BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H12

Length=496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619802.1|  PREDICTED: pentatricopeptide repeat-containi...    196   8e-56   
ref|XP_009619801.1|  PREDICTED: pentatricopeptide repeat-containi...    197   1e-55   Nicotiana tomentosiformis
ref|XP_009777647.1|  PREDICTED: pentatricopeptide repeat-containi...    194   4e-55   Nicotiana sylvestris
ref|XP_009777644.1|  PREDICTED: pentatricopeptide repeat-containi...    194   9e-55   Nicotiana sylvestris
ref|XP_009777646.1|  PREDICTED: pentatricopeptide repeat-containi...    194   1e-54   Nicotiana sylvestris
emb|CDP14603.1|  unnamed protein product                                191   3e-53   Coffea canephora [robusta coffee]
ref|XP_010320451.1|  PREDICTED: pentatricopeptide repeat-containi...    187   3e-52   
ref|XP_006342118.1|  PREDICTED: pentatricopeptide repeat-containi...    187   3e-52   Solanum tuberosum [potatoes]
ref|XP_006342120.1|  PREDICTED: pentatricopeptide repeat-containi...    187   3e-52   Solanum tuberosum [potatoes]
ref|XP_004238420.1|  PREDICTED: pentatricopeptide repeat-containi...    187   4e-52   Solanum lycopersicum
ref|XP_006342119.1|  PREDICTED: pentatricopeptide repeat-containi...    187   4e-52   Solanum tuberosum [potatoes]
ref|XP_008231287.1|  PREDICTED: pentatricopeptide repeat-containi...    181   6e-51   Prunus mume [ume]
ref|XP_008231288.1|  PREDICTED: pentatricopeptide repeat-containi...    181   3e-50   Prunus mume [ume]
gb|ADI58371.1|  pentatricopeptide repeat-containing protein             182   3e-50   Capsicum annuum
ref|XP_010664084.1|  PREDICTED: pentatricopeptide repeat-containi...    181   4e-50   Vitis vinifera
emb|CBI18867.3|  unnamed protein product                                181   5e-50   Vitis vinifera
ref|XP_010664079.1|  PREDICTED: pentatricopeptide repeat-containi...    181   7e-50   Vitis vinifera
ref|XP_010664082.1|  PREDICTED: pentatricopeptide repeat-containi...    181   7e-50   Vitis vinifera
ref|XP_010664080.1|  PREDICTED: pentatricopeptide repeat-containi...    181   8e-50   Vitis vinifera
ref|XP_010664081.1|  PREDICTED: pentatricopeptide repeat-containi...    181   8e-50   Vitis vinifera
ref|XP_010664083.1|  PREDICTED: pentatricopeptide repeat-containi...    181   8e-50   Vitis vinifera
ref|XP_008231248.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    179   2e-49   
ref|XP_007018003.1|  Tetratricopeptide repeat (TPR)-like superfam...    173   2e-47   
ref|XP_007219492.1|  hypothetical protein PRUPE_ppa022231mg             174   2e-47   
ref|XP_007018002.1|  Tetratricopeptide repeat (TPR)-like superfam...    173   6e-47   
ref|XP_008377070.1|  PREDICTED: pentatricopeptide repeat-containi...    173   7e-47   Malus domestica [apple tree]
ref|XP_008377069.1|  PREDICTED: pentatricopeptide repeat-containi...    173   7e-47   Malus domestica [apple tree]
ref|XP_006421239.1|  hypothetical protein CICLE_v10004328mg             169   2e-46   
ref|XP_006421240.1|  hypothetical protein CICLE_v10004328mg             169   1e-45   
ref|XP_006421241.1|  hypothetical protein CICLE_v10004328mg             169   1e-45   
ref|XP_006421242.1|  hypothetical protein CICLE_v10004328mg             169   2e-45   
gb|KDO43134.1|  hypothetical protein CISIN_1g004279mg                   168   3e-45   Citrus sinensis [apfelsine]
gb|EYU36636.1|  hypothetical protein MIMGU_mgv1a001743mg                167   4e-45   Erythranthe guttata [common monkey flower]
ref|XP_010692813.1|  PREDICTED: pentatricopeptide repeat-containi...    168   5e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010692815.1|  PREDICTED: pentatricopeptide repeat-containi...    167   6e-45   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB14290.1|  hypothetical protein B456_002G118000                    165   1e-44   Gossypium raimondii
ref|XP_006491555.1|  PREDICTED: pentatricopeptide repeat-containi...    167   1e-44   
gb|KJB14288.1|  hypothetical protein B456_002G118000                    165   1e-44   Gossypium raimondii
ref|XP_010266133.1|  PREDICTED: pentatricopeptide repeat-containi...    165   2e-44   Nelumbo nucifera [Indian lotus]
gb|KJB14289.1|  hypothetical protein B456_002G118000                    165   3e-44   Gossypium raimondii
gb|KJB14291.1|  hypothetical protein B456_002G118000                    165   3e-44   Gossypium raimondii
gb|KJB14287.1|  hypothetical protein B456_002G118000                    165   4e-44   Gossypium raimondii
ref|XP_010266132.1|  PREDICTED: pentatricopeptide repeat-containi...    165   5e-44   Nelumbo nucifera [Indian lotus]
gb|KHF99794.1|  hypothetical protein F383_16904                         161   2e-42   Gossypium arboreum [tree cotton]
ref|XP_011074015.1|  PREDICTED: pentatricopeptide repeat-containi...    158   1e-41   
ref|XP_011074014.1|  PREDICTED: pentatricopeptide repeat-containi...    157   2e-41   Sesamum indicum [beniseed]
ref|XP_007160600.1|  hypothetical protein PHAVU_001G001200g             154   2e-40   Phaseolus vulgaris [French bean]
ref|XP_007160601.1|  hypothetical protein PHAVU_001G001200g             154   3e-40   Phaseolus vulgaris [French bean]
ref|XP_010539797.1|  PREDICTED: pentatricopeptide repeat-containi...    152   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_010539796.1|  PREDICTED: pentatricopeptide repeat-containi...    152   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_010539795.1|  PREDICTED: pentatricopeptide repeat-containi...    152   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_010539794.1|  PREDICTED: pentatricopeptide repeat-containi...    152   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_010539793.1|  PREDICTED: pentatricopeptide repeat-containi...    152   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_002527312.1|  pentatricopeptide repeat-containing protein,...    151   3e-39   
ref|XP_004512612.1|  PREDICTED: pentatricopeptide repeat-containi...    151   6e-39   Cicer arietinum [garbanzo]
ref|XP_009126324.1|  PREDICTED: pentatricopeptide repeat-containi...    146   7e-39   Brassica rapa
ref|XP_004512611.1|  PREDICTED: pentatricopeptide repeat-containi...    150   8e-39   
ref|XP_008804417.1|  PREDICTED: pentatricopeptide repeat-containi...    150   9e-39   
gb|AES76046.2|  PPR containing plant-like protein                       150   9e-39   Medicago truncatula
gb|KEH26674.1|  PPR containing plant-like protein                       150   1e-38   Medicago truncatula
gb|KEH26673.1|  PPR containing plant-like protein                       150   1e-38   Medicago truncatula
ref|XP_008804413.1|  PREDICTED: pentatricopeptide repeat-containi...    148   6e-38   
ref|XP_006596521.1|  PREDICTED: pentatricopeptide repeat-containi...    147   9e-38   Glycine max [soybeans]
ref|XP_006596520.1|  PREDICTED: pentatricopeptide repeat-containi...    147   2e-37   
ref|XP_006390215.1|  hypothetical protein EUTSA_v10018138mg             147   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_006596519.1|  PREDICTED: pentatricopeptide repeat-containi...    146   2e-37   Glycine max [soybeans]
ref|XP_004292914.1|  PREDICTED: pentatricopeptide repeat-containi...    146   3e-37   Fragaria vesca subsp. vesca
gb|KDP41990.1|  hypothetical protein JCGZ_27008                         146   4e-37   Jatropha curcas
emb|CDX87621.1|  BnaA07g32520D                                          145   4e-37   
ref|XP_009106285.1|  PREDICTED: pentatricopeptide repeat-containi...    145   5e-37   Brassica rapa
ref|XP_011034528.1|  PREDICTED: pentatricopeptide repeat-containi...    144   8e-37   Populus euphratica
ref|XP_011034514.1|  PREDICTED: pentatricopeptide repeat-containi...    145   1e-36   Populus euphratica
emb|CDX73251.1|  BnaC06g36990D                                          144   1e-36   
ref|XP_010905784.1|  PREDICTED: pentatricopeptide repeat-containi...    144   2e-36   
ref|XP_010905783.1|  PREDICTED: pentatricopeptide repeat-containi...    144   2e-36   
ref|XP_010905782.1|  PREDICTED: pentatricopeptide repeat-containi...    144   3e-36   Elaeis guineensis
ref|XP_006302008.1|  hypothetical protein CARUB_v10019985mg             142   3e-36   
ref|XP_002299265.2|  pentatricopeptide repeat-containing family p...    142   5e-36   
ref|XP_009419232.1|  PREDICTED: pentatricopeptide repeat-containi...    142   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006844144.1|  hypothetical protein AMTR_s00006p00259530          142   1e-35   
ref|XP_009419231.1|  PREDICTED: pentatricopeptide repeat-containi...    142   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010471778.1|  PREDICTED: pentatricopeptide repeat-containi...    141   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010416540.1|  PREDICTED: pentatricopeptide repeat-containi...    140   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009419229.1|  PREDICTED: pentatricopeptide repeat-containi...    141   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419230.1|  PREDICTED: pentatricopeptide repeat-containi...    141   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010471777.1|  PREDICTED: pentatricopeptide repeat-containi...    141   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010416539.1|  PREDICTED: pentatricopeptide repeat-containi...    140   5e-35   Camelina sativa [gold-of-pleasure]
ref|NP_001031285.4|  pentatricopeptide repeat-containing protein        139   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177755.3|  pentatricopeptide repeat-containing protein           139   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAF17637.1|AC009978_13  T23E18.21                                    139   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185409.1|  pentatricopeptide repeat-containing protein        139   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003580982.2|  PREDICTED: pentatricopeptide repeat-containi...    136   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_009419233.1|  PREDICTED: pentatricopeptide repeat-containi...    134   6e-33   
ref|XP_003619828.1|  Pentatricopeptide repeat-containing protein        134   1e-32   
ref|XP_008461449.1|  PREDICTED: pentatricopeptide repeat-containi...    133   1e-32   Cucumis melo [Oriental melon]
ref|XP_008461447.1|  PREDICTED: pentatricopeptide repeat-containi...    133   1e-32   Cucumis melo [Oriental melon]
ref|XP_008461448.1|  PREDICTED: pentatricopeptide repeat-containi...    132   1e-32   Cucumis melo [Oriental melon]
ref|XP_004161905.1|  PREDICTED: pentatricopeptide repeat-containi...    133   2e-32   
ref|XP_004139754.1|  PREDICTED: pentatricopeptide repeat-containi...    133   2e-32   
ref|XP_010428682.1|  PREDICTED: pentatricopeptide repeat-containi...    131   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010428681.1|  PREDICTED: pentatricopeptide repeat-containi...    131   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002889073.1|  pentatricopeptide repeat-containing protein        129   3e-31   
ref|XP_006660737.1|  PREDICTED: pentatricopeptide repeat-containi...    129   3e-31   
gb|KFK42046.1|  hypothetical protein AALP_AA2G204700                    125   9e-30   Arabis alpina [alpine rockcress]
ref|XP_010094576.1|  hypothetical protein L484_024872                   122   6e-29   
gb|EEC84742.1|  hypothetical protein OsI_31738                          120   3e-28   Oryza sativa Indica Group [Indian rice]
gb|EAZ45091.1|  hypothetical protein OsJ_29730                          120   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957099.1|  PREDICTED: pentatricopeptide repeat-containi...    119   1e-27   
ref|XP_008652830.1|  PREDICTED: pentatricopeptide repeat-containi...    115   2e-26   Zea mays [maize]
ref|XP_002462526.1|  hypothetical protein SORBIDRAFT_02g027390          115   2e-26   
ref|XP_008652828.1|  PREDICTED: pentatricopeptide repeat-containi...    114   4e-26   Zea mays [maize]
ref|XP_008652825.1|  PREDICTED: pentatricopeptide repeat-containi...    115   4e-26   Zea mays [maize]
ref|XP_008652826.1|  PREDICTED: pentatricopeptide repeat-containi...    115   4e-26   Zea mays [maize]
gb|EMT23079.1|  hypothetical protein F775_02463                         109   3e-24   
gb|KHN12600.1|  Pentatricopeptide repeat-containing protein             108   5e-24   Glycine soja [wild soybean]
ref|XP_010061152.1|  PREDICTED: pentatricopeptide repeat-containi...    102   4e-22   
ref|XP_008804416.1|  PREDICTED: pentatricopeptide repeat-containi...  92.0    4e-18   
ref|XP_008652827.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    2e-15   Zea mays [maize]
gb|KGN44445.1|  hypothetical protein Csa_7G291160                     63.2    2e-12   Cucumis sativus [cucumbers]
gb|KEH26675.1|  PPR containing plant-like protein                     72.4    1e-11   Medicago truncatula
gb|KEH40253.1|  PPR containing plant-like protein                     68.2    9e-11   Medicago truncatula
ref|XP_010692816.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    1e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002983366.1|  hypothetical protein SELMODRAFT_445481           64.7    4e-09   Selaginella moellendorffii
gb|KHN12591.1|  Pentatricopeptide repeat-containing protein           58.9    1e-07   Glycine soja [wild soybean]
ref|XP_001759922.1|  predicted protein                                53.9    2e-05   



>ref|XP_009619802.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Nicotiana tomentosiformis]
Length=654

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 115/151 (76%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  LM+IM +NP+ +  LP+YN  L AC + H + Y N+C+ LM+HQMVGK
Sbjct  134  GYLKE----ALSLMSIMEENPNSYSMLPVYNNFLVACSETHTVDYANECMGLMEHQMVGK  189

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY QLLKLAV QQNL AVHEIWKEC+K+Y  S+I LRKFIWSF++LRD++SAY TLQ
Sbjct  190  NEITYAQLLKLAVLQQNLSAVHEIWKECSKYYSLSVISLRKFIWSFAELRDLQSAYTTLQ  249

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +V +    +S+TAEG+  +LRLDIPAP
Sbjct  250  HMVSLVIRENSYISRTAEGRFCDLRLDIPAP  280



>ref|XP_009619801.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Nicotiana tomentosiformis]
Length=799

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 115/151 (76%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  LM+IM +NP+ +  LP+YN  L AC + H + Y N+C+ LM+HQMVGK
Sbjct  134  GYLKE----ALSLMSIMEENPNSYSMLPVYNNFLVACSETHTVDYANECMGLMEHQMVGK  189

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY QLLKLAV QQNL AVHEIWKEC+K+Y  S+I LRKFIWSF++LRD++SAY TLQ
Sbjct  190  NEITYAQLLKLAVLQQNLSAVHEIWKECSKYYSLSVISLRKFIWSFAELRDLQSAYTTLQ  249

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +V +    +S+TAEG+  +LRLDIPAP
Sbjct  250  HMVSLVIRENSYISRTAEGRFCDLRLDIPAP  280



>ref|XP_009777647.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X3 [Nicotiana sylvestris]
Length=659

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 114/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  LM+IM +NP+ +  LP+YN  L AC + H + Y N+C+ LM+HQMVGK
Sbjct  139  GYLKE----ALSLMSIMEENPNSYSMLPVYNNFLVACSETHTVDYANECMRLMEHQMVGK  194

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY Q LKLAV QQNL AVHEIWKEC+K+Y  S+I LRKFIWSF++LRD++SAY TLQ
Sbjct  195  NEITYAQFLKLAVLQQNLSAVHEIWKECSKYYSLSVISLRKFIWSFTELRDLQSAYTTLQ  254

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +V +    +S+TAEG+  +LRLDIPAP
Sbjct  255  HMVSLVVRENSYISRTAEGRFCDLRLDIPAP  285



>ref|XP_009777644.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Nicotiana sylvestris]
Length=809

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 114/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  LM+IM +NP+ +  LP+YN  L AC + H + Y N+C+ LM+HQMVGK
Sbjct  139  GYLKE----ALSLMSIMEENPNSYSMLPVYNNFLVACSETHTVDYANECMRLMEHQMVGK  194

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY Q LKLAV QQNL AVHEIWKEC+K+Y  S+I LRKFIWSF++LRD++SAY TLQ
Sbjct  195  NEITYAQFLKLAVLQQNLSAVHEIWKECSKYYSLSVISLRKFIWSFTELRDLQSAYTTLQ  254

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +V +    +S+TAEG+  +LRLDIPAP
Sbjct  255  HMVSLVVRENSYISRTAEGRFCDLRLDIPAP  285



>ref|XP_009777646.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Nicotiana sylvestris]
Length=804

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 114/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  LM+IM +NP+ +  LP+YN  L AC + H + Y N+C+ LM+HQMVGK
Sbjct  134  GYLKE----ALSLMSIMEENPNSYSMLPVYNNFLVACSETHTVDYANECMRLMEHQMVGK  189

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY Q LKLAV QQNL AVHEIWKEC+K+Y  S+I LRKFIWSF++LRD++SAY TLQ
Sbjct  190  NEITYAQFLKLAVLQQNLSAVHEIWKECSKYYSLSVISLRKFIWSFTELRDLQSAYTTLQ  249

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +V +    +S+TAEG+  +LRLDIPAP
Sbjct  250  HMVSLVVRENSYISRTAEGRFCDLRLDIPAP  280



>emb|CDP14603.1| unnamed protein product [Coffea canephora]
Length=826

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 114/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF LM ++R+NP+++  LP+YN    ACVQ  +++Y N CL+LM+HQ VG 
Sbjct  139  GYLKE----AFNLMGLLRENPAMYPLLPLYNSFFSACVQNESVNYANNCLELMEHQTVGN  194

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY  LLKLAV  QNLPAVHEIWKE  K+Y  +II LRKFIWSF++LRD+ESAY+TLQ
Sbjct  195  NEITYALLLKLAVLHQNLPAVHEIWKESIKYYSLNIISLRKFIWSFTRLRDLESAYVTLQ  254

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV M F+G  ++ KTAEGK+ + RLDIP P
Sbjct  255  YMVRMAFRGNSVIFKTAEGKLSDSRLDIPIP  285



>ref|XP_010320451.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Solanum lycopersicum]
Length=696

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  LM+IM +N + +  LPIYN  L AC +   I Y N+C+DLM+HQMVGK
Sbjct  33   GYLKE----ALSLMSIMAENTNCYSMLPIYNNFLAACYETQTIDYANECMDLMEHQMVGK  88

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY QLLKLAV QQNL AVHEIWKEC+K Y  S++ LRKFIWSF++LRD+ SA+  LQ
Sbjct  89   NEITYAQLLKLAVLQQNLSAVHEIWKECSKFYSLSLLSLRKFIWSFTELRDLNSAHTALQ  148

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV + F     +S+TAEG+  +LRLDIPAP
Sbjct  149  HMVRLAFTENSYISRTAEGRFCDLRLDIPAP  179



>ref|XP_006342118.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X1 [Solanum tuberosum]
Length=806

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  LM+IM +N + +  LPIYN  L AC +   + Y N+C+DLM+HQMVGK
Sbjct  136  GYLKE----ALSLMSIMGENTNCYSMLPIYNNFLAACYETQTVDYANECMDLMEHQMVGK  191

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY QLLKLAV QQNL AVHEIWKEC+K Y  S++ LRKFIWSF++LRD+ SA+  LQ
Sbjct  192  NEITYAQLLKLAVLQQNLSAVHEIWKECSKFYSLSLLSLRKFIWSFTELRDLTSAHTALQ  251

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV + F+    +S+TAEG+  +LRLDIPAP
Sbjct  252  HMVRLAFRENSYISRTAEGRFCDLRLDIPAP  282



>ref|XP_006342120.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X3 [Solanum tuberosum]
Length=683

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A  LM+IM +N + +  LPIYN  L AC +   + Y N+C+DLM+HQMVGKNEITY QLL
Sbjct  18   ALSLMSIMGENTNCYSMLPIYNNFLAACYETQTVDYANECMDLMEHQMVGKNEITYAQLL  77

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV QQNL AVHEIWKEC+K Y  S++ LRKFIWSF++LRD+ SA+  LQ MV + F+ 
Sbjct  78   KLAVLQQNLSAVHEIWKECSKFYSLSLLSLRKFIWSFTELRDLTSAHTALQHMVRLAFRE  137

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               +S+TAEG+  +LRLDIPAP
Sbjct  138  NSYISRTAEGRFCDLRLDIPAP  159



>ref|XP_004238420.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Solanum lycopersicum]
Length=799

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  LM+IM +N + +  LPIYN  L AC +   I Y N+C+DLM+HQMVGK
Sbjct  136  GYLKE----ALSLMSIMAENTNCYSMLPIYNNFLAACYETQTIDYANECMDLMEHQMVGK  191

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY QLLKLAV QQNL AVHEIWKEC+K Y  S++ LRKFIWSF++LRD+ SA+  LQ
Sbjct  192  NEITYAQLLKLAVLQQNLSAVHEIWKECSKFYSLSLLSLRKFIWSFTELRDLNSAHTALQ  251

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV + F     +S+TAEG+  +LRLDIPAP
Sbjct  252  HMVRLAFTENSYISRTAEGRFCDLRLDIPAP  282



>ref|XP_006342119.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X2 [Solanum tuberosum]
Length=770

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A  LM+IM +N + +  LPIYN  L AC +   + Y N+C+DLM+HQMVGKNEITY QLL
Sbjct  105  ALSLMSIMGENTNCYSMLPIYNNFLAACYETQTVDYANECMDLMEHQMVGKNEITYAQLL  164

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV QQNL AVHEIWKEC+K Y  S++ LRKFIWSF++LRD+ SA+  LQ MV + F+ 
Sbjct  165  KLAVLQQNLSAVHEIWKECSKFYSLSLLSLRKFIWSFTELRDLTSAHTALQHMVRLAFRE  224

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
               +S+TAEG+  +LRLDIPAP  
Sbjct  225  NSYISRTAEGRFCDLRLDIPAPSS  248



>ref|XP_008231287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X1 [Prunus mume]
Length=473

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 113/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF+L+N + ++P ++  LPIYN  L AC +M +I   NQCLDLM+HQMVGK
Sbjct  141  GYLEE----AFKLINFLGESPGIYPVLPIYNSFLRACAKMQSIKNANQCLDLMEHQMVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV+QQNLPA HEIWK+  KHY  SII LRKFIWSF++L D++SAY  LQ
Sbjct  197  NEVTYSELLKLAVWQQNLPAAHEIWKDYIKHYSLSIIPLRKFIWSFTRLGDLKSAYEKLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +  +G   ++KT+EGK+ + RLDIP P
Sbjct  257  YMVTLAIRGNTYVNKTSEGKLYSPRLDIPIP  287



>ref|XP_008231288.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X2 [Prunus mume]
Length=661

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 113/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF+L+N + ++P ++  LPIYN  L AC +M +I   NQCLDLM+HQMVGK
Sbjct  141  GYLEE----AFKLINFLGESPGIYPVLPIYNSFLRACAKMQSIKNANQCLDLMEHQMVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV+QQNLPA HEIWK+  KHY  SII LRKFIWSF++L D++SAY  LQ
Sbjct  197  NEVTYSELLKLAVWQQNLPAAHEIWKDYIKHYSLSIIPLRKFIWSFTRLGDLKSAYEKLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +  +G   ++KT+EGK+ + RLDIP P
Sbjct  257  YMVTLAIRGNTYVNKTSEGKLYSPRLDIPIP  287



>gb|ADI58371.1| pentatricopeptide repeat-containing protein [Capsicum annuum]
Length=805

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 111/151 (74%), Gaps = 5/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  LMNIM +N + +  LPIYN  L AC +  ++ Y ++C+DLM+HQMVGK
Sbjct  136  GYLKE----ALSLMNIMGENLNCYSMLPIYNNFLAACYETQSVDYASKCMDLMEHQMVGK  191

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY QLLKLAV QQNL AVHEIWKEC K Y  SII LRKFIWSF++L D+ESAY  LQ
Sbjct  192  NEITYAQLLKLAVLQQNLSAVHEIWKECIKFYSLSIISLRKFIWSFTELGDLESAYTALQ  251

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV + F+    +S+TAEG+  ++RLDIPAP
Sbjct  252  HMVRLAFR-DCDISRTAEGRFCDVRLDIPAP  281



>ref|XP_010664084.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X6 [Vitis vinifera]
Length=722

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  10   LFSYPGTMQGWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLD  189
            + S     +G  LE    AF L+N + +N  +H  LP+YN  L  CVQ  ++ + NQCLD
Sbjct  135  MLSIQALCKGGYLE---EAFNLLNFVGENHDIHPILPMYNNFLRGCVQTRSLLHANQCLD  191

Query  190  LMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRD  369
            LM+HQ++GKNE+TY Q LKLAV QQNL A H+IWKE   +Y  SII LRKFIWSF++LRD
Sbjct  192  LMEHQVLGKNEVTYSQFLKLAVLQQNLSAAHKIWKEYMTYYSMSIISLRKFIWSFTRLRD  251

Query  370  MESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +ESAY  LQ MVD+VF+G   ++K+AEG++ + RLDIP P
Sbjct  252  LESAYAALQHMVDLVFKGSIFINKSAEGRLCSSRLDIPIP  291



>emb|CBI18867.3| unnamed protein product [Vitis vinifera]
Length=804

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  10   LFSYPGTMQGWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLD  189
            + S     +G  LE    AF L+N + +N  +H  LP+YN  L  CVQ  ++ + NQCLD
Sbjct  131  MLSIQALCKGGYLE---EAFNLLNFVGENHDIHPILPMYNNFLRGCVQTRSLLHANQCLD  187

Query  190  LMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRD  369
            LM+HQ++GKNE+TY Q LKLAV QQNL A H+IWKE   +Y  SII LRKFIWSF++LRD
Sbjct  188  LMEHQVLGKNEVTYSQFLKLAVLQQNLSAAHKIWKEYMTYYSMSIISLRKFIWSFTRLRD  247

Query  370  MESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +ESAY  LQ MVD+VF+G   ++K+AEG++ + RLDIP P
Sbjct  248  LESAYAALQHMVDLVFKGSIFINKSAEGRLCSSRLDIPIP  287



>ref|XP_010664079.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Vitis vinifera]
Length=836

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF L+N + +N  +H  LP+YN  L  CVQ  ++ + NQCLDLM+HQ++GK
Sbjct  145  GYLEE----AFNLLNFVGENHDIHPILPMYNNFLRGCVQTRSLLHANQCLDLMEHQVLGK  200

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY Q LKLAV QQNL A H+IWKE   +Y  SII LRKFIWSF++LRD+ESAY  LQ
Sbjct  201  NEVTYSQFLKLAVLQQNLSAAHKIWKEYMTYYSMSIISLRKFIWSFTRLRDLESAYAALQ  260

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MVD+VF+G   ++K+AEG++ + RLDIP P
Sbjct  261  HMVDLVFKGSIFINKSAEGRLCSSRLDIPIP  291



>ref|XP_010664082.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X4 [Vitis vinifera]
Length=830

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  10   LFSYPGTMQGWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLD  189
            + S     +G  LE    AF L+N + +N  +H  LP+YN  L  CVQ  ++ + NQCLD
Sbjct  129  MLSIQALCKGGYLE---EAFNLLNFVGENHDIHPILPMYNNFLRGCVQTRSLLHANQCLD  185

Query  190  LMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRD  369
            LM+HQ++GKNE+TY Q LKLAV QQNL A H+IWKE   +Y  SII LRKFIWSF++LRD
Sbjct  186  LMEHQVLGKNEVTYSQFLKLAVLQQNLSAAHKIWKEYMTYYSMSIISLRKFIWSFTRLRD  245

Query  370  MESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +ESAY  LQ MVD+VF+G   ++K+AEG++ + RLDIP P
Sbjct  246  LESAYAALQHMVDLVFKGSIFINKSAEGRLCSSRLDIPIP  285



>ref|XP_010664080.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Vitis vinifera]
Length=834

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF L+N + +N  +H  LP+YN  L  CVQ  ++ + NQCLDLM+HQ++GK
Sbjct  143  GYLEE----AFNLLNFVGENHDIHPILPMYNNFLRGCVQTRSLLHANQCLDLMEHQVLGK  198

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY Q LKLAV QQNL A H+IWKE   +Y  SII LRKFIWSF++LRD+ESAY  LQ
Sbjct  199  NEVTYSQFLKLAVLQQNLSAAHKIWKEYMTYYSMSIISLRKFIWSFTRLRDLESAYAALQ  258

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MVD+VF+G   ++K+AEG++ + RLDIP P
Sbjct  259  HMVDLVFKGSIFINKSAEGRLCSSRLDIPIP  289



>ref|XP_010664081.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X3 [Vitis vinifera]
Length=832

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF L+N + +N  +H  LP+YN  L  CVQ  ++ + NQCLDLM+HQ++GK
Sbjct  141  GYLEE----AFNLLNFVGENHDIHPILPMYNNFLRGCVQTRSLLHANQCLDLMEHQVLGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY Q LKLAV QQNL A H+IWKE   +Y  SII LRKFIWSF++LRD+ESAY  LQ
Sbjct  197  NEVTYSQFLKLAVLQQNLSAAHKIWKEYMTYYSMSIISLRKFIWSFTRLRDLESAYAALQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MVD+VF+G   ++K+AEG++ + RLDIP P
Sbjct  257  HMVDLVFKGSIFINKSAEGRLCSSRLDIPIP  287



>ref|XP_010664083.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X5 [Vitis vinifera]
Length=758

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  10   LFSYPGTMQGWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLD  189
            + S     +G  LE    AF L+N + +N  +H  LP+YN  L  CVQ  ++ + NQCLD
Sbjct  57   MLSIQALCKGGYLE---EAFNLLNFVGENHDIHPILPMYNNFLRGCVQTRSLLHANQCLD  113

Query  190  LMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRD  369
            LM+HQ++GKNE+TY Q LKLAV QQNL A H+IWKE   +Y  SII LRKFIWSF++LRD
Sbjct  114  LMEHQVLGKNEVTYSQFLKLAVLQQNLSAAHKIWKEYMTYYSMSIISLRKFIWSFTRLRD  173

Query  370  MESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +ESAY  LQ MVD+VF+G   ++K+AEG++ + RLDIP P
Sbjct  174  LESAYAALQHMVDLVFKGSIFINKSAEGRLCSSRLDIPIP  213



>ref|XP_008231248.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g76280-like [Prunus mume]
Length=724

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  10   LFSYPGTMQGWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLD  189
            L +     +G  LE    AF+L+N + ++P ++  LPIYN  L AC +M +I   NQCLD
Sbjct  24   LLTVQALCKGGYLE---EAFKLINFLGESPGIYPVLPIYNSFLRACAKMQSIKNANQCLD  80

Query  190  LMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRD  369
            LM+HQMVGKNE+TY +LLKLAV+QQNLPA HEIWK+  KHY  SII LRKFIWSF++L D
Sbjct  81   LMEHQMVGKNEVTYSELLKLAVWQQNLPAAHEIWKDYIKHYSLSIIPLRKFIWSFTRLGD  140

Query  370  MESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            ++SAY  LQ +V +  +G   + KT+EGK+ + RLDIP P
Sbjct  141  LKSAYEKLQYLVTLAIRGNTYVHKTSEGKLYSSRLDIPIP  180



>ref|XP_007018003.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOY15228.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
Length=664

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  + +N  ++ FL IYN  LGAC +M    + NQCLDLM+ Q VGK
Sbjct  139  GYLEE----ACNLIKFLGENRGIYPFLSIYNSFLGACAKMQTAVHANQCLDLMERQRVGK  194

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY +LLKLAV+QQNL AVHEIWK+  KHY  +II LRKFIWSF++L+D++SAY TLQ
Sbjct  195  NEITYSELLKLAVWQQNLSAVHEIWKDYIKHYSLNIISLRKFIWSFTRLKDLKSAYETLQ  254

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
             MV +   G   +S+T EG++ + RLDIP P K
Sbjct  255  HMVALAISGKIFVSRTGEGRLYSSRLDIPIPSK  287



>ref|XP_007219492.1| hypothetical protein PRUPE_ppa022231mg [Prunus persica]
 gb|EMJ20691.1| hypothetical protein PRUPE_ppa022231mg [Prunus persica]
Length=772

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF+L+N + + P +H  LPIYN  L AC +M +I   NQCLDLM+ QMVGK
Sbjct  82   GYLEE----AFKLINFLGEIPGIHPVLPIYNSFLRACAKMQSIKNANQCLDLMERQMVGK  137

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV+QQNLPA HEIWK+  K Y  SII LRKFIWSF++L D++SAY  LQ
Sbjct  138  NEVTYSELLKLAVWQQNLPAAHEIWKDYIKCYSLSIIPLRKFIWSFTRLGDLKSAYEKLQ  197

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +  +G   +++T+EGK+ + RLDIP P
Sbjct  198  YMVALAIRGNTYVNRTSEGKLYSSRLDIPIP  228



>ref|XP_007018002.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY15227.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=814

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  + +N  ++ FL IYN  LGAC +M    + NQCLDLM+ Q VGK
Sbjct  139  GYLEE----ACNLIKFLGENRGIYPFLSIYNSFLGACAKMQTAVHANQCLDLMERQRVGK  194

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY +LLKLAV+QQNL AVHEIWK+  KHY  +II LRKFIWSF++L+D++SAY TLQ
Sbjct  195  NEITYSELLKLAVWQQNLSAVHEIWKDYIKHYSLNIISLRKFIWSFTRLKDLKSAYETLQ  254

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
             MV +   G   +S+T EG++ + RLDIP P K
Sbjct  255  HMVALAISGKIFVSRTGEGRLYSSRLDIPIPSK  287



>ref|XP_008377070.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Malus domestica]
Length=844

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 114/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF+L+N + ++  ++  LPIYN  L AC +M ++   NQCLDLM+HQM GK
Sbjct  154  GYLEE----AFKLINFLGESQGIYPVLPIYNSFLRACAKMQSMINANQCLDLMEHQMAGK  209

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLK AV+QQNLPA HEIW++  KHY  SII LRKFIWSF++L D++SAY+TLQ
Sbjct  210  NEVTYSELLKFAVWQQNLPAAHEIWEDYIKHYSLSIIPLRKFIWSFTRLGDLKSAYVTLQ  269

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +MV ++ +G   +++T++GK+ + RLDIP P
Sbjct  270  RMVALITKGNTNVNRTSDGKLFSSRLDIPIP  300



>ref|XP_008377069.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Malus domestica]
Length=848

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 114/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF+L+N + ++  ++  LPIYN  L AC +M ++   NQCLDLM+HQM GK
Sbjct  158  GYLEE----AFKLINFLGESQGIYPVLPIYNSFLRACAKMQSMINANQCLDLMEHQMAGK  213

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLK AV+QQNLPA HEIW++  KHY  SII LRKFIWSF++L D++SAY+TLQ
Sbjct  214  NEVTYSELLKFAVWQQNLPAAHEIWEDYIKHYSLSIIPLRKFIWSFTRLGDLKSAYVTLQ  273

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +MV ++ +G   +++T++GK+ + RLDIP P
Sbjct  274  RMVALITKGNTNVNRTSDGKLFSSRLDIPIP  304



>ref|XP_006421239.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
 gb|ESR34479.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
Length=548

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  + +   ++  LP+YN  LGAC ++H++ + N CLDLMD +MVGK
Sbjct  141  GYLEE----ASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV+Q+NL AVHEIW++  KHY  SI  LRKFIWSF++LRD++SAY TLQ
Sbjct  197  NEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFIWSFTRLRDLKSAYETLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +   G   +++T+EG++R+ RLDIP P
Sbjct  257  HMVALAMMGKLYITRTSEGRLRSSRLDIPIP  287



>ref|XP_006421240.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
 gb|ESR34480.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
Length=782

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  + +   ++  LP+YN  LGAC ++H++ + N CLDLMD +MVGK
Sbjct  100  GYLEE----ASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGK  155

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV+Q+NL AVHEIW++  KHY  SI  LRKFIWSF++LRD++SAY TLQ
Sbjct  156  NEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFIWSFTRLRDLKSAYETLQ  215

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +   G   +++T+EG++R+ RLDIP P
Sbjct  216  HMVALAMMGKLYITRTSEGRLRSSRLDIPIP  246



>ref|XP_006421241.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
 gb|ESR34481.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
Length=782

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  + +   ++  LP+YN  LGAC ++H++ + N CLDLMD +MVGK
Sbjct  141  GYLEE----ASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV+Q+NL AVHEIW++  KHY  SI  LRKFIWSF++LRD++SAY TLQ
Sbjct  197  NEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFIWSFTRLRDLKSAYETLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +   G   +++T+EG++R+ RLDIP P
Sbjct  257  HMVALAMMGKLYITRTSEGRLRSSRLDIPIP  287



>ref|XP_006421242.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
 ref|XP_006421243.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
 gb|ESR34482.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
 gb|ESR34483.1| hypothetical protein CICLE_v10004328mg [Citrus clementina]
Length=823

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  + +   ++  LP+YN  LGAC ++H++ + N CLDLMD +MVGK
Sbjct  141  GYLEE----ASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV+Q+NL AVHEIW++  KHY  SI  LRKFIWSF++LRD++SAY TLQ
Sbjct  197  NEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFIWSFTRLRDLKSAYETLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +   G   +++T+EG++R+ RLDIP P
Sbjct  257  HMVALAMMGKLYITRTSEGRLRSSRLDIPIP  287



>gb|KDO43134.1| hypothetical protein CISIN_1g004279mg [Citrus sinensis]
 gb|KDO43135.1| hypothetical protein CISIN_1g004279mg [Citrus sinensis]
 gb|KDO43136.1| hypothetical protein CISIN_1g004279mg [Citrus sinensis]
Length=764

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  + +   ++  LP+YN  LGAC ++H++ + N CLDLMD +MVGK
Sbjct  136  GYLEE----ASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGK  191

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV+Q+NL AVHEIW++  KHY  SI  LRKF+WSF++LRD++SAY TLQ
Sbjct  192  NEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQ  251

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +   G   +++T+EG++R+ RLDIP P
Sbjct  252  HMVALAMMGKLYINRTSEGRLRSSRLDIPIP  282



>gb|EYU36636.1| hypothetical protein MIMGU_mgv1a001743mg [Erythranthe guttata]
Length=766

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF +++I ++N      LP+YN LL ACVQM+++++  +CL LM+ Q VGKN+ITY  LL
Sbjct  87   AFNILSIQKENSDTCPTLPVYNDLLEACVQMNSLNHAGECLHLMEKQGVGKNDITYTILL  146

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV QQ+L A+HEIWKE   +  PSII LRKFI SF+KLRD+ESAY+ LQ+MVD+ FQ 
Sbjct  147  KLAVLQQDLSAIHEIWKEYFNNNTPSIITLRKFIRSFTKLRDLESAYVALQRMVDVAFQH  206

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
             F ++KTAEGK+ + R++IP P
Sbjct  207  KFSITKTAEGKLFDSRVNIPIP  228



>ref|XP_010692813.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010692814.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=834

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+N + +N  + + LP+YN LL +CV+M ++   +QCLD+M+HQ +GK
Sbjct  144  GYLEE----ALHLVNFIGENNRISFILPLYNNLLSSCVKMKDVMLFHQCLDMMEHQNLGK  199

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY  LLKLAV+Q+NL AVHEIW+E  KHY  +II LRKFIWSF++LRD+ESAY TLQ
Sbjct  200  NEVTYSALLKLAVWQKNLSAVHEIWREHCKHYNVNIISLRKFIWSFTRLRDLESAYRTLQ  259

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             M+ + F+ G  L +T EGK+   +LDIP P
Sbjct  260  CMIVLAFKEGIFLRRTREGKIFCPQLDIPIP  290



>ref|XP_010692815.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=831

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+N + +N  + + LP+YN LL +CV+M ++   +QCLD+M+HQ +GK
Sbjct  141  GYLEE----ALHLVNFIGENNRISFILPLYNNLLSSCVKMKDVMLFHQCLDMMEHQNLGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY  LLKLAV+Q+NL AVHEIW+E  KHY  +II LRKFIWSF++LRD+ESAY TLQ
Sbjct  197  NEVTYSALLKLAVWQKNLSAVHEIWREHCKHYNVNIISLRKFIWSFTRLRDLESAYRTLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             M+ + F+ G  L +T EGK+   +LDIP P
Sbjct  257  CMIVLAFKEGIFLRRTREGKIFCPQLDIPIP  287



>gb|KJB14290.1| hypothetical protein B456_002G118000 [Gossypium raimondii]
Length=599

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A + M  +R+N   +  LP+YN  LGAC +M +I + NQCLDLM+ Q VGK
Sbjct  138  GYLEE----ACKFMKFLRENHGTYPLLPVYNCFLGACAKMKSIIHANQCLDLMELQRVGK  193

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY  LLKLAV+QQ+L AV EIW++  KHY  +II LR+FIWSF++L+D++SAY TLQ
Sbjct  194  NEITYSVLLKLAVWQQDLSAVREIWEDYIKHYSLNIISLRRFIWSFTRLKDLKSAYETLQ  253

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
             MV +   G   +S+T EG++ + RLDIP P K
Sbjct  254  HMVALAISGKHFVSRTDEGRLYSSRLDIPIPSK  286



>ref|XP_006491555.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X1 [Citrus sinensis]
 ref|XP_006491556.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X2 [Citrus sinensis]
 ref|XP_006491557.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X3 [Citrus sinensis]
 ref|XP_006491558.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X4 [Citrus sinensis]
 ref|XP_006491559.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X5 [Citrus sinensis]
Length=822

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 109/151 (72%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  + +   ++  LP+YN  LGAC ++H++ + N CLDLMD +MVGK
Sbjct  141  GYLEE----ASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV+Q+NL AVHEIW +  KHY  S+  LRKF+WSF++LRD++SAY TLQ
Sbjct  197  NEVTYTELLKLAVWQKNLSAVHEIWGDYIKHYSLSVFSLRKFVWSFTRLRDLKSAYETLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +   G   +++T+EG++R+ RLDIP P
Sbjct  257  HMVALAMMGKLYINRTSEGRLRSSRLDIPIP  287



>gb|KJB14288.1| hypothetical protein B456_002G118000 [Gossypium raimondii]
Length=581

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A + M  +R+N   +  LP+YN  LGAC +M +I + NQCLDLM+ Q VGK
Sbjct  138  GYLEE----ACKFMKFLRENHGTYPLLPVYNCFLGACAKMKSIIHANQCLDLMELQRVGK  193

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY  LLKLAV+QQ+L AV EIW++  KHY  +II LR+FIWSF++L+D++SAY TLQ
Sbjct  194  NEITYSVLLKLAVWQQDLSAVREIWEDYIKHYSLNIISLRRFIWSFTRLKDLKSAYETLQ  253

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
             MV +   G   +S+T EG++ + RLDIP P K
Sbjct  254  HMVALAISGKHFVSRTDEGRLYSSRLDIPIPSK  286



>ref|XP_010266133.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Nelumbo nucifera]
Length=710

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF  +  + D+      LP+ N  L  C QM  + + N CLDLM+HQ+ GK+E+TY++LL
Sbjct  29   AFNWLAFLGDDHQKCPVLPMCNIFLNGCGQMQRLDHANYCLDLMEHQLTGKSEVTYWELL  88

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV+QQ+L  VHEIWKECTK+Y PSII LRKFIWS+++LRD+ SAY  LQ MV + F+ 
Sbjct  89   KLAVWQQSLSTVHEIWKECTKYYNPSIILLRKFIWSYTRLRDLASAYKVLQYMVALAFKR  148

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               ++ +AEGK R+ RLDIP P
Sbjct  149  SDFVNTSAEGKFRSSRLDIPIP  170



>gb|KJB14289.1| hypothetical protein B456_002G118000 [Gossypium raimondii]
Length=771

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A + M  +R+N   +  LP+YN  LGAC +M +I + NQCLDLM+ Q VGK
Sbjct  138  GYLEE----ACKFMKFLRENHGTYPLLPVYNCFLGACAKMKSIIHANQCLDLMELQRVGK  193

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY  LLKLAV+QQ+L AV EIW++  KHY  +II LR+FIWSF++L+D++SAY TLQ
Sbjct  194  NEITYSVLLKLAVWQQDLSAVREIWEDYIKHYSLNIISLRRFIWSFTRLKDLKSAYETLQ  253

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
             MV +   G   +S+T EG++ + RLDIP P K
Sbjct  254  HMVALAISGKHFVSRTDEGRLYSSRLDIPIPSK  286



>gb|KJB14291.1| hypothetical protein B456_002G118000 [Gossypium raimondii]
Length=777

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A + M  +R+N   +  LP+YN  LGAC +M +I + NQCLDLM+ Q VGK
Sbjct  138  GYLEE----ACKFMKFLRENHGTYPLLPVYNCFLGACAKMKSIIHANQCLDLMELQRVGK  193

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY  LLKLAV+QQ+L AV EIW++  KHY  +II LR+FIWSF++L+D++SAY TLQ
Sbjct  194  NEITYSVLLKLAVWQQDLSAVREIWEDYIKHYSLNIISLRRFIWSFTRLKDLKSAYETLQ  253

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
             MV +   G   +S+T EG++ + RLDIP P K
Sbjct  254  HMVALAISGKHFVSRTDEGRLYSSRLDIPIPSK  286



>gb|KJB14287.1| hypothetical protein B456_002G118000 [Gossypium raimondii]
Length=817

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A + M  +R+N   +  LP+YN  LGAC +M +I + NQCLDLM+ Q VGK
Sbjct  138  GYLEE----ACKFMKFLRENHGTYPLLPVYNCFLGACAKMKSIIHANQCLDLMELQRVGK  193

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY  LLKLAV+QQ+L AV EIW++  KHY  +II LR+FIWSF++L+D++SAY TLQ
Sbjct  194  NEITYSVLLKLAVWQQDLSAVREIWEDYIKHYSLNIISLRRFIWSFTRLKDLKSAYETLQ  253

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
             MV +   G   +S+T EG++ + RLDIP P K
Sbjct  254  HMVALAISGKHFVSRTDEGRLYSSRLDIPIPSK  286



>ref|XP_010266132.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Nelumbo nucifera]
Length=830

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF  +  + D+      LP+ N  L  C QM  + + N CLDLM+HQ+ GK+E+TY++LL
Sbjct  149  AFNWLAFLGDDHQKCPVLPMCNIFLNGCGQMQRLDHANYCLDLMEHQLTGKSEVTYWELL  208

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV+QQ+L  VHEIWKECTK+Y PSII LRKFIWS+++LRD+ SAY  LQ MV + F+ 
Sbjct  209  KLAVWQQSLSTVHEIWKECTKYYNPSIILLRKFIWSYTRLRDLASAYKVLQYMVALAFKR  268

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               ++ +AEGK R+ RLDIP P
Sbjct  269  SDFVNTSAEGKFRSSRLDIPIP  290



>gb|KHF99794.1| hypothetical protein F383_16904 [Gossypium arboreum]
Length=857

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 107/153 (70%), Gaps = 4/153 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A + M  +R+N   +  LP+YN  LGAC +M ++ + NQCLDLM+ Q VGK
Sbjct  138  GYLEE----ACKFMKFLRENHGTYPLLPVYNCFLGACAKMKSVIHANQCLDLMELQRVGK  193

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY  LLKLAV+QQ+L A  +IW++  KHY  +II LR+FIWSF++L+D++SAY TLQ
Sbjct  194  NEITYSVLLKLAVWQQDLSAARDIWEDYIKHYSLNIISLRRFIWSFTRLKDLKSAYETLQ  253

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
             MV +   G   +S+T EG++ + RLDIP P K
Sbjct  254  HMVALAISGKHFVSRTDEGRLYSSRLDIPIPSK  286



>ref|XP_011074015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Sesamum indicum]
Length=780

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +1

Query  82   IMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLKLAVFQ  261
            I  +N  ++  LP+YN LL ACVQ++++++ ++CL LM+ Q VGKN ITY+ LLKLAV +
Sbjct  108  IQTENSDIYPTLPVYNNLLEACVQVNSLNHASECLHLMEQQGVGKNAITYFLLLKLAVVR  167

Query  262  QNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGGFLLSK  441
            Q+L AV +IWKE    +   II LRKFIWSF++LRD++SAY+ LQQM+ M  Q  F L+K
Sbjct  168  QDLSAVRDIWKEYINCHTLGIITLRKFIWSFTRLRDLDSAYVALQQMIAMALQQKFRLTK  227

Query  442  TAEGKMRNLRLDIPAPCK  495
             AEG++ +L LDIP PC+
Sbjct  228  NAEGRLSDLMLDIPIPCR  245



>ref|XP_011074014.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Sesamum indicum]
Length=816

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +1

Query  82   IMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLKLAVFQ  261
            I  +N  ++  LP+YN LL ACVQ++++++ ++CL LM+ Q VGKN ITY+ LLKLAV +
Sbjct  144  IQTENSDIYPTLPVYNNLLEACVQVNSLNHASECLHLMEQQGVGKNAITYFLLLKLAVVR  203

Query  262  QNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGGFLLSK  441
            Q+L AV +IWKE    +   II LRKFIWSF++LRD++SAY+ LQQM+ M  Q  F L+K
Sbjct  204  QDLSAVRDIWKEYINCHTLGIITLRKFIWSFTRLRDLDSAYVALQQMIAMALQQKFRLTK  263

Query  442  TAEGKMRNLRLDIPAPCK  495
             AEG++ +L LDIP PC+
Sbjct  264  NAEGRLSDLMLDIPIPCR  281



>ref|XP_007160600.1| hypothetical protein PHAVU_001G001200g [Phaseolus vulgaris]
 gb|ESW32594.1| hypothetical protein PHAVU_001G001200g [Phaseolus vulgaris]
Length=748

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 107/151 (71%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF +M+ +  +  ++  LP+YN LLG+C +M ++   N+CLDLM+ +MVGK
Sbjct  90   GYLEE----AFDIMDFLGGSQCLYPVLPLYNSLLGSCSKMQSLILANKCLDLMEKKMVGK  145

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            +E+TY +LLKLAV  ++LPA H +W+E  K+Y  SII LR+FIWSF++L D+ESA  TLQ
Sbjct  146  SEVTYTELLKLAVLLKDLPAAHLVWQEYVKNYSMSIIALRRFIWSFTRLGDLESACKTLQ  205

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            QMV +  +G   ++KT  GK+ + R+DIP P
Sbjct  206  QMVSLAVRGNISIAKTVYGKLYSTRMDIPVP  236



>ref|XP_007160601.1| hypothetical protein PHAVU_001G001200g [Phaseolus vulgaris]
 gb|ESW32595.1| hypothetical protein PHAVU_001G001200g [Phaseolus vulgaris]
Length=792

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 107/151 (71%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF +M+ +  +  ++  LP+YN LLG+C +M ++   N+CLDLM+ +MVGK
Sbjct  134  GYLEE----AFDIMDFLGGSQCLYPVLPLYNSLLGSCSKMQSLILANKCLDLMEKKMVGK  189

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            +E+TY +LLKLAV  ++LPA H +W+E  K+Y  SII LR+FIWSF++L D+ESA  TLQ
Sbjct  190  SEVTYTELLKLAVLLKDLPAAHLVWQEYVKNYSMSIIALRRFIWSFTRLGDLESACKTLQ  249

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            QMV +  +G   ++KT  GK+ + R+DIP P
Sbjct  250  QMVSLAVRGNISIAKTVYGKLYSTRMDIPVP  280



>ref|XP_010539797.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X5 [Tarenaya hassleriana]
Length=706

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A  L+N   ++ SV   LP+YN +L AC +  N+ + ++CLDLMD Q VG+NE TY +LL
Sbjct  35   ASDLINFAGESGSVSPVLPLYNYVLRACAKTKNLLHASKCLDLMDRQRVGRNETTYSELL  94

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AV E WKE TKHY  +I  LRKFIWSF +L D++SAY  LQQMVD+  +G
Sbjct  95   KLAVLQRNLSAVQEFWKEYTKHYSLNIFCLRKFIWSFRRLGDLKSAYGALQQMVDLAIRG  154

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               L    +G++   RLDIP P
Sbjct  155  KHSLESNTKGRLCTSRLDIPIP  176



>ref|XP_010539796.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X4 [Tarenaya hassleriana]
Length=734

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A  L+N   ++ SV   LP+YN +L AC +  N+ + ++CLDLMD Q VG+NE TY +LL
Sbjct  63   ASDLINFAGESGSVSPVLPLYNYVLRACAKTKNLLHASKCLDLMDRQRVGRNETTYSELL  122

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AV E WKE TKHY  +I  LRKFIWSF +L D++SAY  LQQMVD+  +G
Sbjct  123  KLAVLQRNLSAVQEFWKEYTKHYSLNIFCLRKFIWSFRRLGDLKSAYGALQQMVDLAIRG  182

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               L    +G++   RLDIP P
Sbjct  183  KHSLESNTKGRLCTSRLDIPIP  204



>ref|XP_010539795.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X3 [Tarenaya hassleriana]
Length=760

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A  L+N   ++ SV   LP+YN +L AC +  N+ + ++CLDLMD Q VG+NE TY +LL
Sbjct  89   ASDLINFAGESGSVSPVLPLYNYVLRACAKTKNLLHASKCLDLMDRQRVGRNETTYSELL  148

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AV E WKE TKHY  +I  LRKFIWSF +L D++SAY  LQQMVD+  +G
Sbjct  149  KLAVLQRNLSAVQEFWKEYTKHYSLNIFCLRKFIWSFRRLGDLKSAYGALQQMVDLAIRG  208

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               L    +G++   RLDIP P
Sbjct  209  KHSLESNTKGRLCTSRLDIPIP  230



>ref|XP_010539794.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Tarenaya hassleriana]
Length=819

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A  L+N   ++ SV   LP+YN +L AC +  N+ + ++CLDLMD Q VG+NE TY +LL
Sbjct  148  ASDLINFAGESGSVSPVLPLYNYVLRACAKTKNLLHASKCLDLMDRQRVGRNETTYSELL  207

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AV E WKE TKHY  +I  LRKFIWSF +L D++SAY  LQQMVD+  +G
Sbjct  208  KLAVLQRNLSAVQEFWKEYTKHYSLNIFCLRKFIWSFRRLGDLKSAYGALQQMVDLAIRG  267

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               L    +G++   RLDIP P
Sbjct  268  KHSLESNTKGRLCTSRLDIPIP  289



>ref|XP_010539793.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Tarenaya hassleriana]
Length=837

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A  L+N   ++ SV   LP+YN +L AC +  N+ + ++CLDLMD Q VG+NE TY +LL
Sbjct  166  ASDLINFAGESGSVSPVLPLYNYVLRACAKTKNLLHASKCLDLMDRQRVGRNETTYSELL  225

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AV E WKE TKHY  +I  LRKFIWSF +L D++SAY  LQQMVD+  +G
Sbjct  226  KLAVLQRNLSAVQEFWKEYTKHYSLNIFCLRKFIWSFRRLGDLKSAYGALQQMVDLAIRG  285

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               L    +G++   RLDIP P
Sbjct  286  KHSLESNTKGRLCTSRLDIPIP  307



>ref|XP_002527312.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF35064.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=802

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 102/151 (68%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A+ L+N + +   ++  L +YN  LGAC +M N+   N+CLDLM H+M GK
Sbjct  141  GYLEE----AYNLINFIGEKHGMNPSLAVYNSFLGACSKMRNLILANKCLDLMAHRMSGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NEITY QLLKLAV+QQNL AVHEI K+ TK Y PSI+ L+ FI SF++L D+ SAY TLQ
Sbjct  197  NEITYMQLLKLAVWQQNLSAVHEILKDYTKLYSPSILSLQNFIESFTRLGDLNSAYETLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             MV +  +G   +  T EG + + RLDIP P
Sbjct  257  HMVSLALRGNTSIGSTVEGWLYSSRLDIPIP  287



>ref|XP_004512612.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X2 [Cicer arietinum]
Length=835

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF +++ + ++   +  LP+YN +L +C ++ N+    +CLDLM+ +M+GK+E+TY  LL
Sbjct  141  AFSIIDFLGESQRFYPVLPLYNSILRSCTKIQNLIQARKCLDLMEKKMIGKSEVTYNALL  200

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NLPAVH IW+E    Y  SII LRKFIWSF++L D++SAY TLQQMV +  +G
Sbjct  201  KLAVLQKNLPAVHIIWQEYITLYSMSIIALRKFIWSFTRLGDLKSAYRTLQQMVSLAMRG  260

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               +++T  GK+ + RLDIP P
Sbjct  261  NVSIARTVYGKLYSTRLDIPVP  282



>ref|XP_009126324.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
[Brassica rapa]
Length=359

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   +  + +N S+   LP+YN  LGACV+  N +Y ++CL+LMD + VGKNEITY  LL
Sbjct  154  ASEFIQALGENDSISPLLPVYNYFLGACVKTRNGNYASRCLELMDQRRVGKNEITYAALL  213

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NLP+V+EI K    HY  SI+ LRKFIWSF++L D++SAY  LQ MV +  +G
Sbjct  214  KLAVLQRNLPSVNEILKHYVDHYSLSILSLRKFIWSFTRLGDLKSAYELLQHMVALASRG  273

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               + K   GK+ + RLDIP P
Sbjct  274  ELFV-KFKSGKLHSTRLDIPIP  294



>ref|XP_004512611.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X1 [Cicer arietinum]
Length=848

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF +++ + ++   +  LP+YN +L +C ++ N+    +CLDLM+ +M+GK+E+TY  LL
Sbjct  154  AFSIIDFLGESQRFYPVLPLYNSILRSCTKIQNLIQARKCLDLMEKKMIGKSEVTYNALL  213

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NLPAVH IW+E    Y  SII LRKFIWSF++L D++SAY TLQQMV +  +G
Sbjct  214  KLAVLQKNLPAVHIIWQEYITLYSMSIIALRKFIWSFTRLGDLKSAYRTLQQMVSLAMRG  273

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               +++T  GK+ + RLDIP P
Sbjct  274  NVSIARTVYGKLYSTRLDIPVP  295



>ref|XP_008804417.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X3 [Phoenix dactylifera]
Length=751

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = +1

Query  58   INAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQ  237
            I A  L+  +R+N  V+  LP++N LL  C    ++   + C++LM+ Q+VGK+EITY +
Sbjct  12   IKALNLLTSLRENDHVNAALPMFNILLTGCGNKKSLEDADYCMELMESQLVGKSEITYCE  71

Query  238  LLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVF  417
            LLKLAV Q+NL AVHEIWK+C+++Y PSII LRKF+ SF+KL D+ESAY  LQ M+ +V 
Sbjct  72   LLKLAVMQENLSAVHEIWKDCSRYYSPSIITLRKFVRSFTKLGDLESAYNVLQLMMALVR  131

Query  418  QGGFLLSKTAEGKMRNLRLDIPAP  489
            Q    ++ +A G+ R+ RLDIP P
Sbjct  132  QENASVTISATGRYRSSRLDIPIP  155



>gb|AES76046.2| PPR containing plant-like protein [Medicago truncatula]
Length=805

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  67   FRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLK  246
            F +M+ + ++   +  LP+YN +L +  ++ N+    +CLDLM+ QM+GK+E+TY  LLK
Sbjct  144  FSIMDFLAESRHFYPVLPLYNSILRSYTEIQNLVQARKCLDLMEKQMIGKSEVTYTALLK  203

Query  247  LAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGG  426
            LAV Q+NLPAVH IW+E  K Y  SI+ LRKF+WSF++L D++SAY TLQQMV +V +G 
Sbjct  204  LAVVQKNLPAVHIIWQEYIKLYSMSIVPLRKFVWSFTRLGDLKSAYRTLQQMVSLVMRGN  263

Query  427  FLLSKTAEGKMRNLRLDIPAP  489
              ++KT  GK+ + RLDIP P
Sbjct  264  ISIAKTVYGKLYSTRLDIPVP  284



>gb|KEH26674.1| PPR containing plant-like protein [Medicago truncatula]
Length=828

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  67   FRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLK  246
            F +M+ + ++   +  LP+YN +L +  ++ N+    +CLDLM+ QM+GK+E+TY  LLK
Sbjct  135  FSIMDFLAESRHFYPVLPLYNSILRSYTEIQNLVQARKCLDLMEKQMIGKSEVTYTALLK  194

Query  247  LAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGG  426
            LAV Q+NLPAVH IW+E  K Y  SI+ LRKF+WSF++L D++SAY TLQQMV +V +G 
Sbjct  195  LAVVQKNLPAVHIIWQEYIKLYSMSIVPLRKFVWSFTRLGDLKSAYRTLQQMVSLVMRGN  254

Query  427  FLLSKTAEGKMRNLRLDIPAP  489
              ++KT  GK+ + RLDIP P
Sbjct  255  ISIAKTVYGKLYSTRLDIPVP  275



>gb|KEH26673.1| PPR containing plant-like protein [Medicago truncatula]
Length=837

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  67   FRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLK  246
            F +M+ + ++   +  LP+YN +L +  ++ N+    +CLDLM+ QM+GK+E+TY  LLK
Sbjct  144  FSIMDFLAESRHFYPVLPLYNSILRSYTEIQNLVQARKCLDLMEKQMIGKSEVTYTALLK  203

Query  247  LAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGG  426
            LAV Q+NLPAVH IW+E  K Y  SI+ LRKF+WSF++L D++SAY TLQQMV +V +G 
Sbjct  204  LAVVQKNLPAVHIIWQEYIKLYSMSIVPLRKFVWSFTRLGDLKSAYRTLQQMVSLVMRGN  263

Query  427  FLLSKTAEGKMRNLRLDIPAP  489
              ++KT  GK+ + RLDIP P
Sbjct  264  ISIAKTVYGKLYSTRLDIPVP  284



>ref|XP_008804413.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Phoenix dactylifera]
 ref|XP_008804414.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Phoenix dactylifera]
 ref|XP_008804415.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Phoenix dactylifera]
Length=883

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 105/151 (70%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  +R+N  V+  LP++N LL  C    ++   + C++LM+ Q+VGK
Sbjct  141  GYLKE----ALNLLTSLRENDHVNAALPMFNILLTGCGNKKSLEDADYCMELMESQLVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            +EITY +LLKLAV Q+NL AVHEIWK+C+++Y PSII LRKF+ SF+KL D+ESAY  LQ
Sbjct  197  SEITYCELLKLAVMQENLSAVHEIWKDCSRYYSPSIITLRKFVRSFTKLGDLESAYNVLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             M+ +V Q    ++ +A G+ R+ RLDIP P
Sbjct  257  LMMALVRQENASVTISATGRYRSSRLDIPIP  287



>ref|XP_006596521.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X3 [Glycine max]
Length=695

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 103/151 (68%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF +++ +  +  ++  LP+YN LL +C  M NI   ++CLDLM+ +MVGK
Sbjct  137  GYLEE----AFDIVDYLGGSQRLYPVLPLYNSLLRSCTTMQNIIQASRCLDLMEKKMVGK  192

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV Q+NLPA H IW+E  K+Y  SI+ L +FIWSF++L D+ESAY  L 
Sbjct  193  NEVTYIELLKLAVLQKNLPAAHLIWQEYIKNYSMSIMALDRFIWSFTRLGDLESAYKILL  252

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +M+ +  +G   +++T  GK+   RLDIP P
Sbjct  253  EMISLATRGNIPIARTVHGKVYTNRLDIPVP  283



>ref|XP_006596520.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X2 [Glycine max]
Length=809

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 103/151 (68%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF +++ +  +  ++  LP+YN LL +C  M NI   ++CLDLM+ +MVGK
Sbjct  123  GYLEE----AFDIVDYLGGSQRLYPVLPLYNSLLRSCTTMQNIIQASRCLDLMEKKMVGK  178

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV Q+NLPA H IW+E  K+Y  SI+ L +FIWSF++L D+ESAY  L 
Sbjct  179  NEVTYIELLKLAVLQKNLPAAHLIWQEYIKNYSMSIMALDRFIWSFTRLGDLESAYKILL  238

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +M+ +  +G   +++T  GK+   RLDIP P
Sbjct  239  EMISLATRGNIPIARTVHGKVYTNRLDIPVP  269



>ref|XP_006390215.1| hypothetical protein EUTSA_v10018138mg [Eutrema salsugineum]
 gb|ESQ27501.1| hypothetical protein EUTSA_v10018138mg [Eutrema salsugineum]
Length=802

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ + +N S+   LP+YN  LGACV+  + +Y ++CL+LMD + VGKNEITY  LL
Sbjct  149  ALEFIHALGENDSISPLLPVYNYFLGACVKTRSGNYASKCLELMDERRVGKNEITYAALL  208

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ+NL +V+EI K    HY  +I+ LRKFIWSF++L D++SAY  LQ MV +  +G
Sbjct  209  KLAVFQRNLSSVNEILKHYVDHYSLNILSLRKFIWSFTRLGDLKSAYELLQHMVALALRG  268

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  K+  GKM ++RLDIP P
Sbjct  269  E-LFVKSNRGKMHSMRLDIPIP  289



>ref|XP_006596519.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X1 [Glycine max]
Length=823

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 103/151 (68%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF +++ +  +  ++  LP+YN LL +C  M NI   ++CLDLM+ +MVGK
Sbjct  137  GYLEE----AFDIVDYLGGSQRLYPVLPLYNSLLRSCTTMQNIIQASRCLDLMEKKMVGK  192

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE+TY +LLKLAV Q+NLPA H IW+E  K+Y  SI+ L +FIWSF++L D+ESAY  L 
Sbjct  193  NEVTYIELLKLAVLQKNLPAAHLIWQEYIKNYSMSIMALDRFIWSFTRLGDLESAYKILL  252

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +M+ +  +G   +++T  GK+   RLDIP P
Sbjct  253  EMISLATRGNIPIARTVHGKVYTNRLDIPVP  283



>ref|XP_004292914.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
[Fragaria vesca subsp. vesca]
Length=828

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +1

Query  109  YFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEI  288
            Y LP+YN  LGACVQM N+ Y NQCL+LM+ Q VGKNE TY QLLKLAV+++NL   HE+
Sbjct  156  YMLPVYNTFLGACVQMQNMVYANQCLELMERQKVGKNEDTYAQLLKLAVWRKNLSVAHEL  215

Query  289  WKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNL  468
            WK+  KHY  S + L KF+WSF  L D++SA  TLQ MV +V +G   ++K+ E K+ + 
Sbjct  216  WKDYIKHYSLSNMTLHKFVWSFGSLGDLKSACETLQYMVALVIRGKTSVTKSIERKLYSS  275

Query  469  RLDIPAP  489
            RLD P P
Sbjct  276  RLDTPIP  282



>gb|KDP41990.1| hypothetical protein JCGZ_27008 [Jatropha curcas]
Length=828

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 106/162 (65%), Gaps = 3/162 (2%)
 Frame = +1

Query  10   LFSYPGTMQGWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLD  189
            LF      +G  +E    A+ L++ +R+   ++  L + N  L AC ++++I++ N+CLD
Sbjct  131  LFMMQALCKGGYME---EAYDLIHFLREKSGMNPSLAMCNSFLEACSEIYSITHANRCLD  187

Query  190  LMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRD  369
            LM+ +M+GKNE TY  LLKLAV Q+NL AVHEIWK+  K+Y PSI+ L++F+ SF  LRD
Sbjct  188  LMERRMLGKNEDTYTALLKLAVIQRNLSAVHEIWKDYIKYYSPSILSLQQFVLSFVSLRD  247

Query  370  MESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
              SA   LQ MVD+V +G   +  TA GK+ + RLDIP P K
Sbjct  248  TNSACQMLQHMVDLVLRGNIFIESTAYGKLYSSRLDIPIPSK  289



>emb|CDX87621.1| BnaA07g32520D [Brassica napus]
Length=799

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   +  + +N S+   LP+YN  LGACV+  N +Y ++CL+LMD + VGKNEITY  LL
Sbjct  154  ASEFIQALGENDSISPLLPVYNYFLGACVKTRNGNYASRCLELMDQRRVGKNEITYAALL  213

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NLP+V+EI K    HY  SI+ LRKFIWSF++L D++SAY  LQ MV +  +G
Sbjct  214  KLAVLQRNLPSVNEILKHYVDHYSLSILSLRKFIWSFTRLGDLKSAYELLQHMVALASRG  273

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  K   GK+ + RLDIP P
Sbjct  274  E-LFVKFKSGKLHSTRLDIPIP  294



>ref|XP_009106285.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
[Brassica rapa]
Length=815

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   +  + +N S+   LP+YN  LGACV+  N +Y ++CL+LMD + VGKNEITY  LL
Sbjct  154  ASEFIQALGENDSISPLLPVYNYFLGACVKTRNGNYASRCLELMDQRRVGKNEITYAALL  213

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NLP+V+EI K    HY  SI+ LRKFIWSF++L D++SAY  LQ MV +  +G
Sbjct  214  KLAVLQRNLPSVNEILKHYVDHYSLSILSLRKFIWSFTRLGDLKSAYELLQHMVALASRG  273

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               + K   GK+ + RLDIP P
Sbjct  274  ELFV-KFKSGKLHSTRLDIPIP  294



>ref|XP_011034528.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Populus euphratica]
Length=739

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A  +++ + ++  ++  LP+YN  LGAC  M    Y +QCL LM+ +M+GK+E+TY  LL
Sbjct  19   ASNMIDFIGESHGIYPTLPVYNTFLGACTDMSRADYADQCLQLMERRMMGKDEVTYIMLL  78

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV QQNL AV+EIWK+  KH+ PSI+ L+KFIWSF++LRD++SAY  LQ MV +  +G
Sbjct  79   KLAVSQQNLSAVYEIWKDYVKHFSPSILTLQKFIWSFARLRDLKSAYEKLQHMVVLAIRG  138

Query  424  GFLLSKTAEGKMRNLRLDIP  483
               +  ++ G++   R++IP
Sbjct  139  NTFVQTSSRGQLYVSRVNIP  158



>ref|XP_011034514.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034515.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034516.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034517.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034518.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034519.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034520.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034521.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034522.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034523.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034526.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
 ref|XP_011034527.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Populus euphratica]
Length=869

 Score =   145 bits (365),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 102/149 (68%), Gaps = 4/149 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  +++ + ++  ++  LP+YN  LGAC  M    Y +QCL LM+ +M+GK
Sbjct  144  GYLEE----ASNMIDFIGESHGIYPTLPVYNTFLGACTDMSRADYADQCLQLMERRMMGK  199

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            +E+TY  LLKLAV QQNL AV+EIWK+  KH+ PSI+ L+KFIWSF++LRD++SAY  LQ
Sbjct  200  DEVTYIMLLKLAVSQQNLSAVYEIWKDYVKHFSPSILTLQKFIWSFARLRDLKSAYEKLQ  259

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIP  483
             MV +  +G   +  ++ G++   R++IP
Sbjct  260  HMVVLAIRGNTFVQTSSRGQLYVSRVNIP  288


 Score = 35.0 bits (79),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  2    QCYYLAIQALCKGGYLNEVS  61
            +CY L I+ALCKGGYL E S
Sbjct  131  KCYLLMIRALCKGGYLEEAS  150



>emb|CDX73251.1| BnaC06g36990D [Brassica napus]
Length=816

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 95/142 (67%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   +  +  N S+   LP+YN  LGACV+  N +Y ++CL+LMD + VGKNEITY  LL
Sbjct  155  ASEFIQALGGNDSISPLLPVYNYFLGACVKTRNGNYASRCLELMDQRRVGKNEITYAALL  214

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NLP+V+EI K    HY  SI+ LRKFIWSF++L D++SAY  LQ MV +  +G
Sbjct  215  KLAVLQRNLPSVNEILKHYVDHYSLSILSLRKFIWSFTRLGDLKSAYELLQHMVALASRG  274

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  K   GK+ + RLDIP P
Sbjct  275  E-LFVKFKSGKLHSTRLDIPIP  295



>ref|XP_010905784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X3 [Elaeis guineensis]
Length=814

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 102/151 (68%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A   +  + +N  V+  LP++N LL  C    ++   + CL+LM+ Q VGK
Sbjct  141  GYLKE----ALNWLTSLGENDHVNAALPMFNILLAGCGIKKSLKDADYCLELMESQHVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            +EITY++LLKLAV Q+NL AVHEIWK+CT++Y PSII LRKF+ SF+KL D+ESAY  LQ
Sbjct  197  SEITYWELLKLAVMQENLSAVHEIWKDCTRYYSPSIITLRKFVRSFTKLGDLESAYNVLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             M+ +  Q    ++ +A G+ R+ RLDIP P
Sbjct  257  LMMAIARQESASVTISATGRYRSSRLDIPIP  287



>ref|XP_010905783.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Elaeis guineensis]
Length=883

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 102/151 (68%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A   +  + +N  V+  LP++N LL  C    ++   + CL+LM+ Q VGK
Sbjct  118  GYLKE----ALNWLTSLGENDHVNAALPMFNILLAGCGIKKSLKDADYCLELMESQHVGK  173

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            +EITY++LLKLAV Q+NL AVHEIWK+CT++Y PSII LRKF+ SF+KL D+ESAY  LQ
Sbjct  174  SEITYWELLKLAVMQENLSAVHEIWKDCTRYYSPSIITLRKFVRSFTKLGDLESAYNVLQ  233

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             M+ +  Q    ++ +A G+ R+ RLDIP P
Sbjct  234  LMMAIARQESASVTISATGRYRSSRLDIPIP  264



>ref|XP_010905782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Elaeis guineensis]
Length=906

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 102/151 (68%), Gaps = 4/151 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A   +  + +N  V+  LP++N LL  C    ++   + CL+LM+ Q VGK
Sbjct  141  GYLKE----ALNWLTSLGENDHVNAALPMFNILLAGCGIKKSLKDADYCLELMESQHVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            +EITY++LLKLAV Q+NL AVHEIWK+CT++Y PSII LRKF+ SF+KL D+ESAY  LQ
Sbjct  197  SEITYWELLKLAVMQENLSAVHEIWKDCTRYYSPSIITLRKFVRSFTKLGDLESAYNVLQ  256

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             M+ +  Q    ++ +A G+ R+ RLDIP P
Sbjct  257  LMMAIARQESASVTISATGRYRSSRLDIPIP  287



>ref|XP_006302008.1| hypothetical protein CARUB_v10019985mg [Capsella rubella]
 gb|EOA34906.1| hypothetical protein CARUB_v10019985mg [Capsella rubella]
Length=619

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ + ++ S+   LPIYN  LGAC +M ++ + ++CL+LMD + VGKNEITY  LL
Sbjct  152  ASEFIHAVGEDDSISPVLPIYNYFLGACAKMRSVYHASKCLELMDQRRVGKNEITYAALL  211

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ NL AV++IW+    HY  +I+ LRKF+WS+++L D++SAY  LQ MVD+  + 
Sbjct  212  KLAVFQHNLSAVNDIWRHYFDHYSLNILSLRKFVWSYTRLGDLKSAYELLQYMVDLAVRR  271

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  ++ +GK+R+ RLDIP P
Sbjct  272  E-LYVQSNQGKLRSTRLDIPVP  292



>ref|XP_002299265.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE84070.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=733

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 102/149 (68%), Gaps = 4/149 (3%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  +++ + ++  ++  LP+YN  LGAC  M    Y +QCL LM+ +M+GK
Sbjct  100  GYLEE----ASNMIDFIGESHGIYPTLPVYNTFLGACSDMSRADYADQCLQLMERRMMGK  155

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            +E+TY  LLKLAV QQNL AV+EIW++  KH+ PSI+ L+KFIWSF++LRD++SAY  LQ
Sbjct  156  DEVTYIMLLKLAVSQQNLSAVYEIWEDYIKHFSPSILTLQKFIWSFTRLRDLKSAYEKLQ  215

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIP  483
             MV +  +G   +  ++ G++   R+++P
Sbjct  216  HMVVLAIRGNTFVQTSSRGQLYPSRVNVP  244



>ref|XP_009419232.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=793

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF  +N + +N  +HY  P++N  L  C    + ++V++CL+LM++Q+VGK+EIT+++LL
Sbjct  35   AFNWLNFLAENDRMHY-APMFNIFLSGCWSSKSFNHVDRCLELMENQLVGKSEITHWELL  93

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AVHEIWKE T++Y PS+I LRKFIW ++KL D++S    L+ ++ +  QG
Sbjct  94   KLAVLQRNLSAVHEIWKEYTRYYSPSVIMLRKFIWCYAKLGDLDSGNAALKHLLVLARQG  153

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
               LS +  G  ++  +DIP P K
Sbjct  154  SASLSISGTGNYQSSAVDIPIPTK  177



>ref|XP_006844144.1| hypothetical protein AMTR_s00006p00259530 [Amborella trichopoda]
 gb|ERN05819.1| hypothetical protein AMTR_s00006p00259530 [Amborella trichopoda]
Length=927

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 99/154 (64%), Gaps = 4/154 (3%)
 Frame = +1

Query  28   TMQGWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQM  207
            T  G+L E    A   +  + DN  +   LPIYN  L  CV+M N      CL LM+ + 
Sbjct  166  TKSGYLEE----ACNWLTFLGDNGRMKPSLPIYNIFLNGCVKMQNPVLAGYCLQLMEIRS  221

Query  208  VGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYL  387
            +GK+E+TY +LLKLAV+Q+NL AV EIW ECTK+Y PSI  L+KF+WSFSKL D+ SA++
Sbjct  222  IGKSEVTYCELLKLAVWQRNLSAVKEIWVECTKYYSPSITTLQKFVWSFSKLWDIGSAFV  281

Query  388  TLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
             LQQMV  +F+      ++ +G+  + RLDIP P
Sbjct  282  ILQQMVAQLFRANDSAVRSVDGRFHSSRLDIPIP  315



>ref|XP_009419231.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=796

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF  +N + +N  +HY  P++N  L  C    + ++V++CL+LM++Q+VGK+EIT+++LL
Sbjct  38   AFNWLNFLAENDRMHY-APMFNIFLSGCWSSKSFNHVDRCLELMENQLVGKSEITHWELL  96

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AVHEIWKE T++Y PS+I LRKFIW ++KL D++S    L+ ++ +  QG
Sbjct  97   KLAVLQRNLSAVHEIWKEYTRYYSPSVIMLRKFIWCYAKLGDLDSGNAALKHLLVLARQG  156

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
               LS +  G  ++  +DIP P K
Sbjct  157  SASLSISGTGNYQSSAVDIPIPTK  180



>ref|XP_010471778.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Camelina sativa]
Length=711

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ + ++ S+   LPIYN  LGAC +  +  + ++CL+LMD + VGKNEITY  LL
Sbjct  35   ASEFIHSVGEDDSISPILPIYNYFLGACAKARSGYHASKCLELMDQRSVGKNEITYAALL  94

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ+NL AV++IW+    HY  +I+ LRKFIWS+++L D++SAY  LQ MVD+  +G
Sbjct  95   KLAVFQRNLSAVNDIWRHYIDHYSLNIVSLRKFIWSYTRLGDLKSAYELLQYMVDLALRG  154

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  ++  GK+ + RLDIP P
Sbjct  155  E-LFVQSNRGKLHSTRLDIPVP  175



>ref|XP_010416540.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X2 [Camelina sativa]
Length=664

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ + ++ S+   LPIYN  LGAC +  +  +  +CL+LMD + VGKNEITY  LL
Sbjct  152  ASEFIHSVGEDDSISPILPIYNYFLGACAKTRSGYHARKCLELMDQRSVGKNEITYAALL  211

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ+NL AV++IW+    HY  +I+ LRKFIWS+++L D++SAY  LQ MVD+  +G
Sbjct  212  KLAVFQRNLSAVNDIWRHYIDHYSLNIVSLRKFIWSYTRLGDLKSAYELLQYMVDLALRG  271

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  ++  GK+ + RLDIP P
Sbjct  272  E-LFVQSRGGKLHSTRLDIPVP  292



>ref|XP_009419229.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=904

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF  +N + +N  +HY  P++N  L  C    + ++V++CL+LM++Q+VGK+EIT+++LL
Sbjct  146  AFNWLNFLAENDRMHY-APMFNIFLSGCWSSKSFNHVDRCLELMENQLVGKSEITHWELL  204

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AVHEIWKE T++Y PS+I LRKFIW ++KL D++S    L+ ++ +  QG
Sbjct  205  KLAVLQRNLSAVHEIWKEYTRYYSPSVIMLRKFIWCYAKLGDLDSGNAALKHLLVLARQG  264

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
               LS +  G  ++  +DIP P K
Sbjct  265  SASLSISGTGNYQSSAVDIPIPTK  288



>ref|XP_009419230.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=894

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF  +N + +N  +HY  P++N  L  C    + ++V++CL+LM++Q+VGK+EIT+++LL
Sbjct  146  AFNWLNFLAENDRMHY-APMFNIFLSGCWSSKSFNHVDRCLELMENQLVGKSEITHWELL  204

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AVHEIWKE T++Y PS+I LRKFIW ++KL D++S    L+ ++ +  QG
Sbjct  205  KLAVLQRNLSAVHEIWKEYTRYYSPSVIMLRKFIWCYAKLGDLDSGNAALKHLLVLARQG  264

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
               LS +  G  ++  +DIP P K
Sbjct  265  SASLSISGTGNYQSSAVDIPIPTK  288



>ref|XP_010471777.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Camelina sativa]
Length=828

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ + ++ S+   LPIYN  LGAC +  +  + ++CL+LMD + VGKNEITY  LL
Sbjct  152  ASEFIHSVGEDDSISPILPIYNYFLGACAKARSGYHASKCLELMDQRSVGKNEITYAALL  211

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ+NL AV++IW+    HY  +I+ LRKFIWS+++L D++SAY  LQ MVD+  +G
Sbjct  212  KLAVFQRNLSAVNDIWRHYIDHYSLNIVSLRKFIWSYTRLGDLKSAYELLQYMVDLALRG  271

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  ++  GK+ + RLDIP P
Sbjct  272  E-LFVQSNRGKLHSTRLDIPVP  292



>ref|XP_010416539.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X1 [Camelina sativa]
Length=828

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ + ++ S+   LPIYN  LGAC +  +  +  +CL+LMD + VGKNEITY  LL
Sbjct  152  ASEFIHSVGEDDSISPILPIYNYFLGACAKTRSGYHARKCLELMDQRSVGKNEITYAALL  211

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ+NL AV++IW+    HY  +I+ LRKFIWS+++L D++SAY  LQ MVD+  +G
Sbjct  212  KLAVFQRNLSAVNDIWRHYIDHYSLNIVSLRKFIWSYTRLGDLKSAYELLQYMVDLALRG  271

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  ++  GK+ + RLDIP P
Sbjct  272  E-LFVQSRGGKLHSTRLDIPVP  292



>ref|NP_001031285.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AEE35819.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=693

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = +1

Query  7    LLFSYPGTMQGWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCL  186
            LLF       G  L+    A   ++ +R++  +   LPIYN  LGAC +  ++ + ++CL
Sbjct  134  LLFIVKSLCNGGHLD---KASEFIHAVREDDRISPLLPIYNFFLGACARTRSVYHASKCL  190

Query  187  DLMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLR  366
            +LMD + VGKN ITY  LLKLAVFQ+NL  V++IWK    HY   I+ LR+FIWSF++L 
Sbjct  191  ELMDQRRVGKNGITYVALLKLAVFQRNLSTVNDIWKHYVNHYNLDILSLRRFIWSFTRLG  250

Query  367  DMESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
            D++SAY  LQ MV +  +G F + K+  GK+ + RL IP P K
Sbjct  251  DLKSAYELLQHMVYLALRGEFFV-KSNRGKLHSTRLYIPVPSK  292



>ref|NP_177755.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SGQ6.2|PP126_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g76280 
[Arabidopsis thaliana]
 gb|AEE35818.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=773

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = +1

Query  7    LLFSYPGTMQGWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCL  186
            LLF       G  L+    A   ++ +R++  +   LPIYN  LGAC +  ++ + ++CL
Sbjct  134  LLFIVKSLCNGGHLD---KASEFIHAVREDDRISPLLPIYNFFLGACARTRSVYHASKCL  190

Query  187  DLMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLR  366
            +LMD + VGKN ITY  LLKLAVFQ+NL  V++IWK    HY   I+ LR+FIWSF++L 
Sbjct  191  ELMDQRRVGKNGITYVALLKLAVFQRNLSTVNDIWKHYVNHYNLDILSLRRFIWSFTRLG  250

Query  367  DMESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
            D++SAY  LQ MV +  +G F + K+  GK+ + RL IP P K
Sbjct  251  DLKSAYELLQHMVYLALRGEFFV-KSNRGKLHSTRLYIPVPSK  292



>gb|AAF17637.1|AC009978_13 T23E18.21 [Arabidopsis thaliana]
Length=800

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ +R++  +   LPIYN  LGAC +  ++ + ++CL+LMD + VGKN ITY  LL
Sbjct  102  ASEFIHAVREDDRISPLLPIYNFFLGACARTRSVYHASKCLELMDQRRVGKNGITYVALL  161

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ+NL  V++IWK    HY   I+ LR+FIWSF++L D++SAY  LQ MV +  +G
Sbjct  162  KLAVFQRNLSTVNDIWKHYVNHYNLDILSLRRFIWSFTRLGDLKSAYELLQHMVYLALRG  221

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
             F + K+  GK+ + RL IP P K
Sbjct  222  EFFV-KSNRGKLHSTRLYIPVPSK  244



>ref|NP_001185409.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AEE35820.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=801

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ +R++  +   LPIYN  LGAC +  ++ + ++CL+LMD + VGKN ITY  LL
Sbjct  146  ASEFIHAVREDDRISPLLPIYNFFLGACARTRSVYHASKCLELMDQRRVGKNGITYVALL  205

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ+NL  V++IWK    HY   I+ LR+FIWSF++L D++SAY  LQ MV +  +G
Sbjct  206  KLAVFQRNLSTVNDIWKHYVNHYNLDILSLRRFIWSFTRLGDLKSAYELLQHMVYLALRG  265

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
             F + K+  GK+ + RL IP P K
Sbjct  266  EFFV-KSNRGKLHSTRLYIPVPSK  288



>ref|XP_003580982.2| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
[Brachypodium distachyon]
Length=886

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (65%), Gaps = 0/144 (0%)
 Frame = +1

Query  61   NAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQL  240
             A   +N +    S H  LPI+N  L AC  + N++    CL+ M   +VGK+EITY +L
Sbjct  174  EALNWLNSLGGKESTHSPLPIFNIFLSACASIRNLNDAESCLETMGIHLVGKSEITYCEL  233

Query  241  LKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQ  420
            LKLAVFQ+NL AV+++WK+C K+Y PSII  RKF+W+FS L D++SAY  LQ+MV +  +
Sbjct  234  LKLAVFQRNLSAVNDLWKDCNKYYSPSIIIQRKFLWAFSTLGDLQSAYQILQRMVVLAGE  293

Query  421  GGFLLSKTAEGKMRNLRLDIPAPC  492
                L  + + + ++ RLDIP P 
Sbjct  294  SPDHLRVSCKRRYQSTRLDIPVPA  317



>ref|XP_009419233.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X5 [Musa acuminata subsp. malaccensis]
Length=746

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  YFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEI  288
            ++ P++N  L  C    + ++V++CL+LM++Q+VGK+EIT+++LLKLAV Q+NL AVHEI
Sbjct  2    HYAPMFNIFLSGCWSSKSFNHVDRCLELMENQLVGKSEITHWELLKLAVLQRNLSAVHEI  61

Query  289  WKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNL  468
            WKE T++Y PS+I LRKFIW ++KL D++S    L+ ++ +  QG   LS +  G  ++ 
Sbjct  62   WKEYTRYYSPSVIMLRKFIWCYAKLGDLDSGNAALKHLLVLARQGSASLSISGTGNYQSS  121

Query  469  RLDIPAPCK  495
             +DIP P K
Sbjct  122  AVDIPIPTK  130



>ref|XP_003619828.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=895

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 101/173 (58%), Gaps = 32/173 (18%)
 Frame = +1

Query  67   FRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLK  246
            F +M+ + ++   +  LP+YN +L +  ++ N+    +CLDLM+ QM+GK+E+TY  LLK
Sbjct  120  FSIMDFLAESRHFYPVLPLYNSILRSYTEIQNLVQARKCLDLMEKQMIGKSEVTYTALLK  179

Query  247  --------------------------------LAVFQQNLPAVHEIWKECTKHYKPSIIF  330
                                            LAV Q+NLPAVH IW+E  K Y  SI+ 
Sbjct  180  VVIKSERTFNVKLLITWSGPRLKDHLYCPVSQLAVVQKNLPAVHIIWQEYIKLYSMSIVP  239

Query  331  LRKFIWSFSKLRDMESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            LRKF+WSF++L D++SAY TLQQMV +V +G   ++KT  GK+ + RLDIP P
Sbjct  240  LRKFVWSFTRLGDLKSAYRTLQQMVSLVMRGNISIAKTVYGKLYSTRLDIPVP  292



>ref|XP_008461449.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X3 [Cucumis melo]
Length=759

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 9/144 (6%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF L+N + ++  +   LP+YN  L AC    +  + +QCLDLMDH+MVGKNE TY +LL
Sbjct  143  AFGLINFLAESHVMFPVLPVYNCFLRACAIRQSTVHASQCLDLMDHRMVGKNEATYSELL  202

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+N  +VHEIW +  K+Y PS+  LRKFIWSF++L D+ SAY  LQ+MV      
Sbjct  203  KLAVCQENSSSVHEIWTDFVKNYSPSVSSLRKFIWSFARLGDLTSAYTALQKMV------  256

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
               L+  A G+ +   LDIP P +
Sbjct  257  --ALATGATGR-KLQSLDIPIPLR  277



>ref|XP_008461447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Cucumis melo]
Length=817

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 9/144 (6%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF L+N + ++  +   LP+YN  L AC    +  + +QCLDLMDH+MVGKNE TY +LL
Sbjct  143  AFGLINFLAESHVMFPVLPVYNCFLRACAIRQSTVHASQCLDLMDHRMVGKNEATYSELL  202

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+N  +VHEIW +  K+Y PS+  LRKFIWSF++L D+ SAY  LQ+MV      
Sbjct  203  KLAVCQENSSSVHEIWTDFVKNYSPSVSSLRKFIWSFARLGDLTSAYTALQKMV------  256

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
               L+  A G+ +   LDIP P +
Sbjct  257  --ALATGATGR-KLQSLDIPIPLR  277



>ref|XP_008461448.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Cucumis melo]
Length=761

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 9/144 (6%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF L+N + ++  +   LP+YN  L AC    +  + +QCLDLMDH+MVGKNE TY +LL
Sbjct  87   AFGLINFLAESHVMFPVLPVYNCFLRACAIRQSTVHASQCLDLMDHRMVGKNEATYSELL  146

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+N  +VHEIW +  K+Y PS+  LRKFIWSF++L D+ SAY  LQ+MV      
Sbjct  147  KLAVCQENSSSVHEIWTDFVKNYSPSVSSLRKFIWSFARLGDLTSAYTALQKMV------  200

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
               L+  A G+ +   LDIP P +
Sbjct  201  --ALATGATGR-KLQSLDIPIPLR  221



>ref|XP_004161905.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
[Cucumis sativus]
Length=806

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 100/153 (65%), Gaps = 13/153 (8%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF L+N + ++  +   LP YN  L AC    ++ + +QCLDLMDH+MVGK
Sbjct  153  GYLDE----AFGLINFLAESHVMFPALPAYNCFLRACAIRQSMVHASQCLDLMDHKMVGK  208

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            NE TY +LLKLAV Q+NL +VHEIW++  K+Y PS+  LRKFIWS++++ D++SAY  LQ
Sbjct  209  NEATYSELLKLAVCQKNLSSVHEIWRDFVKNYSPSVSSLRKFIWSYARMGDVKSAYTALQ  268

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAPCK  495
            +MV         L+  A G+ +   LDIP P +
Sbjct  269  KMVT--------LNNGAAGR-KLQSLDIPIPSR  292



>ref|XP_004139754.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
[Cucumis sativus]
Length=834

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 96/144 (67%), Gaps = 9/144 (6%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF L+N + ++  +   LP YN  L AC    ++ + +QCLDLMDH+MVGKNE TY +LL
Sbjct  158  AFGLINFLAESHVMFPALPAYNCFLRACAIRQSMVHASQCLDLMDHKMVGKNEATYSELL  217

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL +VHEIW++  K+Y PS+  LRKFIWS++++ D++SAY  LQ+MV      
Sbjct  218  KLAVCQKNLSSVHEIWRDFVKNYSPSVSSLRKFIWSYARMGDVKSAYTALQKMVT-----  272

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
               L+  A G+ +   LDIP P +
Sbjct  273  ---LNNGAAGR-KLQSLDIPIPSR  292



>ref|XP_010428682.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X2 [Camelina sativa]
Length=711

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ + ++  +   LP YN  LGAC +  +  + ++CL+LMD + VGKNEITY  LL
Sbjct  35   ASEFIHSVGEDDGIFPVLPTYNYFLGACAKTRSGYHASKCLELMDQRRVGKNEITYAALL  94

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ+NL AV++IW+    +Y  +I+ LRKFIWS++++ D++SAY  LQ MVD+  +G
Sbjct  95   KLAVFQRNLSAVNDIWRHYIDNYSLNILPLRKFIWSYTRMGDLKSAYELLQYMVDLALRG  154

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  ++  GK+ + RLDIP P
Sbjct  155  E-LFVQSNRGKLHSSRLDIPVP  175



>ref|XP_010428681.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
isoform X1 [Camelina sativa]
Length=828

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ + ++  +   LP YN  LGAC +  +  + ++CL+LMD + VGKNEITY  LL
Sbjct  152  ASEFIHSVGEDDGIFPVLPTYNYFLGACAKTRSGYHASKCLELMDQRRVGKNEITYAALL  211

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAVFQ+NL AV++IW+    +Y  +I+ LRKFIWS++++ D++SAY  LQ MVD+  +G
Sbjct  212  KLAVFQRNLSAVNDIWRHYIDNYSLNILPLRKFIWSYTRMGDLKSAYELLQYMVDLALRG  271

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
              L  ++  GK+ + RLDIP P
Sbjct  272  E-LFVQSNRGKLHSSRLDIPVP  292



>ref|XP_002889073.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65332.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=800

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (65%), Gaps = 6/144 (4%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   ++ + ++ S+   LP+YN  LGAC +  ++ + ++CL+LMD + VGKNEITY  LL
Sbjct  150  ASEFIHAVGEDDSISPILPVYNYFLGACAKTRSVYHASKCLELMDQRRVGKNEITYAALL  209

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            K     +NL AV++IWK    HY   I+ LRKFIWSF++L D++SAY  LQ MVD+  +G
Sbjct  210  K-----RNLSAVNDIWKHYVNHYSLDILPLRKFIWSFTRLGDLKSAYELLQHMVDLASRG  264

Query  424  GFLLSKTAEGKMRNLRLDIPAPCK  495
              L  K+  GK+ +  LDIP P K
Sbjct  265  E-LFVKSNRGKLHSTTLDIPVPAK  287



>ref|XP_006660737.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
[Oryza brachyantha]
Length=816

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 93/143 (65%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   NAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQL  240
             A   + ++ +  S H  LPI+N  L  CV     S V  CL+ M+  ++GK+EITY +L
Sbjct  94   EAIHWLTLLGEKDSNHLSLPIFNIFLSGCVSTTKQSDVEWCLEKMETCLLGKSEITYCEL  153

Query  241  LKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQ  420
            LKLAVF++NLPAVH+IWK+CT++Y PSII  RKF+ + + L D++SAY  +Q MV +  +
Sbjct  154  LKLAVFRRNLPAVHDIWKDCTRNYHPSIILHRKFVRALTILGDLQSAYRIMQHMVVLAGR  213

Query  421  GGFLLSKTAEGKMRNLRLDIPAP  489
                +  +++G+ +  RLDIP P
Sbjct  214  STDHMRGSSKGRYQRSRLDIPVP  236



>gb|KFK42046.1| hypothetical protein AALP_AA2G204700 [Arabis alpina]
Length=823

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = +1

Query  115  LPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWK  294
            LP+YN  LGAC +  + +Y ++CL+LMD + VGK+E+TY  LLKLAVFQ+NL +V+EI K
Sbjct  168  LPVYNHFLGACAKTSSWNYASKCLELMDQRRVGKDELTYIALLKLAVFQRNLSSVNEILK  227

Query  295  ECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRL  474
                HY  +I  L++FIWSFS+L D+++AY  LQ MV +  +G   + +   GK+ + RL
Sbjct  228  HYVDHYSLNIRSLKRFIWSFSRLGDLKTAYELLQHMVALASRGEPFV-EFNRGKLHSTRL  286

Query  475  DIPAP  489
            DIP P
Sbjct  287  DIPIP  291



>ref|XP_010094576.1| hypothetical protein L484_024872 [Morus notabilis]
 gb|EXB56330.1| hypothetical protein L484_024872 [Morus notabilis]
Length=774

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = +1

Query  61   NAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQL  240
             AF+L+N + ++  ++  L IYN  LG C ++ +I + NQCLDLMD +MV KN++TY QL
Sbjct  147  EAFQLINFLGESQGIYPLLSIYNCFLGYCAKVKSIDHANQCLDLMDRRMVEKNQVTYVQL  206

Query  241  LKLAVFQQNLPAVHEIWKECTKHYKPSII--FLRKFIWSFSKLRDMESAYLTLQQMVDMV  414
            LKLAV+Q++L  V E+WKEC   Y P+II   LR+FI S ++L D++SAY  LQ+M+ + 
Sbjct  207  LKLAVWQKDLFTVQEMWKECILKYSPNIICLTLRRFICSLARLGDLKSAYEALQKMMVLA  266

Query  415  FQGG  426
             +G 
Sbjct  267  IRGS  270



>gb|EEC84742.1| hypothetical protein OsI_31738 [Oryza sativa Indica Group]
Length=910

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   + ++ +  S H +LPI+N  L  C      S +  CL+ M+   +GK+EITY +LL
Sbjct  191  AIHWLTLLVEKESSHNYLPIFNIFLSGCGSTTKQSDIEGCLEKMETYFLGKSEITYCELL  250

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AVH+IWK+CT++Y PSII  RKF+ + + L D+ SAY  +Q MV  V  G
Sbjct  251  KLAVSQRNLSAVHDIWKDCTRNYNPSIILQRKFVRALTTLGDLRSAYRIMQHMV--VLAG  308

Query  424  GFLLSKTAEGKMRNLRLDIPAPC  492
                    +G+ +  RLDIP P 
Sbjct  309  RNTDHLRGKGRYQRSRLDIPVPA  331



>gb|EAZ45091.1| hypothetical protein OsJ_29730 [Oryza sativa Japonica Group]
Length=874

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   + ++ +  S H +LPI+N  L  C      S +  CL+ M+   +GK+EITY +LL
Sbjct  155  AIHWLTLLVEKESSHNYLPIFNIFLSGCGSTTKQSDIEGCLEKMETYFLGKSEITYCELL  214

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q+NL AVH+IWK+CT++Y PSII  RKF+ + + L D+ SAY  +Q MV  V  G
Sbjct  215  KLAVSQRNLSAVHDIWKDCTRNYNPSIILQRKFVRALTTLGDLRSAYRIMQHMV--VLAG  272

Query  424  GFLLSKTAEGKMRNLRLDIPAPC  492
                    +G+ +  RLDIP P 
Sbjct  273  RNTDHLRGKGRYQRSRLDIPVPA  295



>ref|XP_004957099.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like 
[Setaria italica]
Length=786

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   + ++ +  S H  LP +N  L AC    N+  V  CL+ M++ ++GK+EITY +LL
Sbjct  87   ALHWLMLLGEKESTHATLPFFNIFLNACGSSANLKDVECCLETMENYLLGKSEITYCELL  146

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            K+AV QQNLPAV++IWK+CT++Y PSII  R+ + + +   D++SAY  LQ MV    Q 
Sbjct  147  KIAVLQQNLPAVYDIWKDCTRYYSPSIITQRRILRALTAFGDLQSAYHILQHMVTSAAQR  206

Query  424  GFLLSKTAEGKMRNLRLDIP  483
               L  +++ + ++ RLDIP
Sbjct  207  SEHLRLSSKRRYQSSRLDIP  226



>ref|XP_008652830.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X5 [Zea mays]
Length=662

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 91/142 (64%), Gaps = 1/142 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   + ++ +  S H   PI+N  L AC +  N+     CL+++++  +GK+EITY +LL
Sbjct  145  ALHWLALLGEKESTHATTPIFNIFLNACGRA-NLKDAENCLEILENLFLGKSEITYCELL  203

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q NLPA ++IWKEC+++Y PSI+  R+FI + + L D++SAY  LQ MV +  Q 
Sbjct  204  KLAVLQGNLPAAYDIWKECSRYYSPSIVTQRRFIRALTALGDLQSAYHILQHMVALAAQS  263

Query  424  GFLLSKTAEGKMRNLRLDIPAP  489
               L  +++ + R+ RLDIP P
Sbjct  264  CDYLRVSSKRRYRSSRLDIPVP  285



>ref|XP_002462526.1| hypothetical protein SORBIDRAFT_02g027390 [Sorghum bicolor]
 gb|EER99047.1| hypothetical protein SORBIDRAFT_02g027390 [Sorghum bicolor]
Length=769

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 89/143 (62%), Gaps = 0/143 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   + ++ +  S H  +PI+N  L A     ++     CL++++   +GK+EITY +LL
Sbjct  69   ALHWLAVLGEKESTHATIPIFNIFLNAFGSRADLKDAECCLEILESLFLGKSEITYCELL  128

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q NLPA ++IWK+C+++Y PSII  R+FI + + L D++SAY  LQ MV +  + 
Sbjct  129  KLAVLQGNLPAAYDIWKDCSRYYSPSIITQRRFIRALTALGDLQSAYHILQHMVVLAARS  188

Query  424  GFLLSKTAEGKMRNLRLDIPAPC  492
               L  +++ + ++ RLDIP P 
Sbjct  189  SDYLRVSSKRRYQSSRLDIPVPA  211



>ref|XP_008652828.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X4 [Zea mays]
 ref|XP_008652829.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X4 [Zea mays]
Length=744

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 91/143 (64%), Gaps = 1/143 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   + ++ +  S H   PI+N  L AC +  N+     CL+++++  +GK+EITY +LL
Sbjct  35   ALHWLALLGEKESTHATTPIFNIFLNACGRA-NLKDAENCLEILENLFLGKSEITYCELL  93

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q NLPA ++IWKEC+++Y PSI+  R+FI + + L D++SAY  LQ MV +  Q 
Sbjct  94   KLAVLQGNLPAAYDIWKECSRYYSPSIVTQRRFIRALTALGDLQSAYHILQHMVALAAQS  153

Query  424  GFLLSKTAEGKMRNLRLDIPAPC  492
               L  +++ + R+ RLDIP P 
Sbjct  154  CDYLRVSSKRRYRSSRLDIPVPA  176



>ref|XP_008652825.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Zea mays]
Length=854

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 91/143 (64%), Gaps = 1/143 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   + ++ +  S H   PI+N  L AC +  N+     CL+++++  +GK+EITY +LL
Sbjct  145  ALHWLALLGEKESTHATTPIFNIFLNACGRA-NLKDAENCLEILENLFLGKSEITYCELL  203

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q NLPA ++IWKEC+++Y PSI+  R+FI + + L D++SAY  LQ MV +  Q 
Sbjct  204  KLAVLQGNLPAAYDIWKECSRYYSPSIVTQRRFIRALTALGDLQSAYHILQHMVALAAQS  263

Query  424  GFLLSKTAEGKMRNLRLDIPAPC  492
               L  +++ + R+ RLDIP P 
Sbjct  264  CDYLRVSSKRRYRSSRLDIPVPA  286



>ref|XP_008652826.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Zea mays]
Length=851

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 91/143 (64%), Gaps = 1/143 (1%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A   + ++ +  S H   PI+N  L AC +  N+     CL+++++  +GK+EITY +LL
Sbjct  142  ALHWLALLGEKESTHATTPIFNIFLNACGRA-NLKDAENCLEILENLFLGKSEITYCELL  200

Query  244  KLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQG  423
            KLAV Q NLPA ++IWKEC+++Y PSI+  R+FI + + L D++SAY  LQ MV +  Q 
Sbjct  201  KLAVLQGNLPAAYDIWKECSRYYSPSIVTQRRFIRALTALGDLQSAYHILQHMVALAAQS  260

Query  424  GFLLSKTAEGKMRNLRLDIPAPC  492
               L  +++ + R+ RLDIP P 
Sbjct  261  CDYLRVSSKRRYRSSRLDIPVPA  283



>gb|EMT23079.1| hypothetical protein F775_02463 [Aegilops tauschii]
Length=988

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 96/166 (58%), Gaps = 25/166 (15%)
 Frame = +1

Query  61   NAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQL  240
             A +L+ ++ +    +  LPI+N  L AC    N++    CL++M++ ++GK+EIT+ +L
Sbjct  165  EALKLLTLLGEKECSYAALPIFNIFLSACST--NLNDAESCLEIMENHLLGKSEITFCEL  222

Query  241  LK-----------------------LAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWS  351
            LK                       + V Q+NL AVH++WK+CT++Y PSI+  RKF+ +
Sbjct  223  LKKFSFISGEEVLVYQNLPVVAATMVVVLQRNLSAVHDLWKDCTRYYSPSIVTQRKFVKA  282

Query  352  FSKLRDMESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            FS L D++SAY  LQ+MV +  +    L  +++ + ++ RLDIP P
Sbjct  283  FSTLGDLQSAYRILQRMVVLAGERTDHLRVSSKRRCQSTRLDIPVP  328



>gb|KHN12600.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=748

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    AF +++ +  +  ++  LP+YN LL +C  M NI   ++CLDLM+ +MVGK
Sbjct  137  GYLEE----AFDIVDYLGGSQRLYPVLPLYNSLLRSCTTMQNIIQASRCLDLMEKKMVGK  192

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKL  363
            NE+TY +LLKLAV Q+NLPA H IW+E  K+Y  +I+ L +FIWSF+ +
Sbjct  193  NEVTYIELLKLAVLQKNLPAAHLIWQEYIKNYSMTIMALDRFIWSFTSI  241



>ref|XP_010061152.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Eucalyptus grandis]
 ref|XP_010061154.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X1 [Eucalyptus grandis]
 gb|KCW68072.1| hypothetical protein EUGRSUZ_F01756 [Eucalyptus grandis]
Length=627

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = +1

Query  193  MDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDM  372
            M+ ++VGKNE TY +LL++AV++QNL AVH IWK+ +KHY   +  LRKFIWSF++LRD+
Sbjct  1    MECRLVGKNEATYLELLEIAVWKQNLFAVHHIWKDYSKHYNFCLTSLRKFIWSFTRLRDL  60

Query  373  ESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +SAY +LQ MV +  +G  L ++ AE    + +LDIP P
Sbjct  61   KSAYESLQLMVALATEGT-LSNRYAERASHSPKLDIPIP  98



>ref|XP_008804416.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X2 [Phoenix dactylifera]
Length=846

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 80/151 (53%), Gaps = 41/151 (27%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+  +R+N  V+  LP++N LL  C    ++   + C++LM+ Q+VGK
Sbjct  141  GYLKE----ALNLLTSLRENDHVNAALPMFNILLTGCGNKKSLEDADYCMELMESQLVGK  196

Query  217  NEITYYQLLKLAVFQQNLPAVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQ  396
            +EITY +LLKLAV Q+NL AVHEIWK+C++                      E+A +T+ 
Sbjct  197  SEITYCELLKLAVMQENLSAVHEIWKDCSRQ---------------------ENASVTI-  234

Query  397  QMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
                           +A G+ R+ RLDIP P
Sbjct  235  ---------------SATGRYRSSRLDIPIP  250



>ref|XP_008652827.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X3 [Zea mays]
Length=794

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 79/133 (59%), Gaps = 10/133 (8%)
 Frame = +1

Query  124  YNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLK----------LAVFQQNLP  273
            ++ +L  C +  +  +V + L+LM+ + +G ++  Y  +++          LAV Q NLP
Sbjct  94   FSYILEYCAEAPDPLFVMETLELMEEKAIGMSKSIYRYVIRALSRGGYAKELAVLQGNLP  153

Query  274  AVHEIWKECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGGFLLSKTAEG  453
            A ++IWKEC+++Y PSI+  R+FI + + L D++SAY  LQ MV +  Q    L  +++ 
Sbjct  154  AAYDIWKECSRYYSPSIVTQRRFIRALTALGDLQSAYHILQHMVALAAQSCDYLRVSSKR  213

Query  454  KMRNLRLDIPAPC  492
            + R+ RLDIP P 
Sbjct  214  RYRSSRLDIPVPA  226



>gb|KGN44445.1| hypothetical protein Csa_7G291160 [Cucumis sativus]
Length=236

 Score = 63.2 bits (152),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   NAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQL  240
             AF L+N + ++  +   LP YN  L AC    ++ + +QCLDLMDH+MVGKNE TY +L
Sbjct  142  EAFGLINFLAESHVMFPALPAYNCFLRACAIRQSMVHASQCLDLMDHKMVGKNEATYSEL  201

Query  241  LKLAVF  258
            LK   F
Sbjct  202  LKSKRF  207


 Score = 29.3 bits (64),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  5    CYYLAIQALCKGGYLNE  55
            C  L I+ALCKGGYL+E
Sbjct  126  CSLLMIEALCKGGYLDE  142


 Score = 25.0 bits (53),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = +3

Query  315  TQHYFSTEVYMVLFKVKRYGICLPDSTTNGRY  410
            ++ + + EVYMVL K  R  IC+  +  +G +
Sbjct  204  SKRFIAEEVYMVLRKDGRCEICIYCTAKDGDF  235



>gb|KEH26675.1| PPR containing plant-like protein [Medicago truncatula]
Length=611

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  319  SIIFLRKFIWSFSKLRDMESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            SI+ LRKF+WSF++L D++SAY TLQQMV +V +G   ++KT  GK+ + RLDIP P
Sbjct  2    SIVPLRKFVWSFTRLGDLKSAYRTLQQMVSLVMRGNISIAKTVYGKLYSTRLDIPVP  58



>gb|KEH40253.1| PPR containing plant-like protein [Medicago truncatula]
 gb|KEH40261.1| PPR containing plant-like protein [Medicago truncatula]
Length=301

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            AF +M+ + + P  +  LPIYN +L +C + HN+    +CLDLM+ +M+GKNE+TY  LL
Sbjct  126  AFSIMDFLSETPQFYPLLPIYNGILRSCTKTHNLIQATKCLDLMEKKMIGKNEVTYTALL  185

Query  244  KL  249
            +L
Sbjct  186  QL  187



>ref|XP_010692816.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=740

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 48/70 (69%), Gaps = 4/70 (6%)
 Frame = +1

Query  37   GWLLE*GINAFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGK  216
            G+L E    A  L+N + +N  + + LP+YN LL +CV+M ++   +QCLD+M+HQ +GK
Sbjct  144  GYLEE----ALHLVNFIGENNRISFILPLYNNLLSSCVKMKDVMLFHQCLDMMEHQNLGK  199

Query  217  NEITYYQLLK  246
            NE+TY  LLK
Sbjct  200  NEVTYSALLK  209



>ref|XP_002983366.1| hypothetical protein SELMODRAFT_445481 [Selaginella moellendorffii]
 gb|EFJ15708.1| hypothetical protein SELMODRAFT_445481 [Selaginella moellendorffii]
Length=758

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 0/101 (0%)
 Frame = +1

Query  112  FLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLLKLAVFQQNLPAVHEIW  291
            ++ ++N +L  C    +  + ++CL LM  + V KN+ TY +LL+LA  +Q+L     +W
Sbjct  172  YVFMFNSVLNGCASAGSSIHADKCLKLMTSRKVEKNQQTYIELLRLAGKKQDLSLTKSLW  231

Query  292  KECTKHYKPSIIFLRKFIWSFSKLRDMESAYLTLQQMVDMV  414
             E    Y PS    R +I S  +  D+  A + LQ+M+D +
Sbjct  232  IELKSIYSPSFNSYRTYIISLCRGSDLGEALIILQEMLDHI  272



>gb|KHN12591.1| Pentatricopeptide repeat-containing protein, partial [Glycine 
soja]
Length=273

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  337  KFIWSFSKLRDMESAYLTLQQMVDMVFQGGFLLSKTAEGKMRNLRLDIPAP  489
            +FIWSF++L D+ESAY  L QMV +  +G   +++T  GK+   RLDIP P
Sbjct  14   RFIWSFTRLGDLESAYKILLQMVSLATRGNIPIARTVHGKVYTNRLDIPVP  64



>ref|XP_001759922.1| predicted protein [Physcomitrella patens]
 gb|EDQ75426.1| predicted protein [Physcomitrella patens]
Length=804

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  64   AFRLMNIMRDNPSVHYFLPIYNKLLGACVQMHNISYVNQCLDLMDHQMVGKNEITYYQLL  243
            A  L++++  +  V   L +YN +L  C    +  + ++CL LMD Q V K+E++Y +L+
Sbjct  40   ALELLSVLSRSKGVKANLVMYNTVLNGCSLAKSKVHADKCLALMDRQGVAKDEMSYVELI  99

Query  244  KLAVFQQNLPAVHEIWKE  297
            KL+   Q+  +V   W+E
Sbjct  100  KLSGLLQDTSSVKRWWEE  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190