WN++ VRYCDG +FTGD+E V+P TNLHFRGAR+F A+IEDLLA
Sbjct  123  ENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDAIIEDLLA  173



>ref|XP_009589915.1| PREDICTED: uncharacterized protein LOC104087209 isoform X2 [Nicotiana 
tomentosiformis]
Length=399

 Score =   106 bits (265),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            VD+T ++SAV+KGAVCLDGSPPA+++D+G GEG NNW+I+F GG WC NV  CL R  T 
Sbjct  41   VDLTILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVIDCLNRTKTE  100

Query  255  LGSSTKMVKQVAFSGLLGNH  314
             GSS    KQ +F G+L N+
Sbjct  101  KGSSKLAPKQRSFYGILSNN  120


 Score = 84.7 bits (208),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+ V YCDG+SFTGDVE V+P TNLHFRGAR+F A+IE  LA
Sbjct  124  NPDFYNWNRVMVIYCDGASFTGDVEIVDPVTNLHFRGARIFHALIEHFLA  173



>ref|XP_009589914.1| PREDICTED: uncharacterized protein LOC104087209 isoform X1 [Nicotiana 
tomentosiformis]
Length=400

 Score =   106 bits (265),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            VD+T ++SAV+KGAVCLDGSPPA+++D+G GEG NNW+I+F GG WC NV  CL R  T 
Sbjct  42   VDLTILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVIDCLNRTKTE  101

Query  255  LGSSTKMVKQVAFSGLLGNH  314
             GSS    KQ +F G+L N+
Sbjct  102  KGSSKLAPKQRSFYGILSNN  121


 Score = 84.7 bits (208),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+ V YCDG+SFTGDVE V+P TNLHFRGAR+F A+IE  LA
Sbjct  125  NPDFYNWNRVMVIYCDGASFTGDVEIVDPVTNLHFRGARIFHALIEHFLA  174



>ref|NP_001053773.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAF15687.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAG93730.1| unnamed protein product [Oryza sativa Japonica Group]
Length=466

 Score = 97.8 bits (242),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            VD+ +++SAV+ GAVCLDGSPP YHF  GSG G NNWL+H EGG WC N   C  R+   
Sbjct  101  VDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECSVRQGNF  160

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS K ++ ++FSG++G
Sbjct  161  RGSS-KFMRPLSFSGIIG  177


 Score = 92.4 bits (228),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVE V   TNLHFRGARV+ A+IEDLLA
Sbjct  183  NPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNAIIEDLLA  232



>emb|CAD41867.2| OSJNBa0041A02.14 [Oryza sativa Japonica Group]
 emb|CAH67867.1| B0403H10-OSIGBa0105A11.19 [Oryza sativa Indica Group]
Length=396

 Score = 97.1 bits (240),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            VD+ +++SAV+ GAVCLDGSPP YHF  GSG G NNWL+H EGG WC N   C  R+   
Sbjct  31   VDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECSVRQGNF  90

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS K ++ ++FSG++G
Sbjct  91   RGSS-KFMRPLSFSGIIG  107


 Score = 92.4 bits (228),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGDVE V   TNLHFRGARV+ A+IEDLLA
Sbjct  113  NPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNAIIEDLLA  162



>ref|XP_009407790.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score = 99.8 bits (247),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L + +  L+ EG  V +T ++ AVA+GAVCLDGS PAY+   GSG G NNWL+  EGG W
Sbjct  49   LLYLLAFLQVEGDNVPMTVLKGAVAEGAVCLDGSAPAYNLAPGSGSGANNWLVFVEGGGW  108

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
            C+ V  CLARK+T  GSS  M  Q +FSG+LG
Sbjct  109  CSTVEECLARKNTFRGSSDHMPPQ-SFSGMLG  139


 Score = 89.0 bits (219),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
              NPDFY WNR+K+RYCDG+SFTGD+E V+P T LHFRGARV+ A+++DLLA
Sbjct  143  QSNPDFYNWNRVKIRYCDGASFTGDIEKVDPATGLHFRGARVWRAIMKDLLA  194



>ref|XP_006652763.1| PREDICTED: protein notum homolog [Oryza brachyantha]
Length=383

 Score =   100 bits (250),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            VD+ +++SAV+KGAVCLDGSPP YHF  GSG G NNWL+H EGG WC N   C  RK   
Sbjct  18   VDMVFLKSAVSKGAVCLDGSPPVYHFSPGSGPGANNWLVHMEGGGWCRNSQECSVRKGNF  77

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS K ++ ++FSG+LG
Sbjct  78   RGSS-KFMRPLSFSGILG  94


 Score = 87.4 bits (215),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+K+RYCDGSSFTGDVE V   TNLH+RGARV+ A+IE+LL+
Sbjct  100  NPDFYNWNRVKIRYCDGSSFTGDVETVETSTNLHYRGARVWNAIIEELLS  149



>ref|XP_004244682.2| PREDICTED: uncharacterized protein LOC101248898 [Solanum lycopersicum]
Length=390

 Score =   105 bits (261),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V++T ++SAV+KGAVCLDG+PPAY++++G GEG NNW+I+F GG WC NV  C+AR  T 
Sbjct  33   VNLTILESAVSKGAVCLDGTPPAYYYEKGYGEGANNWIIYFRGGEWCYNVIDCVARTTTE  92

Query  255  LGSSTKMVKQVAFSGLLGNH  314
             GSS   +KQ +F G+L N+
Sbjct  93   KGSSKYALKQRSFYGILSNN  112


 Score = 82.4 bits (202),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+ V YCDGSSFTGDVE V+P   LHFRGAR+F+A+IE+ L
Sbjct  116  NPDFYNWNRVMVIYCDGSSFTGDVELVDPINKLHFRGARIFLALIENFL  164



>gb|KJB25078.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
Length=433

 Score =   119 bits (297),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 74/123 (60%), Gaps = 36/123 (29%)
 Frame = +3

Query  45   MILLRTEGFFVDITYVQSAVAKGA------------------------------------  116
            +ILL++EG  V ITY+Q AVAKGA                                    
Sbjct  19   VILLKSEGASVGITYLQDAVAKGAGRDLFFFLSMFYYMFMYIIYLRHSFFSFFWFGWWCV  78

Query  117  VCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFS  296
            VCLDGSPPAYHFD+GSG G++NW++H EGG WC +V TCL+RK+T LGSS +MVKQ  FS
Sbjct  79   VCLDGSPPAYHFDKGSGAGVDNWIVHMEGGGWCEDVPTCLSRKNTDLGSSKQMVKQFGFS  138

Query  297  GLL  305
            GLL
Sbjct  139  GLL  141


 Score = 68.6 bits (166),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNRIKVRYCDGSSFTGD  AV+   NL F+G  ++  +I DLLA
Sbjct  148  NPDFYNWNRIKVRYCDGSSFTGD--AVDRANNLFFKGNSIWEFIIADLLA  195



>gb|EMS35701.1| hypothetical protein TRIUR3_33758 [Triticum urartu]
Length=146

 Score =   127 bits (319),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            +   VDITYV+SAVAKGAVCLDGSPPAYH   GSG G+N+WL+HFEGGAWCNN  TCL R
Sbjct  27   DDHLVDITYVESAVAKGAVCLDGSPPAYHLAPGSGSGVNSWLVHFEGGAWCNNAATCLQR  86

Query  243  KDTRLGSSTKMVKQVAFSGLLGN  311
              T LGSS +M ++VAF+G+L N
Sbjct  87   SRTPLGSSKEMARRVAFTGILSN  109


 Score = 60.1 bits (144),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  314  SHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPK  412
            S  NPDFY WNR+KVRYCDGSSFTGD E V+P+
Sbjct  111  SDYNPDFYNWNRVKVRYCDGSSFTGDKEEVDPR  143



>ref|XP_004246220.1| PREDICTED: uncharacterized protein LOC101249672 [Solanum lycopersicum]
Length=645

 Score =   104 bits (260),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +3

Query  63   EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  242
            + F+V+IT ++SA A+GAVCLDGSPPAYH  RG G G+ +W+IH +GG WC+++T CL R
Sbjct  273  DDFYVNITILESATAQGAVCLDGSPPAYHLHRGHGTGLGSWIIHLDGGGWCDSITDCLNR  332

Query  243  KDTRLGSSTKMVKQVAFSGLLGNHPIE  323
              T LGS+  M K+  F G+L N  I 
Sbjct  333  STTYLGSTKYMRKKGFFDGILHNTSIR  359


 Score = 82.4 bits (202),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  314  SHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDL  466
            S RNP+F+ WNR++V+YCDGSSFTGDVE V+ +  L+FRGAR+F A++EDL
Sbjct  357  SIRNPEFHNWNRVRVKYCDGSSFTGDVEQVDTENKLYFRGARIFKAIMEDL  407



>ref|XP_009763243.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana sylvestris]
Length=308

 Score =   101 bits (251),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            V   V + L         +  +V+ITY+++A+ KGAVCLDGS PA+HF  G+G GIN+WL
Sbjct  4    VMATVFFSLLCLWTTTEAKDLYVNITYLETAITKGAVCLDGSAPAFHFHPGTGSGINSWL  63

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            IH +GG WC   + CLAR  T L SS  M K   F+G+L + P
Sbjct  64   IHLQGGGWCETTSDCLARATTDL-SSKNMSKIAYFTGVLSSDP  105


 Score = 85.1 bits (209),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+K+RYCDGSS+ GD+E V+P TNLHFRGAR+F A++E  L 
Sbjct  108  NPDFYNWNRVKIRYCDGSSYIGDIEEVDPDTNLHFRGARIFEAIMEYFLG  157



>ref|XP_009763242.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=386

 Score =   100 bits (249),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  188
            V   V + L         +  +V+ITY+++A+ KGAVCLDGS PA+HF  G+G GIN+WL
Sbjct  4    VMATVFFSLLCLWTTTEAKDLYVNITYLETAITKGAVCLDGSAPAFHFHPGTGSGINSWL  63

Query  189  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHP  317
            IH +GG WC   + CLAR  T L SS  M K   F+G+L + P
Sbjct  64   IHLQGGGWCETTSDCLARATTDL-SSKNMSKIAYFTGVLSSDP  105


 Score = 85.1 bits (209),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            NPDFY WNR+K+RYCDGSS+ GD+E V+P TNLHFRGAR+F A++E  L 
Sbjct  108  NPDFYNWNRVKIRYCDGSSYIGDIEEVDPDTNLHFRGARIFEAIMEYFLG  157



>ref|XP_010240371.1| PREDICTED: uncharacterized protein LOC100827238 isoform X1 [Brachypodium 
distachyon]
Length=404

 Score = 97.4 bits (241),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V++ +++SAVAKGAVCLDGSPP YHF  GSG G NNW++H EGG WC     C  RK   
Sbjct  40   VEMVFLKSAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTSEECSIRKGNF  99

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS K +K ++FSG+LG
Sbjct  100  RGSS-KYMKPLSFSGILG  116


 Score = 87.8 bits (216),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+KVRYCDGSSFTGDVEAV   TNLH+RG RV+ A+I+DLL
Sbjct  122  NPDFYNWNRVKVRYCDGSSFTGDVEAVETSTNLHYRGNRVWQAIIQDLL  170



>ref|XP_003580427.1| PREDICTED: uncharacterized protein LOC100827238 isoform X2 [Brachypodium 
distachyon]
Length=391

 Score = 97.1 bits (240),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V++ +++SAVAKGAVCLDGSPP YHF  GSG G NNW++H EGG WC     C  RK   
Sbjct  27   VEMVFLKSAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTSEECSIRKGNF  86

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS K +K ++FSG+LG
Sbjct  87   RGSS-KYMKPLSFSGILG  103


 Score = 87.8 bits (216),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+KVRYCDGSSFTGDVEAV   TNLH+RG RV+ A+I+DLL
Sbjct  109  NPDFYNWNRVKVRYCDGSSFTGDVEAVETSTNLHYRGNRVWQAIIQDLL  157



>gb|ADE77373.1| unknown [Picea sitchensis]
Length=411

 Score = 97.1 bits (240),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = +3

Query  69   FFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKD  248
              V+IT + +AV KGAVCLDGSPPAYH  RG G G N WL+H EGG WC ++ +C  R  
Sbjct  45   LLVNITVLNNAVFKGAVCLDGSPPAYHLHRGFGSGANRWLVHMEGGGWCYDMLSCSGRAA  104

Query  249  TRLGSSTKMVKQVAFSGLLGNHPIEIRTSTP  341
            + LGSS  M   +AF+G+L     ++R+  P
Sbjct  105  SPLGSSLYMGDTIAFTGILS----DVRSQNP  131


 Score = 87.4 bits (215),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  320  RNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            +NPDFY+WNR+ VRYCDGSSFTGDVE V+P T +HFRG R++ AV+EDLLA
Sbjct  129  QNPDFYSWNRVMVRYCDGSSFTGDVEEVDPITKVHFRGQRIWQAVMEDLLA  179



>ref|XP_006367726.1| PREDICTED: uncharacterized protein LOC102600035, partial [Solanum 
tuberosum]
Length=377

 Score =   102 bits (254),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +3

Query  48   ILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVT  227
            +L   +  +++IT +QSA A+GAVCLDGSPPAYH DRG G G+++W+I+ +GG WC+++ 
Sbjct  18   VLGAEDDLYINITILQSATAQGAVCLDGSPPAYHLDRGHGSGVSSWIIYLDGGGWCDSIP  77

Query  228  TCLARKDTRLGSSTKMVKQVAFSGLLGN  311
             CL R    LGS+ +M +Q  F+ LL N
Sbjct  78   DCLDRSTKALGSTKQMKQQGFFAALLHN  105


 Score = 82.0 bits (201),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  314  SHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDL  466
            S +NP FY WNR++V+YCDGSSFTGDVE V+P+  L FRGAR+F A+++DL
Sbjct  107  SKQNPQFYNWNRVRVKYCDGSSFTGDVEQVDPENKLFFRGARIFKAIMKDL  157



>dbj|BAJ97261.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00807.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score = 95.1 bits (235),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +3

Query  81   ITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLG  260
            + +V+SAVAKGAVCLDGSPP YHF  GSG G +NW++H EGG WC     C  RK    G
Sbjct  31   MVFVKSAVAKGAVCLDGSPPVYHFSPGSGSGADNWVVHMEGGGWCKTPEECAVRKGNFRG  90

Query  261  SSTKMVKQVAFSGLLG  308
            SS K +K ++FSG+LG
Sbjct  91   SS-KYMKPLSFSGILG  105


 Score = 89.0 bits (219),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+KVRYCDGSSFTGDVE V+  TNLH+RGARV+ A+IEDLL
Sbjct  111  NPDFYNWNRVKVRYCDGSSFTGDVEEVDSSTNLHYRGARVWDAIIEDLL  159



>ref|XP_004246219.1| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=390

 Score =   100 bits (250),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  236
            + +  +V+IT +QSA A+GAVCLDGSPPAYH  RG G G  +W+I+ EGG+WC ++  CL
Sbjct  24   KDDFLYVNITILQSATAQGAVCLDGSPPAYHLHRGYGTGFRSWIIYLEGGSWCESIPDCL  83

Query  237  ARKDTRLGSSTKMVKQVAFSGLLGN  311
             R  T LGSS  M +   F+G+L N
Sbjct  84   DRSTTSLGSSNHMKQHDFFAGVLHN  108


 Score = 83.2 bits (204),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  314  SHRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDL  466
            S +NPDF+ WNR+KV+YCDGSSFT DVE V+P+  L+FRGAR+F A++EDL
Sbjct  110  SKQNPDFHNWNRVKVKYCDGSSFTSDVEQVHPENKLYFRGARIFKAIMEDL  160



>ref|XP_009408703.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=398

 Score = 95.1 bits (235),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L + +  L+ EG  V +T ++SAVA+GAVCLDGSP AY+   GSG G NNWL+  EGG W
Sbjct  16   LLYLLAFLQVEGDNVPMTLLKSAVAEGAVCLDGSPAAYNLAPGSGSGANNWLLFVEGGGW  75

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
            C+ V  C+ RK    GSS  M   V+FSG+LG
Sbjct  76   CSTVNDCVERKGNFRGSSNHM-PPVSFSGMLG  106


 Score = 88.2 bits (217),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             RNPDFY WNR+K+RYCDG+SFTGD+E V+P T L+FRGARV+ A+++DLLA
Sbjct  110  ERNPDFYNWNRVKIRYCDGASFTGDIEKVDPATGLYFRGARVWRAIMKDLLA  161



>tpg|DAA36176.1| TPA: pectinacetylesterase [Zea mays]
Length=519

 Score = 99.4 bits (246),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  254
            V++ ++++AVAKGAVCLDGSPP YHF  GSG G NNW++H EGG WC N   C  RK   
Sbjct  155  VEMVFLKAAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCRNPDECAVRKGNF  214

Query  255  LGSSTKMVKQVAFSGLLG  308
             GSS K +K ++FSG+LG
Sbjct  215  RGSS-KFMKPLSFSGILG  231


 Score = 83.2 bits (204),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  323  NPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLL  469
            NPDFY WNR+K+RYCDGSSFTGDVEAV+   +L +RG RV+ AVI+DLL
Sbjct  237  NPDFYNWNRVKIRYCDGSSFTGDVEAVDTAKDLRYRGFRVWRAVIDDLL  285



>ref|XP_004495819.1| PREDICTED: uncharacterized protein LOC101503835 isoform X1 [Cicer 
arietinum]
Length=384

 Score =   113 bits (283),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +3

Query  51   LLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTT  230
            L+ T    V IT + SA AKGAVCLDG+ PAYHFDRG G G NNWL++ EGG WCNN+ T
Sbjct  43   LVATNPHMVGITIIHSAAAKGAVCLDGTLPAYHFDRGHGSGANNWLVNLEGGGWCNNIRT  102

Query  231  CLARKDTRLGSSTKMVKQVAFSGLLGNH  314
            C+ RK +R GSS  M K +AF+G+L N+
Sbjct  103  CVYRKTSRHGSSKLMEKAIAFTGILSNN  130


 Score = 68.9 bits (167),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 2/52 (4%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
            H NPDF+ WNR+K+RYCDG+SFTGD +  +    L FRG R+++A +E+L++
Sbjct  132  HENPDFFNWNRVKIRYCDGASFTGDSK--HKAAQLQFRGQRIWLAAMEELMS  181



>ref|XP_009407792.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score = 93.6 bits (231),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = +3

Query  33   LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  212
            L + +  L+ EG  V +T ++ AVA+GAVCLDGSP AY+   GSG G NNWL+  EGG W
Sbjct  49   LLYLLAFLQVEGDNVPMTLLKGAVAEGAVCLDGSPAAYNLAPGSGSGANNWLLFVEGGGW  108

Query  213  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLG  308
            C+ V  C+ RK    GSS  M   V+FSG+LG
Sbjct  109  CSTVNDCVVRKGNFRGSSNHM-PPVSFSGMLG  139


 Score = 88.6 bits (218),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
             RNPDFY WNR+K+RYCDG+SFTGD+E V+P T L+FRGARV+ A+++DLLA
Sbjct  143  QRNPDFYNWNRVKIRYCDGASFTGDIEKVDPATGLYFRGARVWRAIMKDLLA  194



>ref|XP_010914804.1| PREDICTED: protein notum homolog isoform X2 [Elaeis guineensis]
Length=380

 Score =   112 bits (279),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +3

Query  60   TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  239
            T    VD+T +QSA  KGAVCLDG+P AYH   GSG G NNWL+  EGG WCN++ +C++
Sbjct  32   TPPLLVDLTLIQSAKEKGAVCLDGTPGAYHLHPGSGSGENNWLLELEGGGWCNDIGSCVS  91

Query  240  RKDTRLGSSTKMVKQVAFSGLLGNHPIE  323
            RK TR GSS  M KQ+ F+GLL N P E
Sbjct  92   RKTTRRGSSHYMRKQILFTGLLSNKPEE  119


 Score = 69.7 bits (169),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  317  HRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVAVIEDLLA  472
              NPDFY WNR+++RYCDG+SF G  E  N    L+FRG R+F A +EDL++
Sbjct  118  EENPDFYNWNRVRIRYCDGASFAG--EGYNEAAGLYFRGQRIFSAAMEDLMS  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180