BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H11

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618592.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    201   1e-61   Nicotiana tomentosiformis
ref|XP_009785468.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    201   3e-61   Nicotiana sylvestris
ref|XP_006365808.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    199   1e-60   
ref|XP_004252860.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    199   2e-60   
gb|EYU44192.1|  hypothetical protein MIMGU_mgv1a013253mg                198   3e-60   Erythranthe guttata [common monkey flower]
gb|KJB80515.1|  hypothetical protein B456_013G101000                    197   5e-60   Gossypium raimondii
ref|XP_007045631.1|  Ribosomal protein L6 family                        197   8e-60   Theobroma cacao [chocolate]
gb|KHG21050.1|  50S ribosomal L6, chloroplastic -like protein           195   5e-59   Gossypium arboreum [tree cotton]
ref|XP_003548187.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    195   5e-59   Glycine max [soybeans]
gb|ACU23468.1|  unknown                                                 194   7e-59   Glycine max [soybeans]
ref|XP_011098741.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    194   1e-58   Sesamum indicum [beniseed]
gb|KHN42547.1|  50S ribosomal protein L6, chloroplastic                 193   2e-58   Glycine soja [wild soybean]
ref|XP_011005106.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    193   2e-58   Populus euphratica
ref|XP_002279657.2|  PREDICTED: 50S ribosomal protein L6, chlorop...    193   2e-58   Vitis vinifera
ref|XP_002320459.1|  ribosomal protein L6                               193   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_003534001.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    192   7e-58   Glycine max [soybeans]
gb|AFK43716.1|  unknown                                                 190   3e-57   Medicago truncatula
ref|XP_010522339.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    189   6e-57   Tarenaya hassleriana [spider flower]
ref|XP_008379631.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    189   7e-57   Malus domestica [apple tree]
ref|XP_008223584.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    189   1e-56   Prunus mume [ume]
ref|XP_007223925.1|  hypothetical protein PRUPE_ppa011034mg             187   3e-56   Prunus persica
ref|XP_004514093.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    186   1e-55   Cicer arietinum [garbanzo]
ref|XP_008455431.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    186   2e-55   Cucumis melo [Oriental melon]
gb|KDP25836.1|  hypothetical protein JCGZ_22866                         185   3e-55   Jatropha curcas
ref|XP_010557010.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    185   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_008342000.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    184   5e-55   
gb|ACU19091.1|  unknown                                                 184   7e-55   Glycine max [soybeans]
ref|XP_004287942.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    184   1e-54   Fragaria vesca subsp. vesca
ref|XP_006418054.1|  hypothetical protein EUTSA_v10008693mg             183   1e-54   Eutrema salsugineum [saltwater cress]
ref|XP_009353272.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    183   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_004144493.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    182   3e-54   Cucumis sativus [cucumbers]
ref|XP_010689735.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    182   4e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007152280.1|  hypothetical protein PHAVU_004G116200g             182   5e-54   Phaseolus vulgaris [French bean]
ref|XP_006447548.1|  hypothetical protein CICLE_v10016578mg             180   3e-53   Citrus clementina [clementine]
ref|XP_002892273.1|  EMB2394                                            178   2e-52   
ref|XP_010276744.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    178   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010100629.1|  50S ribosomal protein L6                           177   2e-52   Morus notabilis
ref|XP_009401055.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    177   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_172011.1|  50S ribosomal protein L6                              177   4e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDY46838.1|  BnaA10g03220D                                          177   5e-52   Brassica napus [oilseed rape]
ref|XP_010484767.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    176   7e-52   Camelina sativa [gold-of-pleasure]
emb|CDY70611.1|  BnaAnng34360D                                          176   8e-52   Brassica napus [oilseed rape]
ref|XP_006304184.1|  hypothetical protein CARUB_v10010237mg             176   8e-52   Capsella rubella
ref|XP_009119188.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    176   8e-52   Brassica rapa
ref|XP_010051031.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    176   1e-51   Eucalyptus grandis [rose gum]
ref|XP_010457601.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    176   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010243082.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    175   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010475192.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    174   7e-51   Camelina sativa [gold-of-pleasure]
emb|CDY49511.1|  BnaC05g03230D                                          172   2e-50   Brassica napus [oilseed rape]
gb|ACG25590.1|  50S ribosomal protein L6                                171   9e-50   Zea mays [maize]
ref|XP_010907839.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    171   1e-49   Elaeis guineensis
dbj|BAH20405.1|  AT1G05190                                              169   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118616.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    169   4e-49   Brassica rapa
ref|XP_003557902.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    169   4e-49   Brachypodium distachyon [annual false brome]
ref|XP_006650092.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    169   5e-49   Oryza brachyantha
emb|CDY06163.1|  BnaA09g50400D                                          169   6e-49   
ref|NP_001050139.1|  Os03g0356300                                       167   2e-48   
ref|NP_001051292.1|  Os03g0751400                                       167   2e-48   
gb|EAZ26952.1|  hypothetical protein OsJ_10878                          167   2e-48   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ92513.1|  predicted protein                                      167   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002465260.1|  hypothetical protein SORBIDRAFT_01g035090          166   8e-48   Sorghum bicolor [broomcorn]
dbj|BAJ84917.1|  predicted protein                                      166   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91776.1|  predicted protein                                      165   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO41664.1|  hypothetical protein CISIN_1g027306mg                   163   6e-47   Citrus sinensis [apfelsine]
gb|EMT33559.1|  50S ribosomal protein L6, chloroplastic                 165   1e-46   
gb|EPS61113.1|  hypothetical protein M569_13685                         162   1e-46   Genlisea aurea
ref|XP_004984341.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    163   1e-46   Setaria italica
ref|NP_001148555.1|  50S ribosomal protein L6                           162   3e-46   Zea mays [maize]
gb|EMS56589.1|  50S ribosomal protein L6, chloroplastic                 162   9e-46   Triticum urartu
ref|NP_001152325.1|  50S ribosomal protein L6                           159   3e-45   Zea mays [maize]
ref|XP_006858065.1|  hypothetical protein AMTR_s00062p00057610          158   6e-45   Amborella trichopoda
emb|CDP19076.1|  unnamed protein product                                155   2e-43   Coffea canephora [robusta coffee]
gb|ABK21300.1|  unknown                                                 153   7e-43   Picea sitchensis
ref|XP_008680805.1|  PREDICTED: 50S ribosomal protein L6 isoform X1     148   1e-40   Zea mays [maize]
ref|XP_006376781.1|  hypothetical protein POPTR_0012s06340g             145   6e-40   
ref|XP_002979598.1|  hypothetical protein SELMODRAFT_110948             135   4e-36   
ref|XP_008802994.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    131   5e-35   
ref|XP_002977678.1|  hypothetical protein SELMODRAFT_107348             132   7e-35   
ref|XP_001771522.1|  predicted protein                                  132   1e-34   
ref|XP_001784938.1|  predicted protein                                  129   2e-33   
tpg|DAA45423.1|  TPA: hypothetical protein ZEAMMB73_235465              122   6e-32   
gb|KEH16126.1|  50S ribosomal protein L6                                121   3e-31   Medicago truncatula
emb|CDY41816.1|  BnaC02g12270D                                          113   1e-27   Brassica napus [oilseed rape]
ref|XP_006376783.1|  hypothetical protein POPTR_0012s06360g             107   1e-25   
gb|KIZ02220.1|  50S ribosomal protein L6                                103   5e-24   Monoraphidium neglectum
ref|XP_005849229.1|  hypothetical protein CHLNCDRAFT_34831              103   9e-24   Chlorella variabilis
ref|XP_011399322.1|  50S ribosomal protein L6, chloroplastic          99.4    2e-22   Auxenochlorella protothecoides
ref|WP_020691491.1|  50S ribosomal protein L6                         97.4    6e-22   Aeromicrobium massiliense
ref|WP_030473453.1|  50S ribosomal protein L6                         95.5    5e-21   Lechevalieria
ref|WP_007472094.1|  50S ribosomal protein L6                         94.7    9e-21   Segniliparus rugosus
ref|WP_017721159.1|  50S ribosomal protein L6                         94.0    2e-20   Oscillatoria sp. PCC 10802
ref|XP_001421323.1|  Plastid ribosomal protein L6 large ribosomal...  94.4    2e-20   Ostreococcus lucimarinus CCE9901
ref|WP_017325553.1|  50S ribosomal protein L6                         92.8    4e-20   Synechococcus sp. PCC 7336
ref|XP_002505297.1|  predicted protein                                93.6    4e-20   Micromonas commoda
ref|WP_014349107.1|  50S ribosomal protein L6                         92.8    4e-20   Nocardia cyriacigeorgica
ref|WP_023647009.1|  50S ribosomal protein L6                         92.4    6e-20   actinobacterium LLX17
gb|KBT33208.1|  50S ribosomal protein L6 RplF                         90.1    9e-20   Mycobacterium tuberculosis UT0119
ref|WP_030478310.1|  50S ribosomal protein L6                         91.7    1e-19   Lentzea albidocapillata
ref|WP_015105249.1|  50S ribosomal protein L6                         91.7    1e-19   Saccharothrix espanaensis
ref|WP_015805277.1|  50S ribosomal protein L6                         91.3    1e-19   Actinosynnema
ref|WP_013139775.1|  50S ribosomal protein L6                         91.3    1e-19   Segniliparus rotundus
ref|WP_036533248.1|  50S ribosomal protein L6                         90.9    2e-19   Nocardia cyriacigeorgica
ref|XP_005643355.1|  ribosomal protein L6                             91.7    2e-19   Coccomyxa subellipsoidea C-169
ref|WP_023358196.1|  50S ribosomal protein L6                         90.9    2e-19   Actinoplanes friuliensis
ref|WP_039795552.1|  50S ribosomal protein L6                         90.9    2e-19   Nocardia araoensis
ref|WP_018908047.1|  50S ribosomal protein L6                         90.9    2e-19   Salinispora arenicola
ref|WP_028479346.1|  50S ribosomal protein L6                         90.9    2e-19   Nocardia sp. CNY236
ref|WP_019500654.1|  50S ribosomal protein L6                         90.5    3e-19   Pseudanabaena sp. PCC 6802
ref|WP_013016481.1|  50S ribosomal protein L6                         90.5    3e-19   Stackebrandtia nassauensis
ref|WP_014847225.1|  50S ribosomal protein L6                         90.5    3e-19   Pseudopropionibacterium propionicum
ref|WP_007078621.1|  50S ribosomal protein L6                         90.1    3e-19   Aeromicrobium marinum
ref|WP_015227140.1|  50S ribosomal protein L6                         90.1    4e-19   Halothece sp. PCC 7418
ref|WP_011612508.1|  50S ribosomal protein L6                         90.1    4e-19   Trichodesmium erythraeum
ref|WP_040788652.1|  50S ribosomal protein L6                         90.1    4e-19   Nocardia paucivorans
ref|WP_010311645.1|  50S ribosomal protein L6                         90.1    5e-19   Synechococcus sp. CB0101
ref|WP_024800413.1|  50S ribosomal protein L6                         89.7    5e-19   Nocardia sp. BMG51109
ref|WP_040864897.1|  50S ribosomal protein L6                         89.7    5e-19   Nocardia exalbida
ref|WP_043687380.1|  50S ribosomal protein L6                         89.7    5e-19   Nocardia abscessus
ref|WP_022605574.1|  50S ribosomal protein L6                         89.7    5e-19   Rubidibacter lacunae
ref|WP_034304256.1|  50S ribosomal protein L6                         89.7    5e-19   Amycolatopsis lurida
emb|CEG01824.1|  Ribosomal protein L6, conserved site                 90.5    6e-19   Ostreococcus tauri
ref|WP_012184316.1|  50S ribosomal protein L6                         89.7    6e-19   Salinispora arenicola
ref|WP_028191074.1|  50S ribosomal protein L6                         89.7    7e-19   Salinispora arenicola
ref|WP_008275484.1|  50S ribosomal protein L6                         89.4    7e-19   Cyanothece sp. CCY0110
ref|WP_024125573.1|  50S ribosomal protein L6                         89.7    7e-19   Thermosynechococcus sp. NK55a
ref|WP_009543883.1|  MULTISPECIES: 50S ribosomal protein L6           89.4    7e-19   Cyanothece
ref|WP_031712151.1|  50S ribosomal protein L6                         89.4    8e-19   Mycobacterium tuberculosis
ref|WP_028848728.1|  50S ribosomal protein L6                         89.4    8e-19   Thermocrispum agreste
ref|WP_007073021.1|  50S ribosomal protein L6                         89.4    8e-19   Micromonospora sp. ATCC 39149
ref|WP_031711030.1|  50S ribosomal protein L6                         89.4    9e-19   Mycobacterium tuberculosis
ref|WP_007465267.1|  50S ribosomal protein L6                         89.4    9e-19   Micromonospora lupini
ref|WP_013735942.1|  50S ribosomal protein L6                         89.0    9e-19   Verrucosispora
ref|WP_003403673.1|  MULTISPECIES: 50S ribosomal protein L6           89.0    1e-18   Mycobacterium
ref|WP_031715051.1|  50S ribosomal protein L6                         89.0    1e-18   Mycobacterium tuberculosis
ref|WP_006946061.1|  MULTISPECIES: 50S ribosomal protein L6           89.0    1e-18   Dermacoccus
gb|AFE12033.1|  50S ribosomal protein L6                              89.0    1e-18   Mycobacterium tuberculosis RGTB423
ref|WP_015626848.1|  50S ribosomal protein L6                         89.0    1e-18   
ref|WP_033436726.1|  50S ribosomal protein L6                         89.0    1e-18   Saccharothrix sp. NRRL B-16314
ref|WP_007031044.1|  50S ribosomal protein L6                         89.0    1e-18   Amycolatopsis decaplanina
ref|WP_030532876.1|  MULTISPECIES: 50S ribosomal protein L6           89.0    1e-18   Prauserella rugosa
ref|WP_025777917.1|  50S ribosomal protein L6                         89.0    1e-18   Brevibacterium
ref|WP_037270096.1|  50S ribosomal protein L6                         89.0    1e-18   Kibdelosporangium aridum
ref|WP_008191191.1|  50S ribosomal protein L6                         89.0    1e-18   Moorea producens
ref|WP_015955691.1|  50S ribosomal protein L6                         89.0    1e-18   Cyanothece sp. PCC 7424
ref|WP_018400614.1|  50S ribosomal protein L6                         88.6    1e-18   filamentous cyanobacterium ESFC-1
ref|WP_018682818.1|  50S ribosomal protein L6                         88.6    1e-18   Actinokineospora enzanensis
ref|WP_039206324.1|  50S ribosomal protein L6                         88.6    1e-18   Brevibacterium linens
ref|WP_040716840.1|  50S ribosomal protein L6                         88.6    1e-18   Nocardia veterana
ref|WP_026922777.1|  50S ribosomal protein L6                         88.6    1e-18   Glycomyces arizonensis
ref|WP_040157837.1|  50S ribosomal protein L6                         88.6    2e-18   Nigerium massiliense
ref|WP_015231117.1|  50S ribosomal protein L6                         88.6    2e-18   Dactylococcopsis salina
ref|WP_033428587.1|  50S ribosomal protein L6                         88.6    2e-18   Saccharothrix syringae
ref|WP_026929011.1|  50S ribosomal protein L6                         88.6    2e-18   Glycomyces tenuis
ref|WP_017986620.1|  50S ribosomal protein L6                         88.6    2e-18   Amycolatopsis
ref|WP_026424131.1|  50S ribosomal protein L6                         88.6    2e-18   Actinokineospora inagensis
ref|WP_020417565.1|  MULTISPECIES: 50S ribosomal protein L6           88.6    2e-18   Amycolatopsis
ref|WP_009782735.1|  50S ribosomal protein L6                         88.2    2e-18   Lyngbya sp. PCC 8106
ref|WP_037332683.1|  50S ribosomal protein L6                         88.2    2e-18   Amycolatopsis sp. MJM2582
ref|WP_044096020.1|  50S ribosomal protein L6                         88.2    2e-18   Mycobacterium canettii
ref|WP_024796212.1|  50S ribosomal protein L6                         88.2    2e-18   Tomitella biformata
ref|WP_021798532.1|  50S ribosomal protein L6                         88.2    2e-18   Propionibacterium acidifaciens
ref|WP_043719879.1|  50S ribosomal protein L6                         87.8    3e-18   Nocardia asiatica
ref|WP_040774335.1|  50S ribosomal protein L6                         87.8    3e-18   Nocardia pneumoniae
ref|WP_009625476.1|  50S ribosomal protein L6                         87.8    3e-18   Pseudanabaena
ref|WP_006621330.1|  MULTISPECIES: 50S ribosomal protein L6           87.8    3e-18   Arthrospira
ref|WP_011055950.1|  50S ribosomal protein L6                         87.8    4e-18   Thermosynechococcus
ref|WP_020633320.1|  50S ribosomal protein L6                         87.4    4e-18   Amycolatopsis alba
ref|WP_030329899.1|  50S ribosomal protein L6                         87.4    4e-18   Micromonospora parva
ref|WP_006237995.1|  50S ribosomal protein L6                         87.4    4e-18   Saccharomonospora xinjiangensis
ref|WP_026877482.1|  50S ribosomal protein L6                         87.4    4e-18   Jiangella gansuensis
ref|WP_003912916.1|  50S ribosomal protein L6                         87.4    5e-18   Mycobacterium tuberculosis
ref|WP_023067381.1|  50S ribosomal protein L6                         87.4    5e-18   Lyngbya aestuarii
ref|WP_006100646.1|  50S ribosomal protein L6                         87.0    5e-18   Coleofasciculus chthonoplastes
ref|WP_043058732.1|  50S ribosomal protein L6                         87.0    5e-18   Enteractinococcus helveticum
ref|WP_007167853.1|  50S ribosomal protein L6                         87.0    5e-18   Mycobacterium
ref|WP_042182741.1|  50S ribosomal protein L6                         87.0    5e-18   Kibdelosporangium sp. MJ126-NF4
ref|WP_018156887.1|  50S ribosomal protein L6                         87.0    5e-18   Demetria terragena
ref|WP_030155107.1|  50S ribosomal protein L6                         87.0    6e-18   Glycomyces sp. NRRL B-16210
ref|WP_034266086.1|  50S ribosomal protein L6                         87.0    6e-18   Actinospica robiniae
ref|WP_009883555.1|  50S ribosomal protein L6                         87.0    6e-18   Brevibacterium
ref|WP_038681115.1|  50S ribosomal protein L6                         87.0    6e-18   Pimelobacter simplex
ref|WP_015203286.1|  50S ribosomal protein L6                         87.0    6e-18   Crinalium epipsammum
ref|WP_018720668.1|  50S ribosomal protein L6                         87.0    6e-18   Salinispora pacifica
ref|WP_031581248.1|  50S ribosomal protein L6                         86.7    7e-18   
ref|WP_027649217.1|  50S ribosomal protein L6                         86.7    7e-18   Salinispora pacifica
ref|WP_018729116.1|  50S ribosomal protein L6                         86.7    7e-18   Salinispora pacifica
ref|WP_035991895.1|  50S ribosomal protein L6                         86.7    7e-18   Leptolyngbya sp. KIOST-1
ref|WP_027940987.1|  50S ribosomal protein L6                         86.7    7e-18   Amycolatopsis taiwanensis
ref|WP_009379212.1|  50S ribosomal protein L6                         86.7    7e-18   Brevibacterium casei
ref|WP_013493555.1|  50S ribosomal protein L6                         86.7    7e-18   Intrasporangium calvum
ref|WP_036002394.1|  50S ribosomal protein L6                         86.7    8e-18   [Leptolyngbya] sp. JSC-1
ref|WP_020643212.1|  50S ribosomal protein L6                         86.7    8e-18   Amycolatopsis balhimycina
ref|WP_018726241.1|  50S ribosomal protein L6                         86.7    8e-18   Salinispora pacifica
ref|WP_015118729.1|  50S ribosomal protein L6                         86.7    8e-18   Rivularia sp. PCC 7116
ref|WP_012593618.1|  MULTISPECIES: 50S ribosomal protein L6           86.7    8e-18   Cyanothece
ref|WP_019174650.1|  50S ribosomal protein L6                         86.7    8e-18   Brevibacterium
ref|WP_017297633.1|  50S ribosomal protein L6                         86.7    9e-18   Nodosilinea nodulosa
ref|WP_015170862.1|  50S ribosomal protein L6                         86.7    9e-18   Geitlerinema sp. PCC 7407
ref|WP_018217052.1|  50S ribosomal protein L6                         86.7    9e-18   Salinispora pacifica
ref|WP_040931604.1|  50S ribosomal protein L6                         86.7    9e-18   
ref|WP_037314677.1|  50S ribosomal protein L6                         86.7    9e-18   Actinobacteria
ref|WP_027654160.1|  50S ribosomal protein L6                         86.7    9e-18   Salinispora pacifica
ref|WP_012785173.1|  50S ribosomal protein L6                         86.7    9e-18   Catenulispora acidiphila
ref|WP_012799441.1|  50S ribosomal protein L6                         86.7    9e-18   Slackia heliotrinireducens
ref|WP_003920617.1|  50S ribosomal protein L6                         86.3    9e-18   Mycobacterium xenopi
ref|WP_018801042.1|  50S ribosomal protein L6                         86.3    1e-17   Salinispora arenicola
ref|WP_033357653.1|  50S ribosomal protein L6                         86.3    1e-17   Dactylosporangium aurantiacum
ref|WP_030489593.1|  50S ribosomal protein L6                         86.3    1e-17   Micromonospora chokoriensis
ref|WP_018252463.1|  50S ribosomal protein L6                         86.3    1e-17   Salinispora pacifica
ref|WP_005453260.1|  50S ribosomal protein L6                         86.3    1e-17   Saccharomonospora cyanea
ref|WP_011628222.1|  50S ribosomal protein L6                         86.3    1e-17   Alkalilimnicola ehrlichii
ref|WP_022874123.1|  50S ribosomal protein L6                         86.3    1e-17   Arthrobacter sp. PAO19
ref|WP_022871372.1|  50S ribosomal protein L6                         86.3    1e-17   Yaniella halotolerans
ref|XP_003060321.1|  predicted protein                                86.7    1e-17   Micromonas pusilla CCMP1545
ref|WP_018347778.1|  50S ribosomal protein L6                         86.3    1e-17   Longispora albida
ref|WP_009233265.1|  MULTISPECIES: 50S ribosomal protein L6           86.3    1e-17   Actinomyces
ref|WP_009152392.1|  50S ribosomal protein L6                         85.9    1e-17   Saccharomonospora marina
ref|WP_037816261.1|  MULTISPECIES: 50S ribosomal protein L6           85.9    1e-17   Actinobacteria
ref|WP_025616601.1|  50S ribosomal protein L6                         85.9    1e-17   Salinispora pacifica
ref|WP_010595601.1|  50S ribosomal protein L6                         85.9    1e-17   Rhodococcus
ref|WP_019707835.1|  50S ribosomal protein L6                         85.9    1e-17   Streptomyces xinghaiensis
ref|WP_006515901.1|  50S ribosomal protein L6                         85.9    1e-17   Leptolyngbya sp. PCC 7375
ref|WP_026137931.1|  50S ribosomal protein L6                         85.9    1e-17   
ref|WP_040833621.1|  50S ribosomal protein L6                         85.9    1e-17   Nocardia brevicatena
ref|WP_043368788.1|  50S ribosomal protein L6                         85.9    1e-17   Cyanobium sp. PCC 7001
ref|WP_010850863.1|  50S ribosomal protein L6                         85.9    2e-17   Tetrasphaera elongata
ref|WP_005166793.1|  MULTISPECIES: 50S ribosomal protein L6           85.9    2e-17   Amycolatopsis
ref|WP_007356156.1|  MULTISPECIES: 50S ribosomal protein L6           85.9    2e-17   Kamptonema
ref|WP_043503332.1|  50S ribosomal protein L6                         85.9    2e-17   Streptomyces
ref|WP_006456930.1|  50S ribosomal protein L6                         85.9    2e-17   Synechococcus sp. PCC 7335
ref|XP_002966651.1|  hypothetical protein SELMODRAFT_6327             85.5    2e-17   
ref|WP_018222588.1|  50S ribosomal protein L6                         85.9    2e-17   Salinispora pacifica
ref|WP_035279546.1|  50S ribosomal protein L6                         85.9    2e-17   Actinokineospora
ref|WP_006554596.1|  MULTISPECIES: 50S ribosomal protein L6           85.9    2e-17   Rhodococcus
ref|WP_016331093.1|  50S ribosomal protein L6                         85.9    2e-17   Amycolatopsis
ref|WP_043466731.1|  50S ribosomal protein L6                         85.5    2e-17   Streptomyces
ref|WP_040272340.1|  50S ribosomal protein L6                         85.5    2e-17   Rhodococcus ruber
ref|WP_028656356.1|  50S ribosomal protein L6                         85.5    2e-17   Nocardioides sp. J54
ref|WP_033384207.1|  50S ribosomal protein L6                         85.5    2e-17   Kibdelosporangium aridum
emb|CCQ60081.1|  LSU ribosomal protein L6p (L9e)                      85.5    2e-17   Crocosphaera watsonii WH 0401
ref|WP_038992188.1|  50S ribosomal protein L6                         85.5    2e-17   Micrococcaceae
ref|WP_015619007.1|  50S ribosomal protein L6                         85.5    2e-17   Actinoplanes sp. N902-109
ref|WP_023071150.1|  50S ribosomal protein L6                         85.5    2e-17   Leptolyngbya sp. Heron Island J
ref|WP_015186046.1|  50S ribosomal protein L6                         85.5    2e-17   Microcoleus sp. PCC 7113
ref|WP_012015113.1|  MULTISPECIES: 50S ribosomal protein L6           85.5    2e-17   Salinispora tropica
ref|WP_029254913.1|  50S ribosomal protein L6                         85.5    2e-17   Rhodococcus erythropolis
ref|WP_006502869.1|  50S ribosomal protein L6                         85.5    2e-17   Austwickia chelonae
ref|WP_029127897.1|  50S ribosomal protein L6                         85.5    2e-17   Salinispora pacifica
ref|WP_010840030.1|  50S ribosomal protein L6                         85.5    2e-17   Rhodococcus rhodnii
ref|WP_019737211.1|  50S ribosomal protein L6                         85.5    2e-17   Mycobacteriaceae
ref|WP_026928237.1|  50S ribosomal protein L6                         85.5    2e-17   Granulicoccus phenolivorans
ref|WP_043965528.1|  50S ribosomal protein L6                         85.5    2e-17   Micromonospora carbonacea
ref|WP_017659044.1|  50S ribosomal protein L6                         85.1    3e-17   Geitlerinema sp. PCC 7105
ref|WP_008375943.1|  50S ribosomal protein L6                         85.1    3e-17   Gordonia malaquae
ref|WP_028187530.1|  50S ribosomal protein L6                         85.1    3e-17   Salinispora pacifica
gb|ETI88505.1|  50S ribosomal protein L6                              83.2    3e-17   Propionibacterium sp. DORA_15
ref|WP_016694616.1|  50S ribosomal protein L6                         85.1    3e-17   Rhodococcus
ref|WP_003940970.1|  MULTISPECIES: 50S ribosomal protein L6           85.1    3e-17   Rhodococcus
ref|WP_015218384.1|  50S ribosomal protein L6                         85.1    3e-17   Cyanobacterium aponinum
ref|WP_003789306.1|  MULTISPECIES: 50S ribosomal protein L6           85.1    3e-17   Actinomyces
ref|WP_039727917.1|  MULTISPECIES: 50S ribosomal protein L6           85.1    3e-17   Lyngbya confervoides
ref|WP_015780004.1|  50S ribosomal protein L6                         85.1    3e-17   Kytococcus sedentarius
ref|WP_013222612.1|  50S ribosomal protein L6                         85.1    3e-17   Amycolatopsis mediterranei
ref|WP_040284668.1|  50S ribosomal protein L6                         85.1    3e-17   Tessaracoccus massiliensis
ref|WP_013288623.1|  MULTISPECIES: 50S ribosomal protein L6           85.1    3e-17   Micromonosporaceae
ref|WP_003781878.1|  MULTISPECIES: 50S ribosomal protein L6           84.7    3e-17   Actinomyces
ref|WP_009072324.1|  MULTISPECIES: 50S ribosomal protein L6           84.7    3e-17   Actinobacteria
ref|WP_011430033.1|  50S ribosomal protein L6                         84.7    3e-17   Synechococcus
ref|WP_018784558.1|  50S ribosomal protein L6                         84.7    4e-17   Micromonospora
ref|WP_028852098.1|  50S ribosomal protein L6                         84.7    4e-17   Thermocrispum municipale
ref|WP_034801579.1|  50S ribosomal protein L6                         84.7    4e-17   Intrasporangium oryzae
ref|WP_003938077.1|  50S ribosomal protein L6                         84.7    4e-17   Rhodococcus
emb|CCQ65151.1|  LSU ribosomal protein L6p (L9e)                      84.7    4e-17   Crocosphaera watsonii WH 0402
ref|WP_007306418.1|  50S ribosomal protein L6                         84.7    4e-17   Crocosphaera watsonii
ref|WP_029433451.1|  50S ribosomal protein L6                         84.7    4e-17   Blastococcus sp. URHD0036
ref|WP_032376650.1|  50S ribosomal protein L6                         84.7    4e-17   Rhodococcus
ref|WP_014209123.1|  50S ribosomal protein L6                         84.7    4e-17   Mycolicibacterium rhodesiae
ref|WP_005461363.1|  50S ribosomal protein L6                         84.7    4e-17   Saccharomonospora glauca
ref|WP_030513401.1|  MULTISPECIES: 50S ribosomal protein L6           84.7    4e-17   Corynebacteriales
ref|WP_009300583.1|  50S ribosomal protein L6                         84.7    5e-17   
ref|WP_034266925.1|  50S ribosomal protein L6                         84.3    5e-17   
ref|WP_003886886.1|  50S ribosomal protein L6                         84.3    5e-17   
ref|WP_040160199.1|  50S ribosomal protein L6                         84.3    6e-17   
gb|ELP44194.1|  50S ribosomal protein L6                              84.3    6e-17   
ref|WP_024876324.1|  50S ribosomal protein L6                         84.3    6e-17   
ref|WP_025347236.1|  50S ribosomal protein L6                         84.3    6e-17   
ref|WP_013127985.1|  50S ribosomal protein L6                         84.3    6e-17   
ref|WP_008312941.1|  50S ribosomal protein L6                         84.3    6e-17   
ref|WP_036498215.1|  50S ribosomal protein L6                         84.0    6e-17   
ref|WP_033244267.1|  MULTISPECIES: 50S ribosomal protein L6           84.0    7e-17   
ref|WP_028650493.1|  50S ribosomal protein L6                         84.0    7e-17   
ref|WP_020662788.1|  50S ribosomal protein L6                         84.0    7e-17   
ref|WP_015161727.1|  50S ribosomal protein L6                         84.0    7e-17   
ref|WP_010354227.1|  50S ribosomal protein L6                         84.0    8e-17   
ref|WP_019202351.1|  50S ribosomal protein L6                         84.0    8e-17   
ref|WP_019807076.1|  50S ribosomal protein L6                         84.0    8e-17   
ref|WP_036532292.1|  50S ribosomal protein L6                         84.0    8e-17   
ref|WP_012795920.1|  50S ribosomal protein L6                         84.0    8e-17   
ref|WP_039345443.1|  50S ribosomal protein L6                         84.0    8e-17   
ref|WP_028702603.1|  50S ribosomal protein L6                         84.0    9e-17   
ref|WP_036466729.1|  50S ribosomal protein L6                         83.6    9e-17   
ref|WP_035800859.1|  50S ribosomal protein L6                         83.6    9e-17   
ref|WP_033308964.1|  50S ribosomal protein L6                         83.6    9e-17   
ref|WP_004946665.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_013830244.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_010244377.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_004558872.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_043781945.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_004809043.1|  MULTISPECIES: 50S ribosomal protein L6           83.6    1e-16   
ref|WP_034715238.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_040704408.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_012111673.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_028937624.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_035830882.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_010036705.1|  MULTISPECIES: 50S ribosomal protein L6           83.6    1e-16   
ref|WP_006947161.1|  MULTISPECIES: 50S ribosomal protein L6           83.6    1e-16   
ref|WP_015125765.1|  50S ribosomal protein L6                         83.6    1e-16   
ref|WP_007023275.1|  MULTISPECIES: 50S ribosomal protein L6           83.6    1e-16   
ref|WP_007773556.1|  MULTISPECIES: 50S ribosomal protein L6           83.6    1e-16   
ref|WP_003992368.1|  MULTISPECIES: 50S ribosomal protein L6           83.6    1e-16   
ref|WP_015071227.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_012950467.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_010831723.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_023370960.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_044509837.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_033291192.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_031333108.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_005518391.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_012835383.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_034513976.1|  50S ribosomal protein L6                         83.2    1e-16   
ref|WP_021104901.1|  MULTISPECIES: 50S ribosomal protein L6           83.2    2e-16   
ref|WP_008385401.1|  50S ribosomal protein L6                         83.2    2e-16   
ref|WP_035758067.1|  50S ribosomal protein L6                         83.2    2e-16   
ref|WP_031118788.1|  50S ribosomal protein L6                         83.2    2e-16   
ref|WP_003866494.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|WP_003892857.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|WP_036398367.1|  MULTISPECIES: 50S ribosomal protein L6           82.8    2e-16   
ref|WP_029775156.1|  50S ribosomal protein L6                         81.6    2e-16   
ref|WP_029639091.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|WP_019343845.1|  50S ribosomal protein L6                         82.8    2e-16   
gb|AFC39969.1|  ribosomal protein L6                                  82.8    2e-16   
ref|WP_039717296.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|WP_009948648.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|WP_013349670.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|WP_033231370.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|XP_004086034.1|  PREDICTED: 50S ribosomal protein L6, chlorop...  81.6    2e-16   
ref|WP_030436516.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|WP_005987248.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|WP_030839651.1|  MULTISPECIES: 50S ribosomal protein L6           82.8    2e-16   
ref|WP_011719158.1|  50S ribosomal protein L6                         82.8    2e-16   
ref|WP_014440736.1|  50S ribosomal protein L6                         82.4    2e-16   
ref|WP_020513600.1|  50S ribosomal protein L6                         82.4    2e-16   
ref|WP_016666104.1|  MULTISPECIES: 50S ribosomal protein L6           82.4    2e-16   
ref|WP_005625438.1|  50S ribosomal protein L6                         82.4    2e-16   
ref|WP_041775860.1|  50S ribosomal protein L6                         82.4    2e-16   
ref|WP_037763668.1|  50S ribosomal protein L6                         82.4    2e-16   
ref|WP_025361368.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_030134473.1|  MULTISPECIES: 50S ribosomal protein L6           82.4    3e-16   
ref|WP_016698502.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_030601192.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_038654337.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_043721541.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_026849956.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_010469303.1|  MULTISPECIES: 50S ribosomal protein L6           82.4    3e-16   
ref|WP_027587864.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_008361023.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_030427406.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_019124981.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_011739074.1|  MULTISPECIES: 50S ribosomal protein L6           82.4    3e-16   
ref|WP_030778519.1|  50S ribosomal protein L6                         82.0    3e-16   
ref|WP_024286973.1|  50S ribosomal protein L6                         82.0    3e-16   
ref|WP_026786891.1|  MULTISPECIES: 50S ribosomal protein L6           82.4    3e-16   
ref|WP_027254766.1|  50S ribosomal protein L6                         82.4    3e-16   
ref|WP_026797653.1|  MULTISPECIES: 50S ribosomal protein L6           82.0    3e-16   
ref|WP_015354695.1|  MULTISPECIES: 50S ribosomal protein L6           82.0    4e-16   
ref|WP_028926929.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_026844847.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_026419518.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_033342851.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_012196215.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_011207320.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_005509895.1|  MULTISPECIES: 50S ribosomal protein L6           82.0    4e-16   
ref|WP_041795568.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_006592639.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_020401293.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_043682603.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_033714622.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_003873497.1|  MULTISPECIES: 50S ribosomal protein L6           82.0    4e-16   
ref|WP_020549222.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_020520467.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_008260611.1|  MULTISPECIES: 50S ribosomal protein L6           82.0    4e-16   
ref|WP_029136109.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_009190142.1|  MULTISPECIES: 50S ribosomal protein L6           82.0    4e-16   
ref|WP_003929544.1|  50S ribosomal protein L6                         82.0    4e-16   
ref|WP_040338539.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_015152288.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_003883427.1|  MULTISPECIES: 50S ribosomal protein L6           81.6    5e-16   
ref|WP_013420568.1|  MULTISPECIES: 50S ribosomal protein L6           81.6    5e-16   
ref|WP_028322671.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_030006185.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_040252697.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_006618086.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_026857028.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_009479371.1|  MULTISPECIES: 50S ribosomal protein L6           81.6    5e-16   
ref|WP_031447972.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_012626776.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_019181715.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_030930490.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_020668412.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_031937773.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_015109414.1|  50S ribosomal protein L6                         81.6    5e-16   
ref|WP_018564815.1|  MULTISPECIES: 50S ribosomal protein L6           81.6    6e-16   
ref|WP_019107908.1|  50S ribosomal protein L6                         81.6    6e-16   
ref|WP_017303358.1|  50S ribosomal protein L6                         81.6    6e-16   
ref|WP_030522650.1|  50S ribosomal protein L6                         81.6    6e-16   
ref|WP_013001410.1|  50S ribosomal protein L6                         81.6    6e-16   
ref|WP_024453890.1|  MULTISPECIES: 50S ribosomal protein L6           81.6    6e-16   
ref|WP_024440398.1|  50S ribosomal protein L6                         81.6    6e-16   
ref|WP_018543916.1|  50S ribosomal protein L6                         81.6    6e-16   
ref|WP_011936544.1|  50S ribosomal protein L6                         81.6    6e-16   
ref|WP_029369014.1|  50S ribosomal protein L6                         81.6    6e-16   
ref|WP_031477828.1|  50S ribosomal protein L6                         81.3    6e-16   
ref|WP_025278749.1|  50S ribosomal protein L6                         81.6    6e-16   
ref|WP_017194739.1|  50S ribosomal protein L6                         81.3    6e-16   
ref|WP_015144997.1|  50S ribosomal protein L6                         81.3    6e-16   
ref|WP_028705023.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_027496323.1|  MULTISPECIES: 50S ribosomal protein L6           81.3    7e-16   
ref|WP_032397535.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_008729370.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_030788255.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_027503162.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_036473258.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_009483070.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_039688659.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_020087354.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_037664023.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_029340048.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_026408789.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_004023570.1|  50S ribosomal protein L6                         81.3    7e-16   
ref|WP_012084965.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_012306676.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_009679180.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_005239658.1|  MULTISPECIES: 50S ribosomal protein L6           81.3    8e-16   
ref|XP_002950331.1|  plastid/chloroplast ribosomal protein L6         81.6    8e-16   
ref|WP_015178716.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_021718954.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_030567272.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_006899636.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_043623462.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_030542570.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_037217674.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_006634987.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_002514854.1|  MULTISPECIES: 50S ribosomal protein L6           81.3    8e-16   
ref|WP_030380852.1|  MULTISPECIES: 50S ribosomal protein L6           81.3    8e-16   
ref|WP_002551219.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_038312243.1|  50S ribosomal protein L6                         80.9    8e-16   
ref|WP_034243832.1|  50S ribosomal protein L6                         81.3    8e-16   
ref|WP_009775950.1|  50S ribosomal protein L6                         80.9    8e-16   
ref|WP_015187428.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_039315601.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_002535917.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_033528347.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_018171458.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_012521803.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_037858422.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_030782548.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_002516006.1|  MULTISPECIES: 50S ribosomal protein L6           80.9    9e-16   
ref|WP_039403001.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_030685454.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_007531933.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_015148984.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_022871731.1|  50S ribosomal protein L6                         80.9    9e-16   
ref|WP_007100630.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_006338066.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_009767984.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_014981718.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_007001493.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_040855275.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_028496520.1|  MULTISPECIES: 50S ribosomal protein L6           80.9    1e-15   
ref|WP_019818480.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_011558446.1|  MULTISPECIES: 50S ribosomal protein L6           80.9    1e-15   
ref|WP_040745734.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_038543126.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_028420765.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_020132626.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_040485101.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_019159385.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_030571223.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_011932338.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|XP_001696829.1|  plastid ribosomal protein L6                     81.3    1e-15   
ref|WP_011824506.1|  50S ribosomal protein L6                         80.9    1e-15   
ref|WP_028785452.1|  50S ribosomal protein L6                         80.5    1e-15   
ref|WP_037657566.1|  50S ribosomal protein L6                         80.5    1e-15   
ref|WP_011295459.1|  50S ribosomal protein L6                         80.5    1e-15   
ref|WP_036352720.1|  50S ribosomal protein L6                         80.5    1e-15   
ref|WP_040794536.1|  50S ribosomal protein L6                         80.5    1e-15   
ref|WP_010314956.1|  50S ribosomal protein L6                         80.5    1e-15   
ref|WP_029087829.1|  50S ribosomal protein L6                         80.5    1e-15   
ref|WP_019138783.1|  50S ribosomal protein L6                         80.5    1e-15   
ref|WP_037719144.1|  50S ribosomal protein L6                         80.5    1e-15   



>ref|XP_009618592.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Nicotiana 
tomentosiformis]
Length=227

 Score =   201 bits (512),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +  TSNLR  F+G  +G     + + R  FVRK VECKESRIGKQPI VPSNVT+ MEGQ
Sbjct  9    SLHTSNLRYPFVGSLNGFHVSSVAVRRVGFVRKVVECKESRIGKQPITVPSNVTLTMEGQ  68

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGE+ ITYPREVKLE+EE GVLRVRKAMETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  69   DLKVKGPLGEMAITYPREVKLEREEEGVLRVRKAMETRRANQMHGLFRTLTDNMVVGVSK  128

Query  477  GFDKKLQL  500
            GF+KKLQL
Sbjct  129  GFEKKLQL  136



>ref|XP_009785468.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Nicotiana 
sylvestris]
Length=228

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  126  TSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  305
            TSNLRS F+G  +G     + + R  FVRK VECKESRIGKQPI VPSNVT+ MEGQD K
Sbjct  13   TSNLRSPFVGSLNGFHVSSVAVRRVGFVRKVVECKESRIGKQPITVPSNVTLTMEGQDLK  72

Query  306  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFD  485
            VKGPLGE+ ITYPREVKLE+EE G+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+
Sbjct  73   VKGPLGEMAITYPREVKLEREEEGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFE  132

Query  486  KKLQL  500
            KKLQL
Sbjct  133  KKLQL  137



>ref|XP_006365808.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Solanum 
tuberosum]
Length=227

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +  TS LRS F+G+ +G R   + + R  FVRK +ECKESRIGKQPI VPSNVT+ MEGQ
Sbjct  9    SLHTSTLRSPFVGNLNGFRVSSVAVRRVGFVRKMIECKESRIGKQPISVPSNVTLTMEGQ  68

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGE+ ITYPREVKLEK++ G+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  69   DLKVKGPLGEMAITYPREVKLEKDDGGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSK  128

Query  477  GFDKKLQL  500
            GF+KKLQL
Sbjct  129  GFEKKLQL  136



>ref|XP_004252860.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Solanum lycopersicum]
Length=257

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +   S LRS F+G  +G     + + R  FV KTVECKESRIGKQPI VPSNVT+ MEGQ
Sbjct  39   SLHASTLRSPFVGSLNGFHVSSVAVRRVGFVSKTVECKESRIGKQPISVPSNVTLTMEGQ  98

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGE+ ITYPREVKLEKE+ G+LRVRKAMETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  99   DLKVKGPLGEMAITYPREVKLEKEDGGILRVRKAMETRRANQMHGLFRTLTDNMVVGVSK  158

Query  477  GFDKKLQL  500
            GF+KKLQL
Sbjct  159  GFEKKLQL  166



>gb|EYU44192.1| hypothetical protein MIMGU_mgv1a013253mg [Erythranthe guttata]
Length=226

 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  126  TSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  305
            +S LRS F+G+ +GIR   ++  R   VRKTVECKESRIGKQPIPVPSNVT+ M+GQD K
Sbjct  11   SSYLRSAFLGETNGIRVSGISAPRLAVVRKTVECKESRIGKQPIPVPSNVTLVMDGQDLK  70

Query  306  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFD  485
            VKGPLGEL ITYPRE+ L+K++SG+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+
Sbjct  71   VKGPLGELAITYPREILLDKDDSGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFE  130

Query  486  KKLQL  500
            KKLQL
Sbjct  131  KKLQL  135



>gb|KJB80515.1| hypothetical protein B456_013G101000 [Gossypium raimondii]
Length=225

 Score =   197 bits (501),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +  TSNLRS F+G+ +GI    + I R + VRK +ECKESRIGKQPI VPSNVTI MEGQ
Sbjct  7    SLQTSNLRSAFLGEKTGICVSSIPITRVSLVRKAIECKESRIGKQPITVPSNVTITMEGQ  66

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGE+ +TYPREVK+ +EESG LRVRK++ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  67   DIKVKGPLGEMALTYPREVKVNREESGALRVRKSVETRRANQMHGLFRTLTDNMVVGVSK  126

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  127  GFEKRLQL  134



>ref|XP_007045631.1| Ribosomal protein L6 family [Theobroma cacao]
 gb|EOY01463.1| Ribosomal protein L6 family [Theobroma cacao]
Length=225

 Score =   197 bits (500),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNLRS F+G+ + I    + + R + VRK VECKESRIGKQPI VPSNVTI +EGQ
Sbjct  7    SFQTSNLRSAFLGERNAICISSIPVTRVSLVRKAVECKESRIGKQPIQVPSNVTITLEGQ  66

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL +TYPREVK+++EE G+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  67   DVKVKGPLGELALTYPREVKVDREEPGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSK  126

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  127  GFEKRLQL  134



>gb|KHG21050.1| 50S ribosomal L6, chloroplastic -like protein [Gossypium arboreum]
Length=225

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +  TSNLRS F+G+ +G     + I R + VRK +ECKESRIGKQPI VPSNVTI MEGQ
Sbjct  7    SLQTSNLRSAFLGEKNGSCVSSIPITRVSLVRKAIECKESRIGKQPITVPSNVTITMEGQ  66

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGE+ +TYPREVK+++EESG LR+RK++ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  67   DIKVKGPLGEMALTYPREVKVDREESGALRIRKSVETRRANQMHGLFRTLTDNMVVGVSK  126

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  127  GFEKRLQL  134



>ref|XP_003548187.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like isoform 
1 [Glycine max]
Length=226

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F  SNL+S F+G+ + +R   +  A   F RKTVECKESRIGKQPIPVPSNVT+K+EGQ
Sbjct  8    SFRISNLKSVFVGETNKLRVSSVPGAHVGFNRKTVECKESRIGKQPIPVPSNVTVKLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D +VKGPLGEL +TYPREV +E+EESG LRV+KA+ETRRAN+MHGLFRTLTDN+++GVSK
Sbjct  68   DIQVKGPLGELALTYPREVLVEREESGTLRVKKAVETRRANQMHGLFRTLTDNLVIGVSK  127

Query  477  GFDKKLQL  500
            GFDKKLQL
Sbjct  128  GFDKKLQL  135



>gb|ACU23468.1| unknown [Glycine max]
Length=226

 Score =   194 bits (494),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F  SNL+S F+G+ + +R   +  A   F RKTVECKESRIGKQPIPVPSNVT+K+EGQ
Sbjct  8    SFRISNLKSVFVGETNKLRVSSVPGAHVGFNRKTVECKESRIGKQPIPVPSNVTVKLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D +VKGPLGEL +TYPREV +E+EESG LRV+KA+ETRRAN+MHGLFRTLTDN+++GVSK
Sbjct  68   DIQVKGPLGELALTYPREVLVEREESGTLRVKKAVETRRANQMHGLFRTLTDNLVIGVSK  127

Query  477  GFDKKLQL  500
            GFDKKLQL
Sbjct  128  GFDKKLQL  135



>ref|XP_011098741.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Sesamum indicum]
 ref|XP_011098742.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Sesamum indicum]
Length=226

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            T  +S L   F+G+A+G+RF  ++  R   VRK VECKESRIGKQPI VPSNVT+ M+GQ
Sbjct  8    TMQSSYLSCPFLGEANGLRFSPVSAPRVAVVRKIVECKESRIGKQPITVPSNVTLTMDGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL +TYPRE+KLEKEESG LRV+K++ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   DLKVKGPLGELALTYPREIKLEKEESGALRVKKSVETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  128  GFEKRLQL  135



>gb|KHN42547.1| 50S ribosomal protein L6, chloroplastic [Glycine soja]
Length=226

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F  SNL+S F+G+ + +R   +  A   F RKTVECKESRIGKQPIPVPSNVT+K+EGQ
Sbjct  8    SFRISNLKSVFVGETNKLRVSSVPGAHVGFNRKTVECKESRIGKQPIPVPSNVTVKLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D +VKGPLGEL +TYPREV +E+EESG LRV+KA+ETRRAN+MHGLFRTLTDN++ GVSK
Sbjct  68   DIQVKGPLGELALTYPREVLVEREESGTLRVKKAVETRRANQMHGLFRTLTDNLVTGVSK  127

Query  477  GFDKKLQL  500
            GFDKKLQL
Sbjct  128  GFDKKLQL  135



>ref|XP_011005106.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Populus euphratica]
Length=226

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNLRS F+G+ +GI    + + R  F+RK +ECKESRIGKQPI VPSNVTI +EGQ
Sbjct  8    SFQTSNLRSVFLGERNGICVPSVPVTRFGFLRKAIECKESRIGKQPIQVPSNVTITLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL  TYPREVKLE++E G++RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   DLKVKGPLGELSRTYPREVKLERDEDGIIRVKKALETRRANQMHGLFRTLTDNMLVGVSK  127

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  128  GFEKRLQL  135



>ref|XP_002279657.2| PREDICTED: 50S ribosomal protein L6, chloroplastic [Vitis vinifera]
 emb|CBI28941.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNLRS F+G+ +GI    + + R  F+RKT+ECKESRIGK+PI VPSNVTI +EGQ
Sbjct  8    SFQTSNLRSAFLGERNGIYVSSVPVTRVGFLRKTIECKESRIGKKPIEVPSNVTITLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL  TYPREVK++K+ESG+L V+KA ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   DLKVKGPLGELSRTYPREVKVQKDESGILTVKKAFETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  128  GFEKRLQL  135



>ref|XP_002320459.1| ribosomal protein L6 [Populus trichocarpa]
 gb|EEE98774.1| ribosomal protein L6 [Populus trichocarpa]
Length=227

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNLRS F+G+ + I    + + R  F+RK +ECKESRIGKQPI VPSNVTIK+EGQ
Sbjct  9    SFQTSNLRSVFLGERNRICVPSVPVTRIGFLRKAIECKESRIGKQPIQVPSNVTIKLEGQ  68

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL  TYPREVKLE++E G++RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  69   DLKVKGPLGELSRTYPREVKLERDEDGIIRVKKALETRRANQMHGLFRTLTDNMVVGVSK  128

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  129  GFEKRLQL  136



>ref|XP_003534001.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Glycine 
max]
 gb|KHN23211.1| 50S ribosomal protein L6, chloroplastic [Glycine soja]
Length=226

 Score =   192 bits (487),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +3

Query  99   TTQRKKTFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVT  278
            T+    +F  SNL S F+G+ +  R   +  A   F+RKTVECKESRIGKQPIPVPSNVT
Sbjct  2    TSSVTSSFRISNLNSVFVGETNKFRVSTVPGAHVGFIRKTVECKESRIGKQPIPVPSNVT  61

Query  279  IKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNM  458
            +K+EGQD +VKGPLGEL ++YPREV +E+EESG LRV+KA+ETRRAN+MHGLFRTLTDN+
Sbjct  62   VKLEGQDIQVKGPLGELALSYPREVLVEREESGTLRVKKAVETRRANQMHGLFRTLTDNL  121

Query  459  IVGVSKGFDKKLQL  500
            ++GVSKGF+KKLQL
Sbjct  122  VIGVSKGFEKKLQL  135



>gb|AFK43716.1| unknown [Medicago truncatula]
Length=226

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F  SN +S+F+G+ S IR          F RKT ECKESRIGKQPIPVPSNVTIKMEGQ
Sbjct  8    SFQLSNFKSSFVGERSRIRISSAPATHVGFFRKTTECKESRIGKQPIPVPSNVTIKMEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
             F  KGPLGEL +TYPREVK+E++E GVL+V KA+ETRRAN+MHGLFRTLTDN++VGVSK
Sbjct  68   YFHAKGPLGELSLTYPREVKVERQEEGVLKVSKAVETRRANQMHGLFRTLTDNIVVGVSK  127

Query  477  GFDKKLQL  500
            GF+KKLQL
Sbjct  128  GFEKKLQL  135



>ref|XP_010522339.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Tarenaya 
hassleriana]
Length=226

 Score =   189 bits (481),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  120  FATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQD  299
            F TSN RS F+GD  G R  +  +    F  KTVECKESRIGKQPI VPSNVTI + GQD
Sbjct  9    FQTSNFRSVFLGDGRGFRASRAHVVNVGFSSKTVECKESRIGKQPIAVPSNVTITLAGQD  68

Query  300  FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKG  479
             KVKGPLGEL +TYPREV+++KE+SG LRVRK +ETRRAN+MHGLFRTLTDNMIVGVSKG
Sbjct  69   LKVKGPLGELSLTYPREVEVKKEDSGSLRVRKTVETRRANQMHGLFRTLTDNMIVGVSKG  128

Query  480  FDKKLQL  500
            F+K+LQL
Sbjct  129  FEKRLQL  135



>ref|XP_008379631.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Malus 
domestica]
 ref|XP_008365451.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Malus 
domestica]
Length=226

 Score =   189 bits (480),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNLRS F+G  +G     + ++   F++KT+ECKESRIGKQPI VPSNVTI +EGQ
Sbjct  8    SFQTSNLRSAFLGKRNGFSVCSVPVSHVKFLKKTIECKESRIGKQPIEVPSNVTITLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
               VKGPLG+L +TYPREV ++KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   ALAVKGPLGQLSLTYPREVLVQKEDSGALRVRKAVETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GFDK+LQL
Sbjct  128  GFDKRLQL  135



>ref|XP_008223584.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Prunus mume]
Length=226

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +  TSNLRS F+G+ +G     +++    F++KT+ECKESRIGKQPI VPSNV+IK+EGQ
Sbjct  8    SLQTSNLRSAFLGERNGFSVCSVSVTHVGFLKKTIECKESRIGKQPIEVPSNVSIKLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
              +VKGPLG+L +TYPREV L+KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   ALEVKGPLGQLSMTYPREVLLQKEDSGFLRVRKALETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  128  GFEKRLQL  135



>ref|XP_007223925.1| hypothetical protein PRUPE_ppa011034mg [Prunus persica]
 gb|EMJ25124.1| hypothetical protein PRUPE_ppa011034mg [Prunus persica]
Length=226

 Score =   187 bits (476),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +  TSNLRS F+G+ +G     +++    F++KT+ECKESRIGKQPI VPSNV+IK+EGQ
Sbjct  8    SLQTSNLRSAFLGERNGFSVCSVSVTHVGFLKKTIECKESRIGKQPIEVPSNVSIKLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
              +VKGPLG+L +TYPREV ++KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   ALEVKGPLGQLSMTYPREVLVQKEDSGFLRVRKALETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  128  GFEKRLQL  135



>ref|XP_004514093.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Cicer 
arietinum]
Length=226

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F  SN +S ++G+ S +R       R    RKT ECKESRIGKQPIPVPSNVTIK+EGQ
Sbjct  8    SFQISNFKSVYLGERSKLRVSSAPATRVGVFRKTTECKESRIGKQPIPVPSNVTIKLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D +VKGPLGEL +TYPREVK+E+++ G+L+V KA+ETRRAN+MHGLFRTLTDN++VGVSK
Sbjct  68   DIQVKGPLGELSLTYPREVKVERQDEGILKVSKAVETRRANQMHGLFRTLTDNLVVGVSK  127

Query  477  GFDKKLQL  500
            GF+KKLQL
Sbjct  128  GFEKKLQL  135



>ref|XP_008455431.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Cucumis melo]
Length=233

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  123  ATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDF  302
            + +N RS F+G+ +G     + +     +RKT+ECKESRIGKQPI VPSNVTI ++GQD 
Sbjct  17   SPNNFRSTFLGEKNGFCVSAMPVCHIGLLRKTIECKESRIGKQPIQVPSNVTITLQGQDL  76

Query  303  KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGF  482
            KVKGPLGEL I YPREVK+E+E+SG++RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF
Sbjct  77   KVKGPLGELSILYPREVKIEREDSGIIRVKKALETRRANQMHGLFRTLTDNMVVGVSKGF  136

Query  483  DKKLQL  500
            +KKLQL
Sbjct  137  EKKLQL  142



>gb|KDP25836.1| hypothetical protein JCGZ_22866 [Jatropha curcas]
Length=226

 Score =   185 bits (470),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNLRS F+G+ +G+        R  F+RK + CKESRIGKQPI VP+NVTI ++GQ
Sbjct  8    SFQTSNLRSVFLGERNGVGVPIAPTTRVGFLRKMIVCKESRIGKQPIQVPTNVTITLDGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL  TYPREVKLE++E+GV+RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   DLKVKGPLGELSRTYPREVKLERDENGVIRVKKALETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  128  GFEKRLQL  135



>ref|XP_010557010.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Tarenaya 
hassleriana]
Length=225

 Score =   185 bits (469),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNLR  F+GD+ GI   + T     F  KTVECKESRIGKQPI VPSNVTI + GQ
Sbjct  8    SFQTSNLRPVFLGDSRGIPASR-TPVHVGFSSKTVECKESRIGKQPIAVPSNVTITLAGQ  66

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL +TYPREV+++KE+SG LRVRK +ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  67   DLKVKGPLGELSLTYPREVEVKKEDSGFLRVRKTIETRRANQMHGLFRTLTDNMVVGVSK  126

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  127  GFEKRLQL  134



>ref|XP_008342000.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Malus 
domestica]
Length=225

 Score =   184 bits (468),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = +3

Query  120  FATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQD  299
            F TSNLRS F+G+  G  F   ++    F++KT+ECKESRIGKQPI VPSNVTI +EGQ 
Sbjct  10   FQTSNLRSAFLGERKG--FXXCSVPXVGFLKKTIECKESRIGKQPIEVPSNVTITLEGQA  67

Query  300  FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKG  479
              VKGPLG+L +TYPREV ++KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKG
Sbjct  68   LAVKGPLGQLSLTYPREVLVQKEDSGTLRVRKAVETRRANQMHGLFRTLTDNMVVGVSKG  127

Query  480  FDKKLQL  500
            F+K+LQL
Sbjct  128  FEKRLQL  134



>gb|ACU19091.1| unknown [Glycine max]
Length=226

 Score =   184 bits (467),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  99   TTQRKKTFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVT  278
            T+    +F  SNL S F+G+ +  R   +  A   F+RKTVECKESRIGKQPIPVPSNVT
Sbjct  2    TSSVTSSFRISNLNSVFVGETNKFRVSTVPGAHVGFIRKTVECKESRIGKQPIPVPSNVT  61

Query  279  IKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNM  458
            +K+EGQD +VKGPLGEL ++YPREV +++EESG LRV+KA+ETRRAN+MHGLFRT TDN+
Sbjct  62   VKLEGQDIQVKGPLGELALSYPREVLVKREESGTLRVKKAVETRRANQMHGLFRTPTDNL  121

Query  459  IVGVSKGFDKKLQL  500
            ++GV KGF+KKLQL
Sbjct  122  VIGVFKGFEKKLQL  135



>ref|XP_004287942.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=226

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNLRS F+G+  G   +        F++K VECKESRIGKQPI VP+NVT+K+EGQ
Sbjct  8    SFQTSNLRSAFLGERKGFTVYSAPATNVGFLKKAVECKESRIGKQPIEVPANVTLKLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
              +VKGPLG+L +  PREV +EK+ESGVL+VRKAMETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   SLEVKGPLGQLSMILPREVVVEKQESGVLKVRKAMETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  128  GFEKRLQL  135



>ref|XP_006418054.1| hypothetical protein EUTSA_v10008693mg [Eutrema salsugineum]
 gb|ESQ36407.1| hypothetical protein EUTSA_v10008693mg [Eutrema salsugineum]
Length=226

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F  SN+RS F+GD +  +      A+  F  KT+ECKESRIGKQPI VPSNVTI +EGQ
Sbjct  8    SFQPSNVRSAFLGDRNVFKVSTTPFAQVGFSSKTIECKESRIGKQPIAVPSNVTIALEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   DLKVKGPLGELALTYPREVELTKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GF+KKL L
Sbjct  128  GFEKKLIL  135



>ref|XP_009353272.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Pyrus x bretschneideri]
Length=226

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNLRS F+G+ +G     + ++   F++KT+ECKESRIGKQP  VPSN+TI +EGQ
Sbjct  8    SFQTSNLRSTFLGERNGFSVCSVPVSHVGFLKKTIECKESRIGKQPSEVPSNLTISVEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
               VKGPLG+L +TY REV ++KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   ALAVKGPLGQLSLTYQREVLVQKEDSGALRVRKAVETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GFDK+LQL
Sbjct  128  GFDKRLQL  135



>ref|XP_004144493.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004164857.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Cucumis 
sativus]
 gb|KGN43529.1| hypothetical protein Csa_7G044200 [Cucumis sativus]
Length=233

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  123  ATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDF  302
            + +N RS F+G+ +G     +       +RKT+ECKESRIGKQPI VPS+VTI ++GQD 
Sbjct  17   SPNNFRSTFLGEKNGFCVSAMPACHIGLLRKTIECKESRIGKQPIQVPSSVTITLQGQDL  76

Query  303  KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGF  482
            KVKGPLGEL I YPREVK+E+E+SG++RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF
Sbjct  77   KVKGPLGELSILYPREVKIEREDSGIIRVKKALETRRANQMHGLFRTLTDNMVVGVSKGF  136

Query  483  DKKLQL  500
            +KKLQL
Sbjct  137  EKKLQL  142



>ref|XP_010689735.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = +3

Query  120  FATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQD  299
             A S+L+S F+G    I      + R  F RK VECKESRIGKQPI VP+NV I MEGQD
Sbjct  4    LAPSHLKSVFLGGKIDIGASN-PVTRAGFWRKNVECKESRIGKQPIAVPANVAIAMEGQD  62

Query  300  FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKG  479
             KVKGPLGEL ITYPREV +EK+ESG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKG
Sbjct  63   LKVKGPLGELAITYPREVIVEKQESGFLRVRKAVETRRANQMHGLFRTLTDNMVVGVSKG  122

Query  480  FDKKLQL  500
            F+KKLQL
Sbjct  123  FEKKLQL  129



>ref|XP_007152280.1| hypothetical protein PHAVU_004G116200g [Phaseolus vulgaris]
 gb|ESW24274.1| hypothetical protein PHAVU_004G116200g [Phaseolus vulgaris]
Length=226

 Score =   182 bits (461),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F  SNL++ F+G+ + +R   +  A+  FVRKTVECKESRIGKQ I VP+NVT+K+EGQ
Sbjct  8    SFRISNLKTVFVGETNKLRVSSVPGAQAGFVRKTVECKESRIGKQRITVPTNVTVKLEGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
              +VKGPLGEL +TYPREV +EKEE+G LRVRKA+ETRRAN+MHGLFRTLT+N++VGVS+
Sbjct  68   GIQVKGPLGELALTYPREVLVEKEEAGTLRVRKAVETRRANQMHGLFRTLTNNLVVGVSE  127

Query  477  GFDKKLQL  500
            GF+KKLQL
Sbjct  128  GFEKKLQL  135



>ref|XP_006447548.1| hypothetical protein CICLE_v10016578mg [Citrus clementina]
 ref|XP_006469689.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Citrus 
sinensis]
 gb|ESR60788.1| hypothetical protein CICLE_v10016578mg [Citrus clementina]
 gb|KDO41663.1| hypothetical protein CISIN_1g027306mg [Citrus sinensis]
Length=225

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TSNL+S F G+ +G     + + R  F RKT+ECKESRIGKQPI VPSNVTI + GQ
Sbjct  8    SFHTSNLKSIFFGERNGFSMSNVPVNRVGFSRKTIECKESRIGKQPIEVPSNVTITLGGQ  67

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL + YPREVK+++E+S  LRVRK +ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  68   DLKVKGPLGELSLVYPREVKVDREDS-FLRVRKTVETRRANQMHGLFRTLTDNMVVGVSK  126

Query  477  GFDKKLQL  500
            GF+KKLQ+
Sbjct  127  GFEKKLQM  134



>ref|XP_002892273.1| EMB2394 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68532.1| EMB2394 [Arabidopsis lyrata subsp. lyrata]
Length=223

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  317
            RS F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  318  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  497
            LGEL +TYPREV+L KEESG+LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct  72   LGELALTYPREVELTKEESGLLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI  131

Query  498  L  500
            L
Sbjct  132  L  132



>ref|XP_010276744.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Nelumbo 
nucifera]
Length=225

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  129  SNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  308
             NL+S F+G+ S  +  ++ +    F+RKTVECKESRIGK+PI VP NV I +EGQD KV
Sbjct  11   CNLKSKFLGEVSATQVGRVPVTHVGFLRKTVECKESRIGKKPIEVPPNVAITLEGQDLKV  70

Query  309  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  488
            KGPLGEL  TYPREVKL +EESG LRV KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K
Sbjct  71   KGPLGELSRTYPREVKLVREESGNLRVIKAVETRRANQMHGLFRTLTDNMVVGVSKGFEK  130

Query  489  KLQL  500
            +LQL
Sbjct  131  RLQL  134



>ref|XP_010100629.1| 50S ribosomal protein L6 [Morus notabilis]
 gb|EXB83377.1| 50S ribosomal protein L6 [Morus notabilis]
Length=225

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 107/128 (84%), Gaps = 1/128 (1%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +F TS  RS F+G+ +G     + ++R  FV+K +ECKESRIGKQ I VPSNVTI +EGQ
Sbjct  8    SFQTS-FRSVFLGERNGFSVSSVPVSRVGFVKKNIECKESRIGKQAIEVPSNVTITLEGQ  66

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
              KVKGPLGEL + YPREVK+E+EESG+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  67   GLKVKGPLGELSLNYPREVKVEREESGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSK  126

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  127  GFEKRLQL  134



>ref|XP_009401055.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  123  ATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDF  302
            ++ NL S F+GD S I       +R +F+RK VECKESRIGK+PI VP NVTI ++GQD 
Sbjct  10   SSCNLNSAFLGDRSRICISDAPFSRVHFLRKPVECKESRIGKRPIEVPPNVTIALDGQDL  69

Query  303  KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGF  482
            KVKGPLGEL  TYPREVK++++ESG L+V KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF
Sbjct  70   KVKGPLGELSRTYPREVKVQRDESGFLKVSKAVETRRANQMHGLFRTLTDNMVVGVSKGF  129

Query  483  DKKLQL  500
            +K+LQL
Sbjct  130  EKRLQL  135



>ref|NP_172011.1| 50S ribosomal protein L6 [Arabidopsis thaliana]
 sp|O23049.1|RK6_ARATH RecName: Full=50S ribosomal protein L6, chloroplastic; AltName: 
Full=Protein EMBRYO DEFECTIVE 2394; Flags: Precursor [Arabidopsis 
thaliana]
 pdb|3BBO|I Chain I, Homology Model For The Spinach Chloroplast 50s Subunit 
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
 gb|AAK25975.1|AF360265_1 putative chloroplast 50S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAB71459.1| Similar to Mycobacterium RlpF (gb|Z84395). ESTs gb|T75785,gb|R30580,gb|T04698 
come from this gene [Arabidopsis thaliana]
 gb|AAK64135.1| putative chloroplast 50S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAM62933.1| putative chloroplast 50S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AEE27802.1| 50S ribosomal protein L6 [Arabidopsis thaliana]
Length=223

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  317
            RS F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  318  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  497
            LGEL +TYPREV+L KEESG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct  72   LGELALTYPREVELTKEESGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI  131

Query  498  L  500
            L
Sbjct  132  L  132



>emb|CDY46838.1| BnaA10g03220D [Brassica napus]
Length=223

 Score =   177 bits (448),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  317
            RS F+GD +  +      A+  + RKT+ECKESRIGKQPI VP+NVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSNTPYAQVGYSRKTIECKESRIGKQPIAVPTNVTIALEGQDLKVKGP  71

Query  318  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  497
            LGEL +TYPREV+L KE++GVLRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct  72   LGELALTYPREVELIKEDAGVLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI  131

Query  498  L  500
            L
Sbjct  132  L  132



>ref|XP_010484767.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Camelina 
sativa]
Length=223

 Score =   176 bits (447),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  317
            RS F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSNTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  318  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  497
            LGEL +TYPREV+L KE+SG+LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct  72   LGELALTYPREVELTKEDSGLLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI  131

Query  498  L  500
            L
Sbjct  132  L  132



>emb|CDY70611.1| BnaAnng34360D [Brassica napus]
Length=223

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  317
            RS+F+G+ +  +     IA+  F  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSSFLGERNVFKVSTAPIAQVGFSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  318  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  497
            LGEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct  72   LGELALTYPREVELLKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI  131

Query  498  L  500
            L
Sbjct  132  L  132



>ref|XP_006304184.1| hypothetical protein CARUB_v10010237mg [Capsella rubella]
 gb|EOA37082.1| hypothetical protein CARUB_v10010237mg [Capsella rubella]
Length=223

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  317
            RS F+GD +  +      A+  F  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSSTPFAQVGFSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  318  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  497
            LGEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct  72   LGELALTYPREVELTKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI  131

Query  498  L  500
            L
Sbjct  132  L  132



>ref|XP_009119188.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Brassica 
rapa]
Length=223

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  317
            RS F+GD +  +      A+  + RKT++CKESRIGKQPI VP+NVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVLATPSAQVGYSRKTIQCKESRIGKQPIAVPTNVTIALEGQDLKVKGP  71

Query  318  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  497
            LGEL +TYPREV+L KE++GVLRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct  72   LGELALTYPREVELIKEDAGVLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI  131

Query  498  L  500
            L
Sbjct  132  L  132



>ref|XP_010051031.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Eucalyptus 
grandis]
 gb|KCW89410.1| hypothetical protein EUGRSUZ_A01711 [Eucalyptus grandis]
Length=226

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  120  FATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQD  299
              T  LRS  +G+ SGI    + +    F+R  +ECKESRIGKQPI VP NVTI +EGQ 
Sbjct  9    LQTCKLRSAILGERSGICISSVPVTHVGFMRSNIECKESRIGKQPIEVPKNVTITLEGQS  68

Query  300  FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKG  479
             +VKGPLGEL   YPREVK+EK+ESG L+V KA+ETRRAN+MHGLFRTLTDNM+VGVSKG
Sbjct  69   LRVKGPLGELSQIYPREVKVEKQESGYLKVNKALETRRANQMHGLFRTLTDNMVVGVSKG  128

Query  480  FDKKLQL  500
            F+K+LQL
Sbjct  129  FEKRLQL  135



>ref|XP_010457601.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Camelina 
sativa]
Length=223

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 6/124 (5%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTI---ARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  308
            RS F+GD +    FK++I   A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KV
Sbjct  12   RSAFLGDRN---VFKVSITPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKV  68

Query  309  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  488
            KGPLGEL +TYPREV+L KE+SG+LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+K
Sbjct  69   KGPLGELALTYPREVELTKEDSGLLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEK  128

Query  489  KLQL  500
            KL L
Sbjct  129  KLIL  132



>ref|XP_010243082.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Nelumbo 
nucifera]
Length=226

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  129  SNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  308
             NL+S F+G+ S  +  ++ + +   +RK VECKESRIGK+ I VPSNVTI +EGQD KV
Sbjct  12   CNLKSTFLGEMSATQVVRVPVTKVGLLRKVVECKESRIGKKAIEVPSNVTITLEGQDLKV  71

Query  309  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  488
            KGPLGEL  TYPREVK+ +EESG L+V KA++TRRAN+MHGLFRTLTDNM+VGVSKGF+K
Sbjct  72   KGPLGELSRTYPREVKIVREESGTLKVNKALDTRRANQMHGLFRTLTDNMVVGVSKGFEK  131

Query  489  KLQL  500
            +LQL
Sbjct  132  RLQL  135



>ref|XP_010475192.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Camelina 
sativa]
Length=224

 Score =   174 bits (440),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLT-IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKG  314
            RS F+GD +  +    T  A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKG
Sbjct  12   RSAFLGDRNVFKVSSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKG  71

Query  315  PLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKL  494
            PLGEL +TYPREV+L KE+SG+LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL
Sbjct  72   PLGELALTYPREVELTKEDSGLLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKL  131

Query  495  QL  500
             L
Sbjct  132  IL  133



>emb|CDY49511.1| BnaC05g03230D [Brassica napus]
Length=223

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  317
            RS F+GD +  +      A+  + RKT++CKESRIGKQPI VP+NVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSATPSAQVGYSRKTIQCKESRIGKQPIAVPTNVTIALEGQDLKVKGP  71

Query  318  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  497
            LGEL +TYPREV+L KE++G LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct  72   LGELALTYPREVELIKEDAGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI  131

Query  498  L  500
            L
Sbjct  132  L  132



>gb|ACG25590.1| 50S ribosomal protein L6 [Zea mays]
Length=224

 Score =   171 bits (433),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 7/123 (6%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLT----IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  305
            RS+F+GD +    FK++      +  F  KT+ECKESRIGKQPI VPSNVTI +EGQD K
Sbjct  12   RSSFLGDRNA---FKVSTTPPFTQVGFSSKTIECKESRIGKQPISVPSNVTIALEGQDLK  68

Query  306  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFD  485
            VKGPLGEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+
Sbjct  69   VKGPLGELALTYPREVELLKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFE  128

Query  486  KKL  494
            KKL
Sbjct  129  KKL  131



>ref|XP_010907839.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Elaeis guineensis]
Length=247

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  117  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            +  + NL+S F+G+   I      I+R  F+RK V+CKESRIGK+PI VP NVTI ++GQ
Sbjct  29   SIHSCNLKSLFLGERKEICITNSPISRIGFLRKPVQCKESRIGKRPIEVPPNVTIALDGQ  88

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL  TYPREVK+E  ESG LRV KA +TRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  89   DLKVKGPLGELSTTYPREVKIEILESGTLRVFKASDTRRANQMHGLFRTLTDNMVVGVSK  148

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  149  GFEKRLQL  156



>dbj|BAH20405.1| AT1G05190 [Arabidopsis thaliana]
Length=200

 Score =   169 bits (427),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  ARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEE  371
            A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPLGEL +TYPREV+L KEE
Sbjct  7    AQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPLGELALTYPREVELTKEE  66

Query  372  SGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  67   SGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  109



>ref|XP_009118616.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Brassica 
rapa]
Length=224

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 7/125 (6%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLT----IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  305
            RS+F+GD +    FK++      +  F  KT+ECKESRIGKQPI VPSNVTI + GQD K
Sbjct  12   RSSFLGDRNA---FKVSTTPPFTQVGFSSKTIECKESRIGKQPISVPSNVTIALAGQDLK  68

Query  306  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFD  485
            VKGPLGEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+
Sbjct  69   VKGPLGELALTYPREVELLKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFE  128

Query  486  KKLQL  500
            KKL L
Sbjct  129  KKLIL  133



>ref|XP_003557902.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Brachypodium 
distachyon]
Length=226

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F+G + GIR   +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFLGKSQGIRLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEQQFVKAK  72

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+
Sbjct  73   GPLGELSLNYPNEVKVVKEESGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKR  132

Query  492  LQL  500
            LQL
Sbjct  133  LQL  135



>ref|XP_006650092.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Oryza 
brachyantha]
Length=226

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F+    GIR   +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFVAKTQGIRLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAK  72

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDKK
Sbjct  73   GPLGELSLNYPAEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKK  132

Query  492  LQL  500
            LQL
Sbjct  133  LQL  135



>emb|CDY06163.1| BnaA09g50400D [Brassica napus]
Length=224

 Score =   169 bits (428),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 7/125 (6%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLT----IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  305
            RS+F+GD +    FK++      +  F  KT+ECKESRIGKQPI VPSNVTI + GQD K
Sbjct  12   RSSFLGDRNA---FKVSTTPPFTQVGFSSKTIECKESRIGKQPISVPSNVTIALAGQDLK  68

Query  306  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFD  485
            VKGPLGEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+
Sbjct  69   VKGPLGELALTYPREVELLKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFE  128

Query  486  KKLQL  500
            KKL L
Sbjct  129  KKLIL  133



>ref|NP_001050139.1| Os03g0356300 [Oryza sativa Japonica Group]
 gb|ABF96017.1| 50S ribosomal protein L6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12053.1| Os03g0356300 [Oryza sativa Japonica Group]
 gb|EAY90037.1| hypothetical protein OsI_11607 [Oryza sativa Indica Group]
 dbj|BAG87949.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F G   GIR   +   R  FVR TVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFAGKTQGIRLRVIPAGRVGFVRTTVECKESRIGKKPIEVPSNVTLTLEEQFIKAK  72

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDKK
Sbjct  73   GPLGELSLNYPGEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKK  132

Query  492  LQL  500
            LQL
Sbjct  133  LQL  135



>ref|NP_001051292.1| Os03g0751400 [Oryza sativa Japonica Group]
 gb|AAO32311.1| putative chloroplast 50S ribosomal protein L6 [Oryza sativa Japonica 
Group]
 gb|AAR87250.1| putative ribosomal protein L6 [Oryza sativa Japonica Group]
 gb|ABF98910.1| 50S ribosomal protein L6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13206.1| Os03g0751400 [Oryza sativa Japonica Group]
 gb|EAY91881.1| hypothetical protein OsI_13529 [Oryza sativa Indica Group]
 gb|EAZ28603.1| hypothetical protein OsJ_12590 [Oryza sativa Japonica Group]
 dbj|BAG91224.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  129  SNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  308
             N R+ F+G   GI    +   R  FVRKT+ECKESRIGK+PI VPSNVT+ +E Q  K 
Sbjct  12   CNSRTGFLGKRQGICLHVIPAGRVGFVRKTIECKESRIGKKPIEVPSNVTLTLEEQFIKA  71

Query  309  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  488
            KGPLGEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK
Sbjct  72   KGPLGELSLNYPGEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDNIIVGVSKGFDK  131

Query  489  KLQL  500
            KLQL
Sbjct  132  KLQL  135



>gb|EAZ26952.1| hypothetical protein OsJ_10878 [Oryza sativa Japonica Group]
Length=226

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F G   GIR   +   R  FVR TVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFAGKTQGIRLRVIPAGRVGFVRTTVECKESRIGKKPIEVPSNVTLTLEEQFIKAK  72

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDKK
Sbjct  73   GPLGELSLNYPGEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKK  132

Query  492  LQL  500
            LQL
Sbjct  133  LQL  135



>dbj|BAJ92513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = +3

Query  129  SNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  308
            SN R+ F+G + GI    +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K 
Sbjct  2    SNSRTGFLGKSRGIHLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKA  61

Query  309  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  488
            KGPLGEL + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK
Sbjct  62   KGPLGELSLNYPTEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDK  121

Query  489  KLQL  500
            +LQL
Sbjct  122  RLQL  125



>ref|XP_002465260.1| hypothetical protein SORBIDRAFT_01g035090 [Sorghum bicolor]
 gb|EER92258.1| hypothetical protein SORBIDRAFT_01g035090 [Sorghum bicolor]
Length=226

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F+G   GIR   L   R  FVR  VECKESRIGKQPI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTHGIRPRVLPAGRVGFVRTVVECKESRIGKQPIEVPSNVTLTLEEQFVKAK  72

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL +++P +VK+ KEESG+LRV K  ET+RAN+MHGLFRTLTDN+IVGVSKGFDKK
Sbjct  73   GPLGELSLSFPGDVKIVKEESGMLRVYKTAETKRANQMHGLFRTLTDNIIVGVSKGFDKK  132

Query  492  LQL  500
            LQL
Sbjct  133  LQL  135



>dbj|BAJ84917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=239

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F+G + GI    +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  26   NSRTGFLGKSRGIHLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAK  85

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+
Sbjct  86   GPLGELSLNYPTEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKR  145

Query  492  LQL  500
            LQL
Sbjct  146  LQL  148



>dbj|BAJ91776.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88259.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93276.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +3

Query  129  SNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  308
             N R+ F+G + GI    +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K 
Sbjct  12   CNSRTGFLGKSRGIHLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKA  71

Query  309  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  488
            KGPLGEL + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK
Sbjct  72   KGPLGELSLNYPTEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDK  131

Query  489  KLQL  500
            +LQL
Sbjct  132  RLQL  135



>gb|KDO41664.1| hypothetical protein CISIN_1g027306mg [Citrus sinensis]
Length=199

 Score =   163 bits (412),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +3

Query  183  LTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLE  362
            + + R  F RKT+ECKESRIGKQPI VPSNVTI + GQD KVKGPLGEL + YPREVK++
Sbjct  4    VPVNRVGFSRKTIECKESRIGKQPIEVPSNVTITLGGQDLKVKGPLGELSLVYPREVKVD  63

Query  363  KEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +E+S  LRVRK +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQ+
Sbjct  64   REDS-FLRVRKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQM  108



>gb|EMT33559.1| 50S ribosomal protein L6, chloroplastic [Aegilops tauschii]
Length=279

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F+G + GI    +   R  F+RKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  66   NSRTGFLGKSQGILLRVIPAGRVGFIRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAK  125

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+
Sbjct  126  GPLGELSLNYPTEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKR  185

Query  492  LQL  500
            LQL
Sbjct  186  LQL  188



>gb|EPS61113.1| hypothetical protein M569_13685, partial [Genlisea aurea]
Length=208

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +3

Query  207  VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLR  386
            VRK  ECKESRIGKQPI VPS V++ +EGQD KVKGPLGEL ITYPRE+++ +EESGVL+
Sbjct  20   VRKITECKESRIGKQPITVPSTVSLTLEGQDLKVKGPLGELAITYPREIQVLEEESGVLK  79

Query  387  VRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            VRKA+++RRAN+MHGLFRTLTDNM+VGVS+GF+K+LQL
Sbjct  80   VRKALDSRRANQMHGLFRTLTDNMVVGVSRGFEKRLQL  117



>ref|XP_004984341.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Setaria 
italica]
Length=226

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F+G   GIR   +   R  FVR  VECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTQGIRPRVIPAGRVGFVRTVVECKESRIGKKPIDVPSNVTLTLEEQFVKAK  72

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL ++YP EVK+ KEESG LR+ K  ET+RAN+MHGLFRTLTDN+I+GVSKGFDKK
Sbjct  73   GPLGELSLSYPGEVKVVKEESGKLRLYKTAETKRANQMHGLFRTLTDNIIIGVSKGFDKK  132

Query  492  LQL  500
            LQL
Sbjct  133  LQL  135



>ref|NP_001148555.1| 50S ribosomal protein L6 [Zea mays]
 gb|ACG32024.1| 50S ribosomal protein L6 [Zea mays]
 gb|ACN30855.1| unknown [Zea mays]
 gb|AFW88352.1| 50S ribosomal protein L6 [Zea mays]
Length=226

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +3

Query  129  SNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  308
             N R+ F+G   GIR       R  FVR  VECKESRIGKQPI VPSNVT+ +E Q  K 
Sbjct  12   CNSRTGFLGKTRGIRPCVFPAGRVGFVRTVVECKESRIGKQPIEVPSNVTLTLEEQFVKA  71

Query  309  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  488
            KGPLGEL +++P ++K+ KEESG LRV K  ET+RAN+MHGLFRTLTDN+IVGVSKGFDK
Sbjct  72   KGPLGELSLSFPGDLKIVKEESGNLRVYKTAETKRANQMHGLFRTLTDNIIVGVSKGFDK  131

Query  489  KLQL  500
            KLQL
Sbjct  132  KLQL  135



>gb|EMS56589.1| 50S ribosomal protein L6, chloroplastic [Triticum urartu]
Length=280

 Score =   162 bits (410),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R  F+G + GI    +   R  F+RKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  67   NSRIGFLGKSQGILLRVIPAGRVGFIRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAK  126

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+
Sbjct  127  GPLGELTLNYPAEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKR  186

Query  492  LQL  500
            LQL
Sbjct  187  LQL  189



>ref|NP_001152325.1| 50S ribosomal protein L6 [Zea mays]
 gb|ACG47033.1| 50S ribosomal protein L6 [Zea mays]
 tpg|DAA45424.1| TPA: 50S ribosomal protein L6 [Zea mays]
Length=226

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F+G   G R    +  R  FVR  VECKESRIGKQPI VP NVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTHGTRPRLFSAGRVGFVRTLVECKESRIGKQPIEVPPNVTLTLEEQFVKAK  72

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            GPLGEL +++P +VK+ KEESG LRV K  ET+RAN+MHGLFRTLTDN+IVGVSKGFDKK
Sbjct  73   GPLGELSLSFPGDVKIVKEESGNLRVYKTAETKRANQMHGLFRTLTDNIIVGVSKGFDKK  132

Query  492  LQL  500
            LQL
Sbjct  133  LQL  135



>ref|XP_006858065.1| hypothetical protein AMTR_s00062p00057610 [Amborella trichopoda]
 gb|ERN19532.1| hypothetical protein AMTR_s00062p00057610 [Amborella trichopoda]
Length=225

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +3

Query  135  LRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKG  314
            L+S F G+ +G       +    F RK VECKESR+GK PI VPS+VTI ++GQD KVKG
Sbjct  13   LKSKFWGEKNGRVHTSSPVIGIGFFRKNVECKESRVGKHPIEVPSSVTITLDGQDLKVKG  72

Query  315  PLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKL  494
            PLGEL  TYPREVK+E+ +   L+V KA++TRRAN+MHGLFRTLTDNM+VGVSKGF+K+L
Sbjct  73   PLGELSRTYPREVKVERLDPTTLKVSKALDTRRANQMHGLFRTLTDNMVVGVSKGFEKRL  132

Query  495  QL  500
            QL
Sbjct  133  QL  134



>emb|CDP19076.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 10/128 (8%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIA---RNNFV--RKTVECKESRIGKQPIPVPSNVTIKMEGQ  296
            NL+S F    +G+R  ++ +       FV  R  VECKESRIGKQ I VPSNVT+ ++GQ
Sbjct  13   NLKSPF----TGMRVPRIAVVGYQHAKFVTRRTIVECKESRIGKQLIEVPSNVTLTIDGQ  68

Query  297  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  476
            D KVKGPLGEL +TYP+E+ L++++SG LRVRK++ETRRAN+MHGLFRTLTDNM+VGVSK
Sbjct  69   DLKVKGPLGELALTYPKEILLQRDDSG-LRVRKSIETRRANQMHGLFRTLTDNMVVGVSK  127

Query  477  GFDKKLQL  500
            GF+K+LQL
Sbjct  128  GFEKRLQL  135



>gb|ABK21300.1| unknown [Picea sitchensis]
 gb|ABK26219.1| unknown [Picea sitchensis]
Length=231

 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 98/126 (78%), Gaps = 4/126 (3%)
 Frame = +3

Query  135  LRSNFIGDASGIRFFK----LTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDF  302
            LRS  +G+ +G++  +    + I +   VR T+ECKESRIGK+P+ VP+NV I +EGQ  
Sbjct  15   LRSTLLGEDNGLKAARDRPAIAIVKLPSVRPTIECKESRIGKKPVVVPANVNITLEGQHI  74

Query  303  KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGF  482
            +V G LGEL  TYP E+K+E++ SG +++ KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF
Sbjct  75   RVNGLLGELSQTYPNEIKVERDPSGFIKISKAVETRRANQMHGLFRTLTDNMVVGVSKGF  134

Query  483  DKKLQL  500
            +KKLQL
Sbjct  135  EKKLQL  140



>ref|XP_008680805.1| PREDICTED: 50S ribosomal protein L6 isoform X1 [Zea mays]
Length=245

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 93/142 (65%), Gaps = 19/142 (13%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            N R+ F+G   G R    +  R  FVR  VECKESRIGKQPI VP NVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTHGTRPRLFSAGRVGFVRTLVECKESRIGKQPIEVPPNVTLTLEEQFVKAK  72

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLF------------------  437
            GPLGEL +++P +VK+ KEESG LRV K  ET+RAN+MHGLF                  
Sbjct  73   GPLGELSLSFPGDVKIVKEESGNLRVYKTAETKRANQMHGLFRSSKQKHLRQGHMQAGTT  132

Query  438  -RTLTDNMIVGVSKGFDKKLQL  500
             RTLTDN+IVGVSKGFDKKLQL
Sbjct  133  RRTLTDNIIVGVSKGFDKKLQL  154



>ref|XP_006376781.1| hypothetical protein POPTR_0012s06340g, partial [Populus trichocarpa]
 ref|XP_006376782.1| hypothetical protein POPTR_0012s06350g, partial [Populus trichocarpa]
 gb|ERP54578.1| hypothetical protein POPTR_0012s06340g, partial [Populus trichocarpa]
 gb|ERP54579.1| hypothetical protein POPTR_0012s06350g, partial [Populus trichocarpa]
Length=205

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  311
            NLRS F+ + SGI    + + R  F R+ +ECKES IGKQP+ VP NVTI +EGQ+ KVK
Sbjct  1    NLRSVFLDERSGICAPSVPVTRVGFSREIIECKESWIGKQPVQVPFNVTITLEGQNLKVK  60

Query  312  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK  491
            G LG L   YP+EVK+E++E+G+L+V+KA++TR AN+MHGLFRTLT+NM+VGVS  F+K+
Sbjct  61   GLLGGLSRNYPQEVKIERDENGILQVKKAVDTRIANQMHGLFRTLTNNMVVGVSNDFEKR  120



>ref|XP_002979598.1| hypothetical protein SELMODRAFT_110948 [Selaginella moellendorffii]
 gb|EFJ19487.1| hypothetical protein SELMODRAFT_110948 [Selaginella moellendorffii]
Length=220

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +3

Query  126  TSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  305
             S LRSNF G+  G      + + +  +   V CKESRIGK+P+ VP +V + ++G +  
Sbjct  5    CSGLRSNFSGETLGASICSSSSSASGNLPLRVICKESRIGKRPVEVPKSVNVVLQGPNLS  64

Query  306  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFD  485
            VKGPLGEL   YPREV L ++ESG + V +A+ETRRA +MHGLFRTLTDNM+VGVS+GF+
Sbjct  65   VKGPLGELTRYYPREVSLTRDESGRIVVTRALETRRARQMHGLFRTLTDNMVVGVSQGFE  124

Query  486  KKLQL  500
            KKLQ+
Sbjct  125  KKLQM  129



>ref|XP_008802994.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Phoenix dactylifera]
Length=175

 Score =   131 bits (330),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  252  PIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHG  431
            PI VP NVTI ++GQD KVKG LGEL  TYPREVK+E+ ESG LRV KA++TRRAN+MHG
Sbjct  2    PIEVPPNVTIALDGQDLKVKGRLGELSRTYPREVKIERLESGTLRVFKALDTRRANQMHG  61

Query  432  LFRTLTDNMIVGVSKGFDKKLQL  500
            LFRTLTDNM+VGVSKGF+K+LQL
Sbjct  62   LFRTLTDNMVVGVSKGFEKRLQL  84



>ref|XP_002977678.1| hypothetical protein SELMODRAFT_107348, partial [Selaginella 
moellendorffii]
 gb|EFJ21016.1| hypothetical protein SELMODRAFT_107348, partial [Selaginella 
moellendorffii]
Length=212

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  317
            RSNF G+  G      + + +  +   V CKESRIGK+P+ VP +V + ++G +  VKGP
Sbjct  1    RSNFSGETLGTSICSSSSSASGNLPLRVICKESRIGKRPVEVPKSVNVVLQGPNLSVKGP  60

Query  318  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  497
            LGEL   YPREV L ++ESG + V +A+ETRRA +MHGLFRTLTDNM+VGVS+GF+KKLQ
Sbjct  61   LGELTRYYPREVSLTRDESGRIVVTRALETRRARQMHGLFRTLTDNMVVGVSQGFEKKLQ  120

Query  498  L  500
            +
Sbjct  121  M  121



>ref|XP_001771522.1| predicted protein [Physcomitrella patens]
 gb|EDQ63722.1| predicted protein [Physcomitrella patens]
Length=230

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = +3

Query  219  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKA  398
            ++ KESRIGK PIPVP  VTI +EGQ   VKGPLGEL  TYPREVKL      VL V +A
Sbjct  47   IKAKESRIGKAPIPVPKGVTINLEGQSLTVKGPLGELARTYPREVKLT-NAGDVLTVERA  105

Query  399  METRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +E+RRA +MHGLFRTLTDNM++GVSKGF+K+LQL
Sbjct  106  VESRRARQMHGLFRTLTDNMVIGVSKGFEKRLQL  139



>ref|XP_001784938.1| predicted protein [Physcomitrella patens]
 gb|EDQ50246.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 91/132 (69%), Gaps = 11/132 (8%)
 Frame = +3

Query  123  ATSNLRSNFIG-----DASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKM  287
             +S+LRS+F G     D +G         +   V   +E KESRIGK PIPVP  VT+ +
Sbjct  12   CSSSLRSSFQGESLIVDNAGSLCQVQLQGKGALV---IEAKESRIGKAPIPVPKGVTVNL  68

Query  288  EGQDFKVKGPLGELGITYPREVKLEKEESG-VLRVRKAMETRRANEMHGLFRTLTDNMIV  464
            +GQ+  VKG LGEL  TYPREVKL    SG VL V +A+E+RRA +MHGLFRTLTDNM++
Sbjct  69   DGQNLSVKGALGELVRTYPREVKL--TNSGEVLLVERAVESRRARQMHGLFRTLTDNMVI  126

Query  465  GVSKGFDKKLQL  500
            GVSKGF+K+LQL
Sbjct  127  GVSKGFEKRLQL  138



>tpg|DAA45423.1| TPA: hypothetical protein ZEAMMB73_235465 [Zea mays]
Length=115

 Score =   122 bits (305),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +3

Query  129  SNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  308
             N R+ F+G   G R    +  R  FVR  VECKESRIGKQPI VP NVT+ +E Q  K 
Sbjct  12   CNSRTGFLGKTHGTRPRLFSAGRVGFVRTLVECKESRIGKQPIEVPPNVTLTLEEQFVKA  71

Query  309  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFR  440
            KGPLGEL +++P +VK+ KEESG LRV K  ET+RAN+MHGLFR
Sbjct  72   KGPLGELSLSFPGDVKIVKEESGNLRVYKTAETKRANQMHGLFR  115



>gb|KEH16126.1| 50S ribosomal protein L6 [Medicago truncatula]
Length=163

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  285  MEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIV  464
            MEGQ F  KGPLGEL +TYPREVK+E++E GVL+V KA+ETRRAN+MHGLFRTLTDN++V
Sbjct  1    MEGQYFHAKGPLGELSLTYPREVKVERQEEGVLKVSKAVETRRANQMHGLFRTLTDNIVV  60

Query  465  GVSKGFDKKLQL  500
            GVSKGF+KKLQL
Sbjct  61   GVSKGFEKKLQL  72



>emb|CDY41816.1| BnaC02g12270D [Brassica napus]
Length=208

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  294  QDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVS  473
            QD KVKGPLGEL +TYP EV+L +E+SG LRVRK +ETRRA EMHGLFRTLTDNM+VGVS
Sbjct  49   QDLKVKGPLGELALTYPPEVELTEEDSGFLRVRKTVETRRAKEMHGLFRTLTDNMVVGVS  108

Query  474  KGFDKKLQL  500
            KGF+K L+L
Sbjct  109  KGFEKTLEL  117



>ref|XP_006376783.1| hypothetical protein POPTR_0012s06360g, partial [Populus trichocarpa]
 gb|ERP54580.1| hypothetical protein POPTR_0012s06360g, partial [Populus trichocarpa]
Length=171

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 3/85 (4%)
 Frame = +3

Query  219  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKA  398
            +ECKES IGKQP+ VP NVTI +EGQ+ KVKG LG L   YP+EVK+E++E+G+L+V+KA
Sbjct  3    IECKESWIGKQPVQVPFNVTITLEGQNLKVKGLLGGLSRNYPQEVKIERDENGILQVKKA  62

Query  399  METRRANEMHGLFRTLTDNMIVGVS  473
            ++TR AN+MHGLFR L    +VGV 
Sbjct  63   VDTRIANQMHGLFRDL---QLVGVG  84



>gb|KIZ02220.1| 50S ribosomal protein L6 [Monoraphidium neglectum]
Length=200

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +3

Query  219  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKA  398
            V CKESRIG +PIPVP  VT+ ++G   KVKGP GEL +T    V +E+ E G L +++A
Sbjct  18   VVCKESRIGSKPIPVPKGVTVDLKGSHLKVKGPKGELELTLTPYVTIEQTE-GKLLLKRA  76

Query  399  METRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
             ET++A  MHGL RTL  N++VGVS+GF+KKL+L
Sbjct  77   EETKKAAAMHGLSRTLASNIVVGVSEGFEKKLEL  110



>ref|XP_005849229.1| hypothetical protein CHLNCDRAFT_34831 [Chlorella variabilis]
 gb|EFN57127.1| hypothetical protein CHLNCDRAFT_34831 [Chlorella variabilis]
Length=209

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = +3

Query  180  KLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKL  359
            + T AR    +  V  K+SRIGK P+PVP  V++ ++GQ  KVKGP GEL  T+   VK 
Sbjct  15   QATTARQQRQQLNVVAKDSRIGKVPVPVPDKVSVTLDGQTVKVKGPRGELQRTFHPAVKF  74

Query  360  EKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            E+EE  + RV +A ETR AN+ HGL R+L  NM+VGV  GF  KLQ+
Sbjct  75   EQEEKAI-RVVRANETRTANQQHGLARSLLSNMVVGVDTGFTTKLQM  120



>ref|XP_011399322.1| 50S ribosomal protein L6, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM22401.1| 50S ribosomal protein L6, chloroplastic [Auxenochlorella protothecoides]
Length=210

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = +3

Query  177  FKLTIARNNF-VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREV  353
            FK  + R    + + ++CKESRIG + IPVP  V +K++G +F VKGP GEL  T    V
Sbjct  13   FKTNVGRPRVSISRLIQCKESRIGVKAIPVPKGVDVKLDGHNFVVKGPKGELARTLSTLV  72

Query  354  KLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
             + +EE+G +R+ + +ETR A   HGL R L +NM+VGVS GF + L L
Sbjct  73   TVSREENGDIRLVRNVETREAGAQHGLARALLNNMVVGVSTGFTRTLML  121



>ref|WP_020691491.1| 50S ribosomal protein L6 [Aeromicrobium massiliense]
Length=180

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+PVP+NVT+ ++GQD  VKGP GEL  +    + + K E G L V +  + RR
Sbjct  2    SRIGKIPVPVPANVTVTIDGQDVTVKGPKGELSHSVAEPITVAKSEDGSLLVERPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NMIVGV+ G++KKL++
Sbjct  62   SKALHGLSRTLVNNMIVGVTDGYEKKLEI  90



>ref|WP_030473453.1| 50S ribosomal protein L6 [Lechevalieria aerocolonigenes]
Length=179

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI VPS V + + GQD  VKGP G L +T    + LEK E G L V++  + RR
Sbjct  2    SRIGKQPIIVPSGVDVNIAGQDVSVKGPKGTLTLTIAEPISLEKAEDGTLEVKRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  NM+VGV++G++KK+++
Sbjct  62   NRALHGLSRTLVHNMVVGVTQGYEKKMEI  90



>ref|WP_007472094.1| 50S ribosomal protein L6 [Segniliparus rugosus]
 gb|EFV11908.1| 50S ribosomal protein L6 [Segniliparus rugosus ATCC BAA-974]
Length=180

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PI VPS V + ++GQD KVKGP GELG+T    +K+E+ E G L V +  + RR
Sbjct  2    SRIGRAPIQVPSGVDVTIDGQDVKVKGPKGELGLTLVEPIKVERGEDGALTVVRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL +N++VGV++G+ K+L++
Sbjct  62   NRALHGLSRTLVNNLVVGVTQGYTKQLEI  90



>ref|WP_017721159.1| 50S ribosomal protein L6 [Oscillatoria sp. PCC 10802]
Length=182

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P  VT++++GQ   VKGP GEL    P+EV++  E+SG + VR+  E+R 
Sbjct  2    SRIGKRPIPIPGKVTVEIDGQRVAVKGPKGELSRVLPQEVEV-VEDSGTIAVRRRDESRA  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A + HGL RTL  NMI GVS GF K+L++
Sbjct  61   ARQRHGLCRTLVANMIDGVSAGFQKRLEI  89



>ref|XP_001421323.1| Plastid ribosomal protein L6 large ribosomal subunit [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO99616.1| Plastid ribosomal protein L6 large ribosomal subunit [Ostreococcus 
lucimarinus CCE9901]
Length=213

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +3

Query  207  VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLR  386
            VR T+E KESRIGKQP+ VP  VT  ++     VKGP G L +++P +  +  EE   ++
Sbjct  28   VRATIEAKESRIGKQPVAVPKGVTYTLKDNHLAVKGPKGSLEMSFP-DTMVFTEEGDSIK  86

Query  387  VRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            + +A +T  A + HGL+RTL +NM+VGVS GF+KKL+L
Sbjct  87   ISRANDTPDARKGHGLYRTLANNMMVGVSTGFEKKLKL  124



>ref|WP_017325553.1| 50S ribosomal protein L6 [Synechococcus sp. PCC 7336]
Length=178

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIP+P  VT+K+EGQD  VKGP GEL  T P +V +   + G ++V     TR 
Sbjct  2    SRIGKQPIPIPDKVTVKIEGQDVAVKGPKGELQRTIPAKVTVVL-DGGEVKVAPVDSTRV  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
              +MHGL RTL  NM+ GVS+GF+K+L++
Sbjct  61   GRQMHGLCRTLVANMVEGVSQGFEKRLEI  89



>ref|XP_002505297.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66555.1| predicted protein [Micromonas sp. RCC299]
Length=220

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  216  TVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  395
             V  K+SRIGKQP+PVP  VT  ++     VKGP GEL + +P  + L + ++ +   R 
Sbjct  38   AVVAKQSRIGKQPVPVPKGVTYTLKDNHLSVKGPKGELQMQFPETMVLTEGDNEIAFAR-  96

Query  396  AMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A ++RRA E HGL+RTL +NM+VGVS GF+KKL+L
Sbjct  97   ADDSRRAREGHGLYRTLANNMMVGVSTGFEKKLKL  131



>ref|WP_014349107.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica]
 ref|YP_005262279.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica GUH-2]
 emb|CCF61635.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica GUH-2]
Length=179

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI +PS V + + GQD  VKGP G+L +T    + + K E G L+V +  + RR
Sbjct  2    SRIGKQPIAIPSGVEVTINGQDIAVKGPKGQLSLTVSEPITITKGEDGQLQVARPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NMI GV+KG++KKL++
Sbjct  62   SRALHGLTRTLVANMIEGVTKGYEKKLEI  90



>ref|WP_023647009.1| 50S ribosomal protein L6 [actinobacterium LLX17]
Length=180

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQD +VKGP GEL  T    + + K + G L + +  + RR
Sbjct  2    SRIGKIPVAVPSGVEVSIDGQDVRVKGPKGELSHTVAEPITISKSDDGTLSIERPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NM+VGV++G++KKL++
Sbjct  62   SKALHGLSRTLVNNMVVGVTEGYEKKLEI  90



>gb|KBT33208.1| 50S ribosomal protein L6 RplF, partial [Mycobacterium tuberculosis 
UT0119]
Length=103

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_030478310.1| 50S ribosomal protein L6 [Lentzea albidocapillata]
Length=179

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI VPS V + + GQD  +KGP G L +T    + +EK E G L V++  + RR
Sbjct  2    SRIGKQPIIVPSGVDVNIAGQDVSIKGPKGLLTLTLAEPIIVEKAEDGTLEVKRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  NM+VGV++G++KK+++
Sbjct  62   NRALHGLSRTLVHNMVVGVTQGYEKKMEI  90



>ref|WP_015105249.1| 50S ribosomal protein L6 [Saccharothrix espanaensis]
 emb|CCH35141.1| 50S ribosomal protein L6 [Saccharothrix espanaensis DSM 44229]
Length=179

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V + + GQD  VKGP G L +T    + +EK E G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIAGQDVNVKGPKGTLSLTIAEPIIIEKVEDGTLEVKRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NM++GV++G++KK+++
Sbjct  62   SRSLHGLSRTLVQNMVIGVTQGYEKKMEI  90



>ref|WP_015805277.1| 50S ribosomal protein L6 [Actinosynnema mirum]
 gb|ACU40397.1| ribosomal protein L6 [Actinosynnema mirum DSM 43827]
Length=179

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V + ++GQ   VKGP G L +T    + LEK + G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIDGQAVSVKGPKGTLNLTIAEPITLEKADDGTLEVKRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NM+VGV++G++KK+++
Sbjct  62   SRSLHGLSRTLVQNMVVGVTQGYEKKMEI  90



>ref|WP_013139775.1| 50S ribosomal protein L6 [Segniliparus rotundus]
 gb|ADG99326.1| ribosomal protein L6 [Segniliparus rotundus DSM 44985]
Length=180

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PI VP  V + ++GQ+ KVKGP GELG+T    +K+E+ + GVL V +  + RR
Sbjct  2    SRIGRAPIQVPPGVDVTIDGQNVKVKGPKGELGLTLVEPIKVERGDDGVLSVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL +N++VGV++G+ K+L++
Sbjct  62   NRSLHGLSRTLVNNLVVGVTEGYTKQLEI  90



>ref|WP_036533248.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica]
Length=179

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI +PS V + + GQD  VKGP G+L +T    + + K + G L+V +  + RR
Sbjct  2    SRIGKQPIAIPSGVEVTINGQDVAVKGPKGQLSLTVSEPITVTKGDDGQLQVARPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NMI GV+KG++KKL++
Sbjct  62   SRALHGLTRTLVANMIEGVTKGYEKKLEI  90



>ref|XP_005643355.1| ribosomal protein L6 [Coccomyxa subellipsoidea C-169]
 gb|EIE18811.1| ribosomal protein L6 [Coccomyxa subellipsoidea C-169]
Length=222

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMET  407
            KESRIGK PIP+P  V + +     KVKGP GEL +  P  V++E++E+  LRV K  E+
Sbjct  44   KESRIGKAPIPIPKGVQLTLTRDLLKVKGPKGELELAIPEIVEIEQQEN-ALRVYKMEES  102

Query  408  RRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            R+ANE+HGL R L +NM+VG S G+ K L L
Sbjct  103  RKANEVHGLIRALANNMVVGTSTGWIKTLSL  133



>ref|WP_023358196.1| 50S ribosomal protein L6 [Actinoplanes friuliensis]
 gb|AGZ39205.1| 50S ribosomal protein L6 [Actinoplanes friuliensis DSM 7358]
Length=180

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ  KVKGP GEL  T    + +EK E+G L V +  + RR
Sbjct  2    SRIGRKSIPVPAGVDVTITGQTVKVKGPKGELSHTVAEPITVEKAENGELAVNRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYKKTLEI  90



>ref|WP_039795552.1| 50S ribosomal protein L6 [Nocardia araoensis]
Length=179

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P+ V I ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKKPIAIPAGVDITIDGQDIAVKGPKGTLSLTVAEPITVAKGEDGQLEVARPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NMIVGV++G++KK+++
Sbjct  62   SRALHGLTRTLVSNMIVGVTQGYEKKMEI  90



>ref|WP_018908047.1| 50S ribosomal protein L6 [Salinispora arenicola]
Length=180

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + ++GQ  KVKGP GEL  T    + +E+ E G L V +  E R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNEERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_028479346.1| 50S ribosomal protein L6 [Nocardia sp. CNY236]
Length=179

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P+ V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKKPIAIPTGVDVSIDGQDVSVKGPKGTLSLTVSEPITVAKSEDGQLEVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NMIVGV++G++KK+++
Sbjct  62   SRALHGLTRTLVSNMIVGVTQGYEKKMEI  90



>ref|WP_019500654.1| 50S ribosomal protein L6 [Pseudanabaena sp. PCC 6802]
Length=179

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIPVP+ VT+ + GQ   VKGP GEL  T P +V++ + +S VL+V +  ++R 
Sbjct  2    SRIGKRPIPVPNKVTVTIAGQHVTVKGPKGELQRTLPNQVEVVQSDS-VLQVNRRDDSRP  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A +MHGL RTL  NM+ GVS+GF ++L++
Sbjct  61   ARQMHGLCRTLVANMVEGVSEGFQRRLEI  89



>ref|WP_013016481.1| 50S ribosomal protein L6 [Stackebrandtia nassauensis]
 gb|ADD40910.1| ribosomal protein L6 [Stackebrandtia nassauensis DSM 44728]
Length=179

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+Q IPVP  V + ++G D KVKGP GEL  T    + +EK E G L++ +  + RR
Sbjct  2    SRIGRQSIPVPGGVEVTIDGTDVKVKGPKGELSRTLVEPITIEKNEDGSLQLNRPDDDRR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  MHGL R+L +NM++GVS+G+ K L++
Sbjct  62   SRAMHGLCRSLVNNMVIGVSEGYKKSLEI  90



>ref|WP_014847225.1| 50S ribosomal protein L6 [Propionibacterium propionicum]
 gb|AFN45762.1| ribosomal protein L6 [Propionibacterium propionicum F0230a]
Length=180

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PI VPSNV +K++GQD  VKGP GEL  T    + + K E G L+V +  + R 
Sbjct  2    SRIGRLPIAVPSNVEVKIDGQDVAVKGPKGELKFTVREPITIAKNEQGELQVSRPDDERL  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NM+ GV++G++KKL++
Sbjct  62   SRSLHGLTRTLVSNMVTGVTQGYEKKLEI  90



>ref|WP_007078621.1| 50S ribosomal protein L6 [Aeromicrobium marinum]
 gb|EFQ81832.1| ribosomal protein L6 [Aeromicrobium marinum DSM 15272]
Length=180

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VP+ V + +EGQD +VKGP GEL  T    + + + + G L V +  + RR
Sbjct  2    SRIGKIPVAVPAGVEVSIEGQDVRVKGPKGELAHTVAEPIVVSRTDDGALAVERPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NM++GV++G++KKL++
Sbjct  62   SKALHGLSRTLINNMVIGVTEGYEKKLEI  90



>ref|WP_015227140.1| 50S ribosomal protein L6 [Halothece sp. PCC 7418]
 gb|AFZ45268.1| LSU ribosomal protein L6P [Halothece sp. PCC 7418]
Length=179

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIP+P  V I ++G+  KVKGP GEL  T P  V +E+E++ +L V++  ++R+
Sbjct  2    SRIGKLPIPIPQKVEITVDGKQVKVKGPKGELEQTMPDFVTIEQEDNQIL-VKRVNDSRK  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NM+ GVS+GF+++LQ+
Sbjct  61   ARERHGLARTLVANMVHGVSQGFERRLQI  89



>ref|WP_011612508.1| 50S ribosomal protein L6 [Trichodesmium erythraeum]
 sp|Q110C1.1|RL6_TRIEI RecName: Full=50S ribosomal protein L6 [Trichodesmium erythraeum 
IMS101]
 gb|ABG52153.1| LSU ribosomal protein L6P [Trichodesmium erythraeum IMS101]
Length=179

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIP+P  VTI +EGQ   VKGPLGEL    P E+ ++++E+ ++ V+   ++RR
Sbjct  2    SRIGKLPIPIPKKVTITIEGQKVTVKGPLGELSRVLPPEIAVKEQENTII-VKPQEQSRR  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKL  494
            A + +GL RTL  NM+ GVSKG++K+L
Sbjct  61   ARQRYGLCRTLVANMVEGVSKGYEKRL  87



>ref|WP_040788652.1| 50S ribosomal protein L6 [Nocardia paucivorans]
Length=179

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+PVPS V + + GQD  VKGP G+L +T    + + + + G + V +  + RR
Sbjct  2    SRIGKHPVPVPSGVEVTLNGQDIAVKGPKGQLSLTVAEPITVSRNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NMI GV++G++KK+++
Sbjct  62   SRSLHGLTRTLIANMITGVTQGYEKKMEI  90



>ref|WP_010311645.1| 50S ribosomal protein L6 [Synechococcus sp. CB0101]
Length=179

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIPVP  VT+ + G D KVKGP GEL  T P  V + ++ S ++ V  A + RR
Sbjct  2    SRIGKAPIPVPGGVTVTLSGLDVKVKGPKGELSRTLPDGVTIAQDGSNLV-VSPASDNRR  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            + E HGL RTL  NM+ GVSKG+ +KL++
Sbjct  61   SRERHGLCRTLVANMVEGVSKGYTRKLEI  89



>ref|WP_024800413.1| 50S ribosomal protein L6 [Nocardia sp. BMG51109]
Length=179

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+P+PVP+ V + +EGQ   VKGP G L  T    + +++ ESG L + +  + RR
Sbjct  2    SRIGKRPVPVPAGVEVTIEGQHVSVKGPKGTLSHTIAEPITVDRAESGELEITRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL +NMIVGV++G++KK+++
Sbjct  62   NRSLHGLTRTLINNMIVGVTQGYEKKMEI  90



>ref|WP_040864897.1| 50S ribosomal protein L6 [Nocardia exalbida]
Length=179

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +PS V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKKPIALPSGVDVTIDGQDISVKGPKGTLSLTVAEPITVAKGEDGQLEVARPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NM+VGV++G++KK+++
Sbjct  62   SRALHGLTRTLVSNMVVGVTQGYEKKMEI  90



>ref|WP_043687380.1| 50S ribosomal protein L6 [Nocardia abscessus]
Length=179

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P+ V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKKPIAIPAGVDVAIDGQDVSVKGPKGALSLTIAEPITVAKGEDGQLEVVRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NMIVGV++G++KK+++
Sbjct  62   SRALHGLTRTLVSNMIVGVTQGYEKKMEI  90



>ref|WP_022605574.1| 50S ribosomal protein L6 [Rubidibacter lacunae]
 gb|ERN42229.1| ribosomal protein L6 [Rubidibacter lacunae KORDI 51-2]
Length=179

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P+ V++ ++GQ  KVKGP GEL    P  + + + + G L V +  E+R 
Sbjct  2    SRIGKRPIPIPAKVSVALDGQQVKVKGPKGELARILPAPIAIAQTD-GQLHVTRVDESRT  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A ++HGL RTL  NM+ GVS+GF +KL+L
Sbjct  61   ARQLHGLCRTLVANMVEGVSQGFTRKLEL  89



>ref|WP_034304256.1| 50S ribosomal protein L6 [Amycolatopsis lurida]
 gb|KFU83012.1| 50S ribosomal protein L6 [Amycolatopsis lurida NRRL 2430]
 gb|AJK51997.1| 50S ribosomal protein L6 [Amycolatopsis lurida NRRL 2430]
Length=179

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + +EGQ  KVKGP G L  T    + +EK E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIEGQQIKVKGPKGTLEHTIAEPITVEKAENGTLEVKRPDEERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>emb|CEG01824.1| Ribosomal protein L6, conserved site [Ostreococcus tauri]
Length=214

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +3

Query  207  VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLR  386
            V + VE KESRIGK+P+ VP  VT  ++     VKGP GEL + +P  +  E E+   ++
Sbjct  29   VTRVVEAKESRIGKKPVAVPKGVTYTLKDNHLAVKGPKGELKMQFPPTMVFE-EQGDAIK  87

Query  387  VRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            + ++ ++  A + HGL+RTL DNM VGVS GF+KKL+L
Sbjct  88   ITRSDDSPEARKGHGLYRTLADNMFVGVSTGFEKKLKL  125



>ref|WP_012184316.1| 50S ribosomal protein L6 [Salinispora arenicola]
 sp|A8M514.1|RL6_SALAI RecName: Full=50S ribosomal protein L6 [Salinispora arenicola 
CNS-205]
 gb|ABW00082.1| ribosomal protein L6 [Salinispora arenicola CNS-205]
Length=180

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + ++GQ  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_028191074.1| 50S ribosomal protein L6 [Salinispora arenicola]
Length=180

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + ++GQ  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_008275484.1| 50S ribosomal protein L6 [Cyanothece sp. CCY0110]
 gb|EAZ91358.1| 50S ribosomal protein L6 [Cyanothece sp. CCY0110]
Length=179

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V + ++   +L V++  ++R 
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSQVTVNQDGETIL-VQRVDDSRV  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGLFRTL  NMI GVSKGF+K+L +
Sbjct  61   ARERHGLFRTLVSNMIEGVSKGFEKRLSI  89



>ref|WP_024125573.1| 50S ribosomal protein L6 [Thermosynechococcus sp. NK55a]
 gb|AHB89192.1| 50S ribosomal protein L6 RplF [Thermosynechococcus sp. NK55a]
Length=187

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P NVT+ +EGQ   VKGP G+L   +P EV + +E   ++ VR+  ++R 
Sbjct  2    SRIGKRPIPLPKNVTLTLEGQQVTVKGPKGQLTRVFPPEVNVAQEGETIV-VRRRDDSRP  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NM+ GVS+GF KKL++
Sbjct  61   AKERHGLCRTLLANMVEGVSQGFTKKLEI  89



>ref|WP_009543883.1| MULTISPECIES: 50S ribosomal protein L6 [Cyanothece]
 sp|B1WQS5.1|RL6_CYAA5 RecName: Full=50S ribosomal protein L6 [Cyanothece sp. ATCC 51142]
 gb|ACB53377.1| 50S ribosomal protein L6 [Cyanothece sp. ATCC 51142]
Length=179

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P EV +  +E   + V++  ++R 
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSEVTVN-QEGETVEVQRVDDSRT  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGLFRTL  NMI GVS+GF+K+L +
Sbjct  61   ARERHGLFRTLVANMIQGVSQGFEKRLNI  89



>ref|WP_031712151.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KAN56897.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 3499MM]
Length=179

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKMARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_028848728.1| 50S ribosomal protein L6 [Thermocrispum agreste]
Length=179

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI +PS V + + GQ   VKGP G L  T    +K+ K E G LRV +  + R+
Sbjct  2    SRIGKQPIAIPSGVDVTISGQQVTVKGPKGTLTHTVAEPIKVSKAEDGTLRVTRPDDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N+I+GV++G++KK+++
Sbjct  62   SRALHGLTRTLVNNLIIGVTEGYEKKMEI  90



>ref|WP_007073021.1| 50S ribosomal protein L6 [Micromonospora sp. ATCC 39149]
 gb|EEP71745.1| 50S ribosomal protein L6 [Micromonospora sp. ATCC 39149]
Length=180

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V I ++GQ  KVKGP GEL +T    +  E+ E G L+V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGQTVKVKGPKGELTLTLAEPITAERAEDGQLQVNRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G  K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGHRKSLEI  90



>ref|WP_031711030.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KBN36706.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 36361]
Length=179

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_007465267.1| 50S ribosomal protein L6 [Micromonospora lupini]
 emb|CCH21405.1| 50S ribosomal subunit protein L6 [Micromonospora lupini str. 
Lupac 08]
Length=180

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V I ++GQ  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGQTVKVKGPKGELQHTIADPITVERAEDGQLNVNRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_013735942.1| 50S ribosomal protein L6 [Verrucosispora maris]
 gb|AEB47301.1| 50S ribosomal protein L6 [Verrucosispora maris AB-18-032]
Length=180

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVPS V + ++G+  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPSGVDVTIDGRTVKVKGPKGELSHTLAEPISIERAEDGQLSVNRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_003403673.1| MULTISPECIES: 50S ribosomal protein L6 [Mycobacterium tuberculosis 
complex]
 ref|NP_215233.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis H37Rv]
 ref|NP_854398.1| 50S ribosomal protein L6 [Mycobacterium bovis AF2122/97]
 ref|YP_007960622.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis CAS/NITR204]
 sp|P66312.1|RL6_MYCBO RecName: Full=50S ribosomal protein L6 [Mycobacterium bovis AF2122/97]
 sp|A1KGK0.1|RL6_MYCBP RecName: Full=50S ribosomal protein L6 [Mycobacterium bovis BCG 
str. Pasteur 1173P2]
 sp|A5U0A5.1|RL6_MYCTA RecName: Full=50S ribosomal protein L6 [Mycobacterium tuberculosis 
H37Ra]
 sp|C1AL53.1|RL6_MYCBT RecName: Full=50S ribosomal protein L6 [Mycobacterium bovis BCG 
str. Tokyo 172]
 sp|P9WH80.1|RL6_MYCTO RecName: Full=50S ribosomal protein L6 [Mycobacterium tuberculosis 
CDC1551]
 sp|P9WH81.1|RL6_MYCTU RecName: Full=50S ribosomal protein L6 [Mycobacterium tuberculosis 
H37Rv]
 gb|AAK44978.1| ribosomal protein L6 [Mycobacterium tuberculosis CDC1551]
 emb|CAD93602.1| PROBABLE 50S RIBOSOMAL PROTEIN L6 RPLF [Mycobacterium bovis AF2122/97]
 emb|CAL70755.1| Probable 50S ribosomal protein L6 rplF [Mycobacterium bovis BCG 
str. Pasteur 1173P2]
 gb|EAY59108.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis C]
 gb|EBA41224.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis str. 
Haarlem]
 gb|ABQ72455.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis H37Ra]
 gb|ABR05076.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis F11]
 dbj|BAH25032.1| 50S ribosomal protein L6 [Mycobacterium bovis BCG str. Tokyo 
172]
 gb|ACT23768.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis KZN 
1435]
 gb|EFD12279.1| LSU ribosomal protein L6 [Mycobacterium tuberculosis T46]
 gb|EFD16438.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis CPHL_A]
 gb|EFD42336.1| 50S ribosomal protein L6 rplF [Mycobacterium africanum K85]
 gb|EFD52459.1| ribosomal protein L6 [Mycobacterium tuberculosis 02_1987]
 gb|EFD57242.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis T92]
 gb|EFD60782.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis EAS054]
 gb|EFD72368.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis GM 
1503]
 gb|EFD76383.1| ribosomal protein L6 [Mycobacterium tuberculosis T85]
 gb|EFI29298.1| ribosomal protein L6 [Mycobacterium tuberculosis 94_M4241A]
 gb|EFO76118.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu001]
 gb|EFP48404.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu010]
 gb|EFP52308.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu011]
 gb|EFP55947.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu012]
 gb|EGB29913.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis CDC1551A]
 gb|EGE51992.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis W-148]
 gb|AEB02866.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis KZN 
4207]
 gb|AEJ45856.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis CCDC5079]
 gb|AEJ49494.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis CCDC5180]
 emb|CCC25800.1| putative 50S ribosomal protein L6 RPLF [Mycobacterium africanum 
GM041182]
 emb|CCC43064.1| putative 50S ribosomal protein L6 RPLF [Mycobacterium canettii 
CIPT 140010059]
 emb|CCC63327.1| probable 50S ribosomal protein L6 rplF [Mycobacterium bovis BCG 
str. Moreau RDJ]
 gb|AEM99174.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis CTRI-2]
 gb|AET18025.1| 50S ribosomal protein L6 [Mycobacterium bovis BCG str. Mexico]
 dbj|GAA44495.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis NCGM2209]
 emb|CCE36262.1| rplF [Mycobacterium tuberculosis UT205]
 dbj|BAL64604.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis str. Erdman 
= ATCC 35801]
 gb|AFE15682.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis RGTB327]
 gb|AFM48115.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis KZN 
605]
 gb|AFN48592.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H37Rv]
 emb|CCK50641.1| Putative 50S ribosomal protein L6 RplF [Mycobacterium canettii 
CIPT 140060008]
 emb|CCK54668.1| Putative 50S ribosomal protein L6 RplF [Mycobacterium canettii 
CIPT 140070008]
 emb|CCK58738.1| Putative 50S ribosomal protein L6 RplF [Mycobacterium canettii 
CIPT 140070010]
 emb|CCK62820.1| Putative 50S ribosomal protein L6 RplF [Mycobacterium canettii 
CIPT 140070017]
 emb|CCG10586.1| putative 50S RIBOSOMAL protein L6 RPLF [Mycobacterium tuberculosis 
7199-99]
 emb|CCP43463.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H37Rv]
 gb|AGE66677.1| 50S ribosomal protein L6 [Mycobacterium bovis BCG str. Korea 
1168P]
 gb|EMT37032.1| 50S ribosomal protein L6 [Mycobacterium orygis 112400015]
 gb|AGJ66740.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis str. Beijing/NITR203]
 gb|AGL26196.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis CAS/NITR204]
 gb|AGL30160.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis EAI5/NITR206]
 gb|AGL99187.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis CCDC5079]
 emb|CCI89897.1| Putative 50S ribosomal protein L6 RplF [Mycobacterium canettii 
CIPT 140070008]
 emb|CCI98417.1| Putative 50S ribosomal protein L6 RplF [Mycobacterium canettii 
CIPT 140070010]
 emb|CCI93956.1| Putative 50S ribosomal protein L6 RplF [Mycobacterium canettii 
CIPT 140060008]
 emb|CCJ02073.1| Putative 50S ribosomal protein L6 RplF [Mycobacterium canettii 
CIPT 140070017]
 gb|AGQ34233.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis EAI5]
 gb|EPZ63647.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis '98-R604 
INH-RIF-EM']
 gb|EQM23479.1| large subunit ribosomal protein L6 [Mycobacterium tuberculosis 
GuangZ0019]
 gb|EQM24439.1| large subunit ribosomal protein L6 [Mycobacterium tuberculosis 
FJ05194]
 gb|ESK73950.1| 50S ribosomal protein L6 [Mycobacterium bovis AN5]
 gb|ESK77283.1| 50S ribosomal protein L6 [Mycobacterium bovis 04-303]
 gb|EUA95103.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis INS_SEN]
 gb|EUA97257.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis INS_MDR]
 gb|EUB02045.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis INS_XDR]
 gb|AHJ41401.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis HKBS1]
 gb|AHJ45553.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis BT2]
 gb|AHJ49701.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis BT1]
 gb|AHJ53840.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis CCDC5180]
 gb|AHM06434.1| LSU ribosomal protein L6p (L9e) [Mycobacterium bovis BCG str. 
ATCC 35743]
 gb|KAK28102.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis CWCFVRF 
MDRTB 670]
 gb|KAK92394.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0036]
 gb|KAK97767.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis SK-B]
 gb|KAL09105.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0046]
 gb|KAL09278.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0026]
 gb|KAL16098.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0075]
 gb|KAL20478.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0018]
 gb|KAL24196.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0037]
 gb|KAL27987.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0040]
 gb|KAL32345.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0067]
 gb|KAL37387.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0081]
 gb|KAL39982.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0049]
 gb|KAL43669.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0043]
 gb|KAL45346.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-110]
 gb|KAL50807.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-142]
 gb|KAL56794.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0047]
 gb|KAL57174.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-123]
 gb|KAL61397.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-173]
 gb|KAL68508.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18320]
 gb|KAL70433.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18486]
 gb|KAL76151.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16764]
 gb|KAL78369.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD20344]
 gb|KAL84049.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17749]
 gb|KAL89729.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16765]
 gb|KAL91558.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 02_1987]
 gb|KAL94999.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA54]
 gb|KAM00763.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1029]
 gb|KAM03164.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1030]
 gb|KAM08080.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1926]
 gb|KAM13753.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-168]
 gb|KAM13999.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2352]
 gb|KAM17547.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2482AR]
 gb|KAM20072.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2485AR]
 gb|KAM26897.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2483AR]
 gb|KAM29555.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2101HD]
 gb|KAM29896.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2196MM]
 gb|KAM36203.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis D 4155]
 gb|KAM42459.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0062]
 gb|KAM44437.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis Kc 
32216]
 gb|KAM53893.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0009]
 gb|KAM54955.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0011]
 gb|KAM55781.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0051]
 gb|KAM65777.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0020]
 gb|KAM68156.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0026]
 gb|KAM72985.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0095]
 gb|KAM79133.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0108]
 gb|KAM80130.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0097]
 gb|KAM84920.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0112]
 gb|KAM88694.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0118]
 gb|KAM92709.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0141]
 gb|KAM95419.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0157]
 gb|KAN01585.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2484AR]
 gb|KAN04124.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2230BH]
 gb|KAN04854.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2074CJ]
 gb|KAN13191.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 3067CJ]
 gb|KAN17631.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2229BH]
 gb|KAN19914.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2228BH]
 gb|KAN21157.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2100HD]
 gb|KAN27006.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2094HD]
 gb|KAN32018.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2093HD]
 gb|KAN34988.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2099HD]
 gb|KAN38222.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2543MS]
 gb|KAN40450.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2091HD]
 gb|KAN48311.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2541MS]
 gb|KAN53989.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2089HD]
 gb|KAN58401.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2088HD]
 gb|KAN65205.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 1755BN]
 gb|KAN67013.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 1430BH]
 gb|KAN71838.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 1429BH]
 gb|KAN78376.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 1173CS]
 gb|KAN80822.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis Wt 
21231]
 gb|KAN82020.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 1010SM]
 gb|KAN91089.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis Wt 
21419]
 gb|KAN91550.1| 50S ribosomal protein L6 RplF [Mycobacterium bovis Bz 31150]
 gb|KAO00298.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis Mr 
4387]
 gb|KAO02417.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis Kc 
9614]
 gb|KAO03719.1| 50S ribosomal protein L6 RplF [Mycobacterium bovis B2 7505]
 gb|KAO08791.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17898]
 gb|KAO11560.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17904]
 gb|KAO18119.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17902]
 gb|KAO19936.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16555]
 gb|KAO24427.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18478]
 gb|KAO26019.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18489]
 gb|KAO30193.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD19964]
 gb|KAO35696.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD19693]
 gb|KAO40423.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD19042]
 gb|KAO44388.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17614]
 gb|KAO47769.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17615]
 gb|KAO49395.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17748]
 gb|KAO55459.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD19043]
 gb|KAO59272.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD20845]
 gb|KAO62534.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD19591]
 gb|KAO66246.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD19339]
 gb|KAO72863.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18472]
 gb|KAO78915.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD19051]
 gb|KAO79182.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD19323]
 gb|KAO81537.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18096]
 gb|KAO89926.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18112]
 gb|KAO91991.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17973]
 gb|KAO94937.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17903]
 gb|KAO97846.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15594]
 gb|KAP04589.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16728]
 gb|KAP08324.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18498]
 gb|KAP12654.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18116]
 gb|KAP16376.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18090]
 gb|KAP17474.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16261]
 gb|KAP17575.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18314]
 gb|KAP25999.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16732]
 gb|KAP32822.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17021]
 gb|KAP34892.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17503]
 gb|KAP40518.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17517]
 gb|KAP44765.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17647]
 gb|KAP46103.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17613]
 gb|KAP52889.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16775]
 gb|KAP56918.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17240]
 gb|KAP60289.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17656]
 gb|KAP62062.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17888]
 gb|KAP67314.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16577]
 gb|KAP73355.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16277]
 gb|KAP76394.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16553]
 gb|KAP79345.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15766]
 gb|KAP84114.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15974]
 gb|KAP88495.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16265]
 gb|KAP92171.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15226]
 gb|KAP96035.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16568]
 gb|KAQ00253.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16571]
 gb|KAQ06665.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15430]
 gb|KAQ09045.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17006]
 gb|KAQ11912.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17232]
 gb|KAQ14611.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15977]
 gb|KAQ23186.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15770]
 gb|KAQ29877.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15855]
 gb|KAQ31835.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15963]
 gb|KAQ33456.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16257]
 gb|KAQ40514.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14620]
 gb|KAQ43594.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14844]
 gb|KAQ47391.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14847]
 gb|KAQ50299.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15050]
 gb|KAQ57854.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14621]
 gb|KAQ58299.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14832]
 gb|KAQ61485.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD13874]
 gb|KAQ67765.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15973]
 gb|KAQ68703.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD13878]
 gb|KAQ74427.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14002]
 gb|KAQ77788.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14435]
 gb|KAQ83349.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14709]
 gb|KAQ87360.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15597]
 gb|KAQ91278.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14720]
 gb|KAQ95085.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15212]
 gb|KAQ98659.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14437]
 gb|KAR04278.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD16573]
 gb|KAR05039.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15584]
 gb|KAR10108.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15758]
 gb|KAR17877.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15765]
 gb|KAR19972.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0012]
 gb|KAR27681.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15762]
 gb|KAR30131.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0015]
 gb|KAR30951.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0021]
 gb|KAR36925.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0023]
 gb|KAR41483.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0028]
 gb|KAR46361.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0024]
 gb|KAR46535.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0035]
 gb|KAR53299.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0037]
 gb|KAR58555.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0039]
 gb|KAR58855.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0038]
 gb|KAR64678.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0040]
 gb|KAR69744.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0042]
 gb|KAR71707.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0044]
 gb|KAR80200.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0050]
 gb|KAR81797.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0058]
 gb|KAR82771.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0047]
 gb|KAR88086.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0059]
 gb|KAR91996.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0063]
 gb|KAR95587.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0062]
 gb|KAR99797.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0065]
 gb|KAS05214.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0072]
 gb|KAS09003.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0075]
 gb|KAS13209.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0064]
 gb|KAS16178.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0083]
 gb|KAS19270.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0089]
 gb|KAS27443.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0092]
 gb|KAS28783.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0090]
 gb|KAS30050.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0094]
 gb|KAS37760.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0099]
 gb|KAS40207.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0098]
 gb|KAS40782.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0096]
 gb|KAS48706.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0101]
 gb|KAS52100.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0100]
 gb|KAS54747.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0103]
 gb|KAS59858.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0106]
 gb|KAS65258.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0105]
 gb|KAS69331.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0109]
 gb|KAS75016.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0111]
 gb|KAS75328.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0108]
 gb|KAS80134.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0112]
 gb|KAS84970.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0114]
 gb|KAS87907.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0115]
 gb|KAS93033.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0118]
 gb|KAS98267.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0116]
 gb|KAT01731.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0149]
 gb|KAT05500.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0113]
 gb|KAT07573.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0150]
 gb|KAT10819.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0153]
 gb|KAT15386.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0154]
 gb|KAT19772.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0159]
 gb|KAT22792.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0156]
 gb|KAT28186.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0158]
 gb|KAT28449.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0051]
 gb|KAT36668.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0160]
 gb|KAT38504.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0059]
 gb|KAT39658.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0054]
 gb|KAT43286.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0060]
 gb|KAT50453.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0064]
 gb|KAT54971.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0061]
 gb|KAT58351.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0063]
 gb|KAT59113.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0066]
 gb|KAT69770.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0068]
 gb|KAT70487.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0067]
 gb|KAT73287.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0070]
 gb|KAT81148.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0069]
 gb|KAT82789.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0071]
 gb|KAT87201.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0078]
 gb|KAT90810.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0072]
 gb|KAT96533.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0075]
 gb|KAU01930.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0081]
 gb|KAU03718.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0079]
 gb|KAU06508.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0080]
 gb|KAU07810.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0082]
 gb|KAU15456.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0083]
 gb|KAU17861.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0001]
 gb|KAU23865.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0084]
 gb|KAU26553.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0086]
 gb|KAU31702.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0004]
 gb|KAU36341.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0010]
 gb|KAU38994.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0011]
 gb|KAU46266.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0016]
 gb|KAU46764.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0012]
 gb|KAU50207.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0017]
 gb|KAU56534.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0018]
 gb|KAU58568.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0026]
 gb|KAU64054.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0020]
 gb|KAU67215.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0025]
 gb|KAU72155.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0033]
 gb|KAU74604.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0031]
 gb|KAU78114.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0035]
 gb|KAU84920.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0036]
 gb|KAU87365.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0037]
 gb|KAU92290.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0040]
 gb|KAU94719.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0046]
 gb|KAU97300.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0044]
 gb|KAV03853.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0048]
 gb|KAV04259.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0056]
 gb|KAV09733.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0052]
 gb|KAV11414.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_2005]
 gb|KAV16956.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_2008]
 gb|KAV21937.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0058]
 gb|KAV24634.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_2015]
 gb|KAV31250.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0010]
 gb|KAV35572.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0012]
 gb|KAV40243.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0014]
 gb|KAV43155.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0016]
 gb|KAV48249.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0017]
 gb|KAV48977.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0018]
 gb|KAV56182.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0019]
 gb|KAV59466.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0021]
 gb|KAV63907.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0023]
 gb|KAV66844.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0025]
 gb|KAV71717.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0031]
 gb|KAV72552.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0036]
 gb|KAV75832.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0042]
 gb|KAV76753.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0041]
 gb|KAV81050.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0043]
 gb|KAV92708.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0044]
 gb|KAV95219.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0046]
 gb|KAV97673.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0048]
 gb|KAV99324.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0047]
 gb|KAW08261.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0050]
 gb|KAW12110.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0052]
 gb|KAW16402.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0054]
 gb|KAW17268.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0055]
 gb|KAW24092.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0058]
 gb|KAW27039.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0074]
 gb|KAW31492.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0085]
 gb|KAW37769.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0089]
 gb|KAW39280.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0094]
 gb|KAW39589.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0090]
 gb|KAW46145.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0099]
 gb|KAW52226.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0096]
 gb|KAW53679.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0105]
 gb|KAW59064.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0098]
 gb|KAW60111.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0106]
 gb|KAW66035.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0109]
 gb|KAW66908.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0103]
 gb|KAW76381.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0107]
 gb|KAW76475.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0113]
 gb|KAW78428.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0117]
 gb|KAW86036.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0114]
 gb|KAW87716.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0122]
 gb|KAW92422.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0123]
 gb|KAX01739.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0120]
 gb|KAX02954.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M984]
 gb|KAX09806.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M987]
 gb|KAX12356.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M990]
 gb|KAX17281.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1004]
 gb|KAX18689.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M991]
 gb|KAX19668.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M992]
 gb|KAX20715.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M995]
 gb|KAX27905.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1007]
 gb|KAX29410.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1008]
 gb|KAX37080.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1009]
 gb|KAX41517.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1012]
 gb|KAX44892.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1010]
 gb|KAX46318.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1011]
 gb|KAX52723.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1021]
 gb|KAX54898.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1011]
 gb|KAX61011.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1023]
 gb|KAX64186.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1017]
 gb|KAX65983.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1022]
 gb|KAX66828.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1024]
 gb|KAX73145.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1025]
 gb|KAX74941.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1026]
 gb|KAX81396.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1210]
 gb|KAX85008.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1034]
 gb|KAX90217.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1215]
 gb|KAX93509.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1213]
 gb|KAX95802.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1212]
 gb|KAX98215.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1232]
 gb|KAY06250.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1221]
 gb|KAY10554.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1233]
 gb|KAY14230.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1253]
 gb|KAY19445.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1271]
 gb|KAY22290.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1236]
 gb|KAY22769.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1270]
 gb|KAY31762.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1283]
 gb|KAY32762.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1273]
 gb|KAY38313.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1287]
 gb|KAY40417.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1272]
 gb|KAY42587.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1274]
 gb|KAY48735.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1288]
 gb|KAY55665.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1295]
 gb|KAY59003.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1292]
 gb|KAY64445.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1294]
 gb|KAY66845.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1300]
 gb|KAY69838.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1310]
 gb|KAY70345.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1304]
 gb|KAY77762.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1309]
 gb|KAY82077.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1315]
 gb|KAY88613.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1319]
 gb|KAY90599.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1317]
 gb|KAY92778.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1340]
 gb|KAY95597.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1324]
 gb|KAZ02848.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1325]
 gb|KAZ06624.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1373]
 gb|KAZ10383.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1374]
 gb|KAZ11395.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1381]
 gb|KAZ13164.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1389]
 gb|KAZ19914.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1392]
 gb|KAZ26640.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1384]
 gb|KAZ27136.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1393]
 gb|KAZ30573.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1402]
 gb|KAZ39333.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1400]
 gb|KAZ44441.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1397]
 gb|KAZ46445.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1404]
 gb|KAZ49690.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1410]
 gb|KAZ56065.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1416]
 gb|KAZ59274.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1415]
 gb|KAZ59824.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1417]
 gb|KAZ69565.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1422]
 gb|KAZ70076.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1418]
 gb|KAZ72365.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1424]
 gb|KAZ78579.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1431]
 gb|KAZ81495.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1425]
 gb|KAZ83702.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1429]
 gb|KAZ86425.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1438]
 gb|KAZ93013.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1439]
 gb|KAZ99959.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1441]
 gb|KBA02500.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1444]
 gb|KBA03962.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1448]
 gb|KBA07781.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1700]
 gb|KBA13766.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1449]
 gb|KBA14225.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1452]
 gb|KBA24281.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1456]
 gb|KBA26608.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1459]
 gb|KBA30051.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1458]
 gb|KBA35776.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1475]
 gb|KBA37892.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1461]
 gb|KBA39889.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1481]
 gb|KBA49903.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1488]
 gb|KBA50922.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1533]
 gb|KBA52333.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1520]
 gb|KBA56540.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1545]
 gb|KBA62015.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1559]
 gb|KBA62477.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1560]
 gb|KBA68252.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1570]
 gb|KBA73304.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1615]
 gb|KBA77511.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1638]
 gb|KBA78560.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1703]
 gb|KBA80726.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1702]
 gb|KBA85145.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1703]
 gb|KBA89861.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1704]
 gb|KBA91781.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1726]
 gb|KBA97325.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1762]
 gb|KBA97895.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1728]
 gb|KBB00806.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1734]
 gb|KBB08184.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1780]
 gb|KBB12828.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1787]
 gb|KBB16224.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1782]
 gb|KBB17115.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1816]
 gb|KBB24341.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1822]
 gb|KBB28787.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1848]
 gb|KBB35953.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1895]
 gb|KBB36578.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1893]
 gb|KBB39988.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1906]
 gb|KBB45669.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1913]
 gb|KBB49149.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1914]
 gb|KBB52568.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1928]
 gb|KBB56148.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1929]
 gb|KBB60658.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1932]
 gb|KBB64778.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1948]
 gb|KBB68145.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1955]
 gb|KBB72440.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1956]
 gb|KBB75656.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1959]
 gb|KBB81260.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1961]
 gb|KBB84283.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1967]
 gb|KBB85906.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1976]
 gb|KBB88435.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1973]
 gb|KBB96311.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1978]
 gb|KBC00552.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1979]
 gb|KBC03759.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2003]
 gb|KBC10656.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2006]
 gb|KBC12379.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2007]
 gb|KBC13150.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2010]
 gb|KBC21133.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2020]
 gb|KBC23822.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2021]
 gb|KBC28505.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2032]
 gb|KBC33677.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2085]
 gb|KBC36030.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2086]
 gb|KBC39759.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2113]
 gb|KBC45635.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2116]
 gb|KBC48564.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2128]
 gb|KBC51725.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2129]
 gb|KBC60066.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2130]
 gb|KBC60880.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2131]
 gb|KBC63911.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2132]
 gb|KBC70016.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2134]
 gb|KBC71642.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2136]
 gb|KBC76562.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2137]
 gb|KBC81686.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2139]
 gb|KBC84606.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2138]
 gb|KBC88867.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2140]
 gb|KBC93811.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2248]
 gb|KBC95685.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2218]
 gb|KBD00240.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2211]
 gb|KBD05390.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2206]
 gb|KBD08165.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2204]
 gb|KBD12449.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2203]
 gb|KBD17528.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2199]
 gb|KBD19039.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2198]
 gb|KBD23844.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2192]
 gb|KBD27928.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2191]
 gb|KBD32325.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2141]
 gb|KBD36875.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2343]
 gb|KBD37323.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2324]
 gb|KBD40135.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2342]
 gb|KBD48659.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2323]
 gb|KBD52020.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2278]
 gb|KBD56310.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2277]
 gb|KBD61618.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2276]
 gb|KBD63860.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2259]
 gb|KBD67723.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2249]
 gb|KBD73143.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2142]
 gb|KBD75524.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2459]
 gb|KBD80136.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2442]
 gb|KBD84167.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2440]
 gb|KBD87240.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2435]
 gb|KBD93046.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2416]
 gb|KBD97151.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2402]
 gb|KBE00131.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2376]
 gb|KBE04244.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2361]
 gb|KBE09069.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2360]
 gb|KBE11384.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2145]
 gb|KBE12888.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2479]
 gb|KBE15629.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2144]
 gb|KBE23669.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2384]
 gb|KBE28125.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2508]
 gb|KBE33013.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H1329]
 gb|KBE35464.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H1578]
 gb|KBE39500.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H1580]
 gb|KBE44539.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H1589]
 gb|KBE46173.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2101]
 gb|KBE47447.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H1856]
 gb|KBE59095.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2300]
 gb|KBE63174.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2438]
 gb|KBE68060.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H3005]
 gb|KBE68893.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2760]
 gb|KBE69833.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H3004]
 gb|KBE74440.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H3005]
 gb|KBE80748.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H3361]
 gb|KBE81065.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H3033]
 gb|KBE85505.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H3360]
 gb|KBE85961.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2463]
 gb|KBE89679.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2754]
 gb|KBE91876.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2463]
 gb|KBE97916.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H3094]
 gb|KBF04293.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H3986]
 gb|KBF06436.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H1249]
 gb|KBF11276.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H1996]
 gb|KBF16761.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2581]
 gb|KBF19988.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2264]
 gb|KBF22897.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2398]
 gb|KBF28631.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H3367]
 gb|KBF31742.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2346]
 gb|KBF35195.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2828]
 gb|KBF39463.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2350]
 gb|KBF40610.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis T92]
 gb|KBF49776.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum K85]
 gb|KBF53072.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M13]
 gb|KBF54945.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis T85]
 gb|KBF55654.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis EAS054]
 gb|KBF60074.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis CPHL_A]
 gb|KBF67710.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis T17]
 gb|KBF70489.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 94_M4241A]
 gb|KBF77215.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis T46]
 gb|KBF79763.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis]
 gb|KBF88196.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis]
 gb|KBF88758.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis GM 
1503]
 gb|KBF89234.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum]
 gb|KBF97184.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum]
 gb|KBF98937.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis]
 gb|KBG01368.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis]
 gb|KBG05799.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis]
 gb|KBG09432.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis]
 gb|KBG10187.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010070]
 gb|KBG16340.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010074]
 gb|KBG18282.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010071]
 gb|KBG26775.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010078]
 gb|KBG32023.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010081]
 gb|KBG32764.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010079]
 gb|KBG36979.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010080]
 gb|KBG45510.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010086]
 gb|KBG46280.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010087]
 gb|KBG53954.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010099]
 gb|KBG55813.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010088]
 gb|KBG57786.1| 50S ribosomal protein L6 RplF [Mycobacterium bovis MAL010093]
 gb|KBG59630.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010100]
 gb|KBG64112.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010103]
 gb|KBG66079.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010102]
 gb|KBG74284.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010106]
 gb|KBG78616.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010105]
 gb|KBG80810.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010108]
 gb|KBG83656.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010110]
 gb|KBG87533.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010111]
 gb|KBG94096.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010109]
 gb|KBH00449.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010112]
 gb|KBH04197.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010120]
 gb|KBH06585.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010118]
 gb|KBH07280.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010121]
 gb|KBH11734.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010123]
 gb|KBH18213.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010128]
 gb|KBH19450.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010130]
 gb|KBH21314.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010129]
 gb|KBH23200.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010133]
 gb|KBH24691.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010131]
 gb|KBH36334.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010136]
 gb|KBH39683.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL010137]
 gb|KBH43806.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010134]
 gb|KBH44527.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL020107]
 gb|KBH48808.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020110]
 gb|KBH55305.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020120]
 gb|KBH57998.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020130]
 gb|KBH61051.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020131]
 gb|KBH66064.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL020135]
 gb|KBH69451.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020132]
 gb|KBH72176.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL020136]
 gb|KBH76111.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020138]
 gb|KBH80671.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020141]
 gb|KBH84556.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020145]
 gb|KBH88271.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020142]
 gb|KBH93522.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020146]
 gb|KBH95139.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020144]
 gb|KBI02899.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020150]
 gb|KBI05788.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020147]
 gb|KBI12261.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020152]
 gb|KBI14330.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020156]
 gb|KBI16321.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020157]
 gb|KBI22543.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020162]
 gb|KBI24251.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020160]
 gb|KBI27615.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020172]
 gb|KBI35323.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL020173]
 gb|KBI37541.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL020176]
 gb|KBI43500.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020174]
 gb|KBI45400.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020167]
 gb|KBI52684.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020179]
 gb|KBI57226.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020181]
 gb|KBI60542.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020182]
 gb|KBI63861.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL020185]
 gb|KBI68236.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020186]
 gb|KBI73008.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020187]
 gb|KBI77183.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020192]
 gb|KBI78665.1| 50S ribosomal protein L6 RplF [Mycobacterium africanum MAL020193]
 gb|KBI82193.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020195]
 gb|KBI87024.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020194]
 gb|KBI90332.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020197]
 gb|KBI93807.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020196]
 gb|KBI98741.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020199]
 gb|KBJ01078.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020200]
 gb|KBJ08433.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020202]
 gb|KBJ09479.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020201]
 gb|KBJ17247.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020206]
 gb|KBJ19821.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020209]
 gb|KBJ23468.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020208]
 gb|KBJ25866.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020211]
 gb|KBJ31730.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis str. 
Haarlem]
 gb|KBJ37641.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis F11]
 gb|KBJ39346.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H37Rv]
 gb|KBJ42657.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-1]
 gb|KBJ46215.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-6]
 gb|KBJ48526.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis T67]
 gb|KBJ52424.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-8]
 gb|KBJ57974.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-17]
 gb|KBJ60678.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-9]
 gb|KBJ65745.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-20]
 gb|KBJ71575.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-18]
 gb|KBJ75294.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-19]
 gb|KBJ81385.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-22]
 gb|KBJ82721.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-21]
 gb|KBJ88046.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-25]
 gb|KBJ89221.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-23]
 gb|KBJ95119.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-26]
 gb|KBJ96067.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-27]
 gb|KBJ99563.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-30]
 gb|KBK02892.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-29]
 gb|KBK10088.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-31]
 gb|KBK16571.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-32]
 gb|KBK18201.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-33]
 gb|KBK18805.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis str. 
Erdman = ATCC 35801]
 gb|KBK25484.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0030]
 gb|KBK30337.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0036]
 gb|KBK35475.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0037]
 gb|KBK36930.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0038]
 gb|KBK38284.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0034]
 gb|KBK45032.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0040]
 gb|KBK48692.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0041]
 gb|KBK51268.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0045]
 gb|KBK56370.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0044]
 gb|KBK64366.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0050]
 gb|KBK65339.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0051]
 gb|KBK69895.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0048]
 gb|KBK72373.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0052]
 gb|KBK76827.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0053]
 gb|KBK80756.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0055]
 gb|KBK80960.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0056]
 gb|KBK83470.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0057]
 gb|KBK89159.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0058]
 gb|KBK94260.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0059]
 gb|KBL00752.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0060]
 gb|KBL06149.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0069]
 gb|KBL07188.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0070]
 gb|KBL12500.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0071]
 gb|KBL14879.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0067]
 gb|KBL22856.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0077]
 gb|KBL24704.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0079]
 gb|KBL33185.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0082]
 gb|KBL34458.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0083]
 gb|KBL35073.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0080]
 gb|KBL38504.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0084]
 gb|KBL45968.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0085]
 gb|KBL46300.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0087]
 gb|KBL48554.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0088]
 gb|KBL55419.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0089]
 gb|KBL61011.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0090]
 gb|KBL62589.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0091]
 gb|KBL66633.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0093]
 gb|KBL70279.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0092]
 gb|KBL75832.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0094]
 gb|KBL83806.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0100]
 gb|KBL84941.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0097]
 gb|KBL89522.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0096]
 gb|KBL93563.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0105]
 gb|KBL96668.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0104]
 gb|KBM02361.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0110]
 gb|KBM06890.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0112]
 gb|KBM07929.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0113]
 gb|KBM10548.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0106]
 gb|KBM15429.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0123]
 gb|KBM22529.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0116]
 gb|KBM24206.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0115]
 gb|KBM27183.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0124]
 gb|KBM29669.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0017]
 gb|KBM39894.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0004]
 gb|KBM41098.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0010]
 gb|KBM45357.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0012]
 gb|KBM47217.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0025]
 gb|KBM51254.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0020]
 gb|KBM58949.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0029]
 gb|KBM62134.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0031]
 gb|KBM65146.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0033]
 gb|KBM66178.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0032]
 gb|KBM74387.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0042]
 gb|KBM76851.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0034]
 gb|KBM80463.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0060]
 gb|KBM87755.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0069]
 gb|KBM90805.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0086]
 gb|KBM92300.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0082]
 gb|KBM93838.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XDR 
KZN 605]
 gb|KBN02017.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KZN 
4207]
 gb|KBN03504.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KZN 
1435]
 gb|KBN05851.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0087]
 gb|KBN11935.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis cdc1551]
 gb|KBN19381.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 38765]
 gb|KBN24529.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 51628]
 gb|KBN26293.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 44503]
 gb|KBN26596.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 49375]
 gb|KBN39515.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA01]
 gb|KBN43683.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 38088]
 gb|KBN49962.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA03]
 gb|KBN51632.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA02]
 gb|KBN54360.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA04]
 gb|KBN55897.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA05]
 gb|KBN57758.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA06]
 gb|KBN68213.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA07]
 gb|KBN72993.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA08]
 gb|KBN76022.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA09]
 gb|KBN78029.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA10]
 gb|KBN83974.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA13]
 gb|KBN86437.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA11]
 gb|KBN90041.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA12]
 gb|KBN98502.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA14]
 gb|KBO01764.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA15]
 gb|KBO02704.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA16]
 gb|KBO04833.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA18]
 gb|KBO10418.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA17]
 gb|KBO14550.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA19]
 gb|KBO23669.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA21]
 gb|KBO24319.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA20]
 gb|KBO25970.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA22]
 gb|KBO29787.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA23]
 gb|KBO32223.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA25]
 gb|KBO33650.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA24]
 gb|KBO38225.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA26]
 gb|KBO47157.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA27]
 gb|KBO50409.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA30]
 gb|KBO51083.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA29]
 gb|KBO56422.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA31]
 gb|KBO62439.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA28]
 gb|KBO66694.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA34]
 gb|KBO66996.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA32]
 gb|KBO73203.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA33]
 gb|KBO78200.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA37]
 gb|KBO82411.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA35]
 gb|KBO84335.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA36]
 gb|KBO94071.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA38]
 gb|KBO94673.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA39]
 gb|KBO95610.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA40]
 gb|KBO97421.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA41]
 gb|KBP05700.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA42]
 gb|KBP06122.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA43]
 gb|KBP15652.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA45]
 gb|KBP17076.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA44]
 gb|KBP20099.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA48]
 gb|KBP25141.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA49]
 gb|KBP30152.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA46]
 gb|KBP36081.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA50]
 gb|KBP41541.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA53]
 gb|KBP42278.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA51]
 gb|KBP48174.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA55]
 gb|KBP53535.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA57]
 gb|KBP52340.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA56]
 gb|KBP58392.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA59]
 gb|KBP58971.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA60]
 gb|KBP60145.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA58]
 gb|KBP71597.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA63]
 gb|KBP72773.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA61]
 gb|KBP79104.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA64]
 gb|KBP81278.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA62]
 gb|KBP84369.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA68]
 gb|KBP86578.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA66]
 gb|KBP89722.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA68]
 gb|KBP93963.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA67]
 gb|KBP98277.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA69]
 gb|KBQ04079.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA70]
 gb|KBQ06766.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA72]
 gb|KBQ09008.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA71]
 gb|KBQ11392.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA73]
 gb|KBQ19346.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA75]
 gb|KBQ20730.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA74]
 gb|KBQ24891.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-180]
 gb|KBQ28031.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA76]
 gb|KBQ30756.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-182]
 gb|KBQ35026.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-184]
 gb|KBQ39248.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-183]
 gb|KBQ46343.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-187]
 gb|KBQ48462.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-188]
 gb|KBQ49643.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-186]
 gb|KBQ60637.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-190]
 gb|KBQ65204.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-191]
 gb|KBQ65884.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-192]
 gb|KBQ74287.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-194]
 gb|KBQ74936.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-193]
 gb|KBQ77517.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-195]
 gb|KBQ83323.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-197]
 gb|KBQ88460.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-196]
 gb|KBQ90751.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-198]
 gb|KBQ91248.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-200]
 gb|KBQ94401.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-203]
 gb|KBQ97079.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-199]
 gb|KBR09737.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-205]
 gb|KBR11341.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-206]
 gb|KBR12357.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-204]
 gb|KBR20517.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-208]
 gb|KBR21432.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-209]
 gb|KBR29744.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-210]
 gb|KBR30876.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-211]
 gb|KBR38182.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-212]
 gb|KBR40948.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-213]
 gb|KBR42313.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-214]
 gb|KBR43721.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-216]
 gb|KBR48594.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-217]
 gb|KBR50973.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-218]
 gb|KBR54913.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-219]
 gb|KBR66652.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-225]
 gb|KBR71324.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-227]
 gb|KBR72434.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-229]
 gb|KBR76347.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-228]
 gb|KBR83268.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-231]
 gb|KBR84173.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-230]
 gb|KBR87222.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-232]
 gb|KBR95368.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-233]
 gb|KBS01485.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-235]
 gb|KBS04760.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-237]
 gb|KBS05989.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-234]
 gb|KBS10616.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-239]
 gb|KBS12972.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-238]
 gb|KBS13690.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-240]
 gb|KBS26228.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-241]
 gb|KBS28770.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-242]
 gb|KBS34875.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-245]
 gb|KBS35379.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-244]
 gb|KBS38975.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-246]
 gb|KBS42602.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-247]
 gb|KBS47989.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-250]
 gb|KBS50631.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-249]
 gb|KBS57893.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-251]
 gb|KBS59466.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-252]
 gb|KBS62174.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-253]
 gb|KBS70674.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-255]
 gb|KBS73183.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-256]
 gb|KBS76345.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-262]
 gb|KBS80070.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-265]
 gb|KBS84569.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-278]
 gb|KBS87165.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-290]
 gb|KBS90881.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-299]
 gb|KBS98812.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0006]
 gb|KBS99899.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0117]
 gb|KBT02714.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0014]
 gb|KBT09534.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0032]
 gb|KBT12318.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0028]
 gb|KBT16014.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0054]
 gb|KBT20808.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0073]
 gb|KBT21646.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0074]
 gb|KBT28118.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0098]
 gb|KBT32549.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0101]
 gb|KBT36915.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0103]
 gb|KBT43798.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0125]
 gb|KBT47560.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2233BH]
 gb|KBT51641.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0129]
 gb|KBT56247.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0126]
 gb|KBT59901.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0130]
 gb|KBT62389.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 3280CJ]
 gb|KBT62959.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0132]
 gb|KBT71380.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0131]
 gb|KBT73662.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0137]
 gb|KBT81920.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0134]
 gb|KBT82720.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0136]
 gb|KBT91175.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0139]
 gb|KBT92057.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0145]
 gb|KBT94694.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0140]
 gb|KBU02229.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0148]
 gb|KBU05354.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0149]
 gb|KBU07029.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0150]
 gb|KBU14137.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0153]
 gb|KBU17136.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0158]
 gb|KBU19648.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0104]
 gb|KBU20577.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0155]
 gb|KBU27102.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0159]
 gb|KBU30192.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD47]
 gb|KBU35403.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD45]
 gb|KBU42314.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD49]
 gb|KBU44664.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD50]
 gb|KBU47400.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD44]
 gb|KBU49772.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD51]
 gb|KBU51620.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD53]
 gb|KBU61208.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD55]
 gb|KBU62267.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD54]
 gb|KBU68122.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD57]
 gb|KBU68936.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD56]
 gb|KBU73932.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD59]
 gb|KBU79476.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD60]
 gb|KBU84053.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD10]
 gb|KBU88569.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD09]
 gb|KBU89865.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD11]
 gb|KBU98496.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD13]
 gb|KBU98964.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD14]
 gb|KBV04528.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD12]
 gb|KBV06979.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD15]
 gb|KBV08942.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD16]
 gb|KBV14942.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD17]
 gb|KBV20045.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD19]
 gb|KBV21715.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD20]
 gb|KBV31001.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD21]
 gb|KBV33060.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD31]
 gb|KBV33478.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD33]
 gb|KBV38239.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD34]
 gb|KBV43439.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD38]
 gb|KBV49917.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0017]
 gb|KBV50353.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD37]
 gb|KBV54807.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0008]
 gb|KBV60261.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0021]
 gb|KBV63926.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0032]
 gb|KBV68603.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0026]
 gb|KBV71235.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0023]
 gb|KBV76549.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0069]
 gb|KBV78973.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0004]
 gb|KBV83151.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0080]
 gb|KBV87806.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0072]
 gb|KBV89112.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0007]
 gb|KBV95090.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0005]
 gb|KBV96295.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0009]
 gb|KBV99257.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0008]
 gb|KBW10135.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0023]
 gb|KBW11931.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0010]
 gb|KBW12613.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0011]
 gb|KBW14718.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0024]
 gb|KBW17791.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0026]
 gb|KBW22643.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0028]
 gb|KBW27098.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0029]
 gb|KBW30395.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0030]
 gb|KBW31392.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0031]
 gb|KBW41818.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0040]
 gb|KBW44843.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0035]
 gb|KBW46854.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0037]
 gb|KBW49970.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0041]
 gb|KBW56014.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0042]
 gb|KBW63064.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0044]
 gb|KBW66836.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0043]
 gb|KBW69894.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0048]
 gb|KBW71105.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0049]
 gb|KBW73044.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0047]
 gb|KBW81898.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0051]
 gb|KBW84979.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0050]
 gb|KBW89188.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0053]
 gb|KBW98247.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0056]
 gb|KBX00745.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0055]
 gb|KBX02641.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0057]
 gb|KBX03281.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0058]
 gb|KBX06224.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0060]
 gb|KBX07035.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0059]
 gb|KBX19822.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0065]
 gb|KBX25229.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0066]
 gb|KBX26929.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0074]
 gb|KBX32747.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0079]
 gb|KBX34230.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0075]
 gb|KBX38802.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0076]
 gb|KBX39531.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0080]
 gb|KBX42221.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-2]
 gb|KBX46568.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-3]
 gb|KBX55951.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-4]
 gb|KBX58523.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-5]
 gb|KBX64308.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-11]
 gb|KBX66200.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-10]
 gb|KBX67673.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-7]
 gb|KBX71332.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-12]
 gb|KBX74986.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-13]
 gb|KBX78503.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-14]
 gb|KBX84546.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-15]
 gb|KBX88785.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis OFXR-16]
 gb|KBX92999.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0001]
 gb|KBX98536.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0004]
 gb|KBY05174.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0002]
 gb|KBY06944.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0003]
 gb|KBY13901.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0006]
 gb|KBY16004.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0005]
 gb|KBY21793.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0009]
 gb|KBY23171.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0007]
 gb|KBY26809.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0011]
 gb|KBY30143.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0012]
 gb|KBY32076.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0010]
 gb|KBY37713.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0013]
 gb|KBY44483.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0014]
 gb|KBY47113.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0015]
 gb|KBY49147.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0016]
 gb|KBY57883.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0018]
 gb|KBY58383.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0019]
 gb|KBY62937.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0022]
 gb|KBY69119.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0025]
 gb|KBY72143.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0024]
 gb|KBY77330.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0028]
 gb|KBY80130.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0027]
 gb|KBY84461.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0029]
 gb|KBY90507.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0030]
 gb|KBY91370.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0031]
 gb|KBY93813.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0033]
 gb|KBZ00339.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0035]
 gb|KBZ02718.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0034]
 gb|KBZ09526.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0037]
 gb|KBZ10738.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0039]
 gb|KBZ11642.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0038]
 gb|KBZ17666.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0041]
 gb|KBZ20238.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0040]
 gb|KBZ24966.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0043]
 gb|KBZ30529.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0042]
 gb|KBZ32177.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0044]
 gb|KBZ39190.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0045]
 gb|KBZ45091.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0046]
 gb|KBZ47155.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0048]
 gb|KBZ55009.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0047]
 gb|KBZ57984.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0050]
 gb|KBZ58736.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0049]
 gb|KBZ65305.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0052]
 gb|KBZ72875.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0053]
 gb|KBZ77846.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0054]
 gb|KBZ83435.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0055]
 gb|KBZ87307.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0056]
 gb|KBZ88917.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0058]
 gb|KBZ90193.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0057]
 gb|KBZ92036.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0060]
 gb|KBZ98163.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0061]
 gb|KCA00398.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0062]
 gb|KCA02224.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0063]
 gb|KCA12671.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0065]
 gb|KCA16481.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0066]
 gb|KCA18304.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0064]
 gb|KCA23880.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0067]
 gb|KCA25769.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0068]
 gb|KCA30997.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0070]
 gb|KCA32804.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0071]
 gb|KCA41575.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0073]
 gb|KCA42426.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0074]
 gb|KCA46731.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0076]
 gb|KCA51058.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0077]
 gb|KCA53794.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0075]
 gb|KCA58591.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0079]
 gb|KCA63362.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0078]
 gb|KCA68009.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0082]
 gb|KCA72497.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0081]
 gb|KCA73057.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0083]
 gb|KCA83454.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0084]
 gb|KCA85764.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0086]
 gb|KCA86674.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0085]
 gb|KCA94307.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0087]
 gb|KCA95858.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0089]
 gb|KCB00127.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0088]
 gb|KCB07847.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0090]
 gb|KCB09218.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0091]
 gb|KCB13523.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0093]
 gb|KCB15795.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0092]
 gb|KCB19301.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0094]
 gb|KCB56818.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA77]
 gb|KCB63707.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-565]
 gb|KCB64605.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-377]
 gb|KCB71007.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-092]
 gb|KCB72919.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-253]
 gb|KCB77996.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-308]
 gb|KCB80628.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-258]
 gb|KCB87774.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0001]
 gb|KCB88469.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0002]
 gb|KCB96204.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0006]
 gb|KCB96768.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0003]
 gb|KCB99926.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0012]
 gb|KCC00425.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0013]
 gb|KCC04483.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0014]
 gb|KCC10315.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0015]
 gb|KCC10811.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0016]
 gb|KCC17834.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0017]
 gb|KCC25418.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0018]
 gb|KCC27211.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0020]
 gb|KCC31655.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0019]
 gb|KCC35978.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0021]
 gb|KCC38944.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0022]
 gb|KCC45622.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0025]
 gb|KCC47943.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0033]
 gb|KCC52001.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0027]
 gb|KCC53724.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0034]
 gb|KCC60106.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0036]
 gb|KCC60796.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0038]
 gb|KCC64061.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0039]
 gb|KCC70652.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0045]
 gb|KCC79021.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0052]
 gb|KCC79899.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0046]
 gb|KCC83653.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0061]
 gb|KCC89937.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0062]
 gb|KCC93183.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0068]
 gb|KCC93946.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0063]
 gb|KCD00029.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0069]
 gb|KCD02818.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0071]
 gb|KCD09490.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0070]
 gb|KCD14385.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0073]
 gb|KCD16843.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0077]
 gb|KCD20913.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0018]
 gb|KCD22359.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_02_0067]
 gb|KCD28289.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0020]
 gb|KCD31724.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0022]
 gb|KCD34655.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0025]
 gb|KCD40670.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0026]
 gb|KCD47549.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0027]
 gb|KCD49275.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0030]
 gb|KCD49449.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0029]
 gb|KCD58266.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0031]
 gb|KCD61383.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0033]
 gb|KCD65866.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0034]
 gb|KCD72608.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0043]
 gb|KCD72885.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0036]
 gb|KCD80008.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0045]
 gb|KCD81167.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0078]
 gb|KCD84626.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0081]
 gb|KCD90209.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0082]
 gb|KCD93486.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0001]
 gb|KCD97672.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0002]
 gb|KCE01948.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0006]
 gb|KCE02839.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0003]
 gb|KCE08909.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0014]
 gb|KCE13192.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0015]
 gb|KCE18303.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0017]
 gb|KCE22708.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0018]
 gb|KCE25223.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0019]
 gb|KCE31486.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0022]
 gb|KCE32590.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0021]
 gb|KCE39790.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0024]
 gb|KCE40280.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0023]
 gb|KCE43297.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0043]
 gb|KCE48681.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0048]
 gb|KCE52620.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0047]
 gb|KCE59014.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0007]
 gb|KCE61139.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0005]
 gb|KCE61924.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0008]
 gb|KCE62770.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0013]
 gb|KCE72584.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0034]
 gb|KCE76744.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0020]
 gb|KCE80474.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0038]
 gb|KCE82743.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0036]
 gb|KCE86797.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0039]
 gb|KCE93229.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0040]
 gb|KCE98023.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0044]
 gb|KCF01553.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0045]
 gb|KCF05487.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0046]
 gb|KCF10324.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0042]
 gb|KCF13543.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0037]
 gb|KCF19750.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0030]
 gb|KCF21526.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0029]
 gb|KCF27471.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0031]
 gb|KCF28964.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0033]
 gb|KCF34168.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0002]
 gb|KCF35777.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0001]
 gb|KCF38037.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0003]
 gb|KCF40248.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0006]
 gb|KCF48716.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0008]
 gb|KCF49061.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0007]
 gb|KCF58773.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0011]
 gb|KCF61704.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0014]
 gb|KCF66934.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0016]
 gb|KCF67746.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0015]
 gb|KCF70246.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0017]
 gb|KCF78732.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0019]
 gb|KCF80284.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0024]
 gb|KCF81860.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0022]
 gb|KCF86611.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0026]
 gb|KCF93346.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0027]
 gb|KCF97644.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0028]
 gb|KCG00740.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0035]
 gb|KCG05925.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0041]
 gb|KCG08395.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0039]
 gb|KCG11391.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0043]
 gb|KCG16297.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0047]
 gb|KCG18162.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0048]
 gb|KCG19405.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0051]
 gb|KCG26134.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0053]
 gb|KCG32816.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0057]
 gb|KCG34369.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0056]
 gb|KCG38749.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0058]
 gb|KCG46155.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0063]
 gb|KCG47338.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0064]
 gb|KCG52594.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0070]
 gb|KCG54817.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0071]
 gb|KCG60203.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0072]
 gb|KCG62683.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0077]
 gb|KCG65547.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0075]
 gb|KCG74663.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0078]
 gb|KCG77190.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0080]
 gb|KCG78951.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0083]
 gb|KCG83523.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0084]
 gb|KCG86580.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0085]
 gb|KCG91141.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0089]
 gb|KCG95786.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0091]
 gb|KCH00404.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0092]
 gb|KCH03993.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0096]
 gb|KCH06460.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0094]
 gb|KCH13526.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0099]
 gb|KCH15053.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0098]
 gb|KCH19395.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0102]
 gb|KCH23978.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0100]
 gb|KCH27885.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0104]
 gb|KCH31894.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0106]
 gb|KCH37615.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0109]
 gb|KCH40314.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0108]
 gb|KCH43369.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0110]
 gb|KCH49255.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis SK-E]
 gb|KCH50830.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis SK-C]
 gb|KCH53185.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UG-C]
 gb|KCH60188.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UG-D]
 gb|KCH64771.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0001]
 gb|KCH71424.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0003]
 gb|KCH72534.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0002]
 gb|KCH79287.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0004]
 gb|KCH80071.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0009]
 gb|KCH84627.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0015]
 gb|KCH89564.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0016]
 gb|KCH91646.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0022]
 gb|KCH93332.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0020]
 gb|KCI01963.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0024]
 gb|KCI02242.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA78]
 gb|KCI09794.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA79]
 gb|KCI12420.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA80]
 gb|KCI15306.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA81]
 gb|KCI18109.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA82]
 gb|KCI19318.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA83]
 gb|KCI26026.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA84]
 gb|KCI32335.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA85]
 gb|KCI38924.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA86]
 gb|KCI40231.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA87]
 gb|KCI45420.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA89]
 gb|KCI46244.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA88]
 gb|KCI53964.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA90]
 gb|KCI54060.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA91]
 gb|KCI60866.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA93]
 gb|KCI62559.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA92]
 gb|KCI69110.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA94]
 gb|KCI69459.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA95]
 gb|KCI74131.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA96]
 gb|KCI79731.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA97]
 gb|KCI86214.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA98]
 gb|KCI88449.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA99]
 gb|KCI91371.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA100]
 gb|KCI98207.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA101]
 gb|KCI98418.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA102]
 gb|KCJ01769.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA104]
 gb|KCJ08146.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA103]
 gb|KCJ14509.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA106]
 gb|KCJ16722.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA105]
 gb|KCJ20511.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA107]
 gb|KCJ21810.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA108]
 gb|KCJ26888.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA109]
 gb|KCJ33192.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA110]
 gb|KCJ37305.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA111]
 gb|KCJ40271.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA113]
 gb|KCJ41244.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA114]
 gb|KCJ46838.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA117]
 gb|KCJ50416.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA118]
 gb|KCJ55487.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA119]
 gb|KCJ59967.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA120]
 gb|KCJ64819.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA122]
 gb|KCJ68966.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA121]
 gb|KCJ69979.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA123]
 gb|KCJ79837.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA124]
 gb|KCJ80820.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA125]
 gb|KCJ83096.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA127]
 gb|KCJ83693.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA126]
 gb|KCJ88411.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA128]
 gb|KCJ92430.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA129]
 gb|KCJ99935.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA130]
 gb|KCK03523.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA132]
 gb|KCK08181.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA131]
 gb|KCK10103.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA133]
 gb|KCK15055.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA134]
 gb|KCK15205.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA135]
 gb|KCK20172.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA136]
 gb|KCK29776.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA137]
 gb|KCK33171.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA138]
 gb|KCK36738.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA139]
 gb|KCK38546.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA140]
 gb|KCK42739.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA142]
 gb|KCK47849.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA141]
 gb|KCK53493.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA143]
 gb|KCK54107.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA144]
 gb|KCK58808.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA145]
 gb|KCK61780.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA146]
 gb|KCK63247.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA147]
 gb|KCK73310.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA148]
 gb|KCK75321.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA149]
 gb|KCK80723.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA150]
 gb|KCK82698.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA151]
 gb|KCK88949.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA152]
 gb|KCK91050.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA153]
 gb|KCK96946.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA154]
 gb|KCL02751.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA155]
 gb|KCL06016.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA156]
 gb|KCL08837.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA157]
 gb|KCL10295.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA158]
 gb|KCL16515.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA159]
 gb|KCL19572.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA161]
 gb|KCL25035.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA162]
 gb|KCL25366.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA160]
 gb|KCL33362.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA163]
 gb|KCL33603.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA164]
 gb|KCL40070.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA165]
 gb|KCL44553.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA166]
 gb|KCL51152.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA167]
 gb|KCL52092.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA168]
 gb|KCL57443.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA170]
 gb|KCL61412.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA171]
 gb|KCL63095.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA169]
 gb|KCL66751.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA172]
 gb|KCL69718.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA173]
 gb|KCL74076.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA174]
 gb|KCL78420.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA175]
 gb|KCL85905.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA177]
 gb|KCL87558.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA176]
 gb|KCL89193.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA179]
 gb|KCL96764.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA178]
 gb|KCL98600.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA180]
 gb|KCM07419.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA182]
 gb|KCM09005.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA181]
 gb|KCM11939.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA184]
 gb|KCM15293.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA189]
 gb|KCM21680.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA190]
 gb|KCM24682.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA191]
 gb|KCM29393.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA192]
 gb|KCM33174.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA193]
 gb|KCM39134.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA195]
 gb|KCM40881.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA194]
 gb|KCM44714.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA197]
 gb|KCM48432.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA199]
 gb|KCM51861.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA196]
 gb|KCM58773.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA200]
 gb|KCM58867.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB03-012]
 gb|KCM62883.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB05-481]
 gb|KCM69709.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB03-108]
 gb|KCM75585.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB03-168]
 gb|KCM76157.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB03-169]
 gb|KCM83905.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-011]
 gb|KCM84712.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-001]
 gb|KCM91697.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-097]
 gb|KCM92696.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB03-142]
 gb|KCM98485.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-158]
 gb|KCN00407.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-128]
 gb|KCN02640.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-388]
 gb|KCN06532.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-172]
 gb|KCN08752.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-416]
 gb|KCN16574.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-452]
 gb|KCN22699.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB05-001]
 gb|KCN23227.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB05-013]
 gb|KCN25380.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB05-285]
 gb|KCN32487.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB05-348]
 gb|KCN33276.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB05-371]
 gb|KCN39823.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB03-143]
 gb|KCN45300.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB05-660]
 gb|KCN45660.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB05-650]
 gb|KCN51591.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB06-001]
 gb|KCN56249.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB06-340]
 gb|KCN58622.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB06-467]
 gb|KCN65255.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-001]
 gb|KCN65708.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB06-494]
 gb|KCN72652.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-070]
 gb|KCN73134.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-034]
 gb|KCN80423.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-123]
 gb|KCN81901.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-126]
 gb|KCN89655.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-170]
 gb|KCN90222.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB03-144]
 gb|KCN94483.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-206]
 gb|KCO00642.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-246]
 gb|KCO02653.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-243]
 gb|KCO07789.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-261]
 gb|KCO09325.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-254]
 gb|KCO15730.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-283]
 gb|KCO18788.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-275]
 gb|KCO23836.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-299]
 gb|KCO26404.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-300]
 gb|KCO32776.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-323]
 gb|KCO34533.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-324]
 gb|KCO39064.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-325]
 gb|KCO44410.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-354]
 gb|KCO46283.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-001]
 gb|KCO52486.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-014]
 gb|KCO54313.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-043]
 gb|KCO54848.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-022]
 gb|KCO63882.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-072]
 gb|KCO66927.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-093]
 gb|KCO70001.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-183]
 gb|KCO72210.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-148]
 gb|KCO81536.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-283]
 gb|KCO82564.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-221]
 gb|KCO83229.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-288]
 gb|KCO85249.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-309]
 gb|KCO91130.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-356]
 gb|KCO99441.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-362]
 gb|KCP04015.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-394]
 gb|KCP06170.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-036]
 gb|KCP07892.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-001]
 gb|KCP14336.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-085]
 gb|KCP15167.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-058]
 gb|KCP23605.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-086]
 gb|KCP28572.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-091]
 gb|KCP31290.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-151]
 gb|KCP36074.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-157]
 gb|KCP39088.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-184]
 gb|KCP43499.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-230]
 gb|KCP46598.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-382]
 gb|KCP47210.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-453]
 gb|KCP54857.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-485]
 gb|KCP58298.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-553]
 gb|KCP63443.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB09-554]
 gb|KCP64586.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-001]
 gb|KCP69784.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-005]
 gb|KCP75107.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-097]
 gb|KCP79643.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-120]
 gb|KCP83327.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-142]
 gb|KCP88895.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-257]
 gb|KCP90201.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-277]
 gb|KCP93361.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-357]
 gb|KCP95466.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-295]
 gb|KCQ04266.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-367]
 gb|KCQ06311.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-422]
 gb|KCQ07024.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-406]
 gb|KCQ13720.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-472]
 gb|KCQ14668.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-426]
 gb|KCQ20773.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-487]
 gb|KCQ28048.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-027]
 gb|KCQ30870.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-001]
 gb|KCQ34623.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-047]
 gb|KCQ36926.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-133]
 gb|KCQ43227.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-112]
 gb|KCQ47157.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-139]
 gb|KCQ51205.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-160]
 gb|KCQ54042.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-192]
 gb|KCQ58401.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-195]
 gb|KCQ63160.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-207]
 gb|KCQ65741.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-210]
 gb|KCQ72141.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-236]
 gb|KCQ72924.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-214]
 gb|KCQ78137.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-250]
 gb|KCQ84412.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-299]
 gb|KCQ86470.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-289]
 gb|KCQ93133.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-300]
 gb|KCQ94420.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-343]
 gb|KCQ96605.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB11-371]
 gb|KCR01102.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-001]
 gb|KCR09518.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-002]
 gb|KCR09995.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-046]
 gb|KCR14369.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-054]
 gb|KCR18520.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-094]
 gb|KCR22826.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-162]
 gb|KCR25948.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-206]
 gb|KCR32957.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-211]
 gb|KCR33891.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-294]
 gb|KCR38856.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-304]
 gb|KCR42960.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-305]
 gb|KCR46605.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-313]
 gb|KCR51316.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-314]
 gb|KCR54069.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-315]
 gb|KCR55773.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-400]
 gb|KCR64055.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-384]
 gb|KCR67571.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB12-449]
 gb|KCR69754.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB13-063]
 gb|KCR74271.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB13-089]
 gb|KCR76951.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB13-127]
 gb|KCR83736.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB13-156]
 gb|KCR84940.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB13-128]
 gb|KCR92120.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB13-206]
 gb|KCR93408.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB13-222]
 gb|KCR94675.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-081]
 gb|KCS01533.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-082]
 gb|KCS05760.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB13-276]
 gb|KCS09660.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-083]
 gb|KCS14478.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-084]
 gb|KCS17342.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-086]
 gb|KCS18741.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-088]
 gb|KCS24569.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-089]
 gb|KCS26343.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-091]
 gb|KCS34323.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-092]
 gb|KCS34938.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-093]
 gb|KCS38708.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-094]
 gb|KCS43458.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-095]
 gb|KCS50311.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-096]
 gb|KCS50702.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-097]
 gb|KCS58256.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-098]
 gb|KCS60965.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-100]
 gb|KCS63621.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-102]
 gb|KCS70066.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-103]
 gb|KCS72014.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-104]
 gb|KCS78395.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-105]
 gb|KCS80405.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-108]
 gb|KCS86357.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-107]
 gb|KCS89298.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-112]
 gb|KCS93652.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-111]
 gb|KCS95309.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-113]
 gb|KCS96357.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-114]
 gb|KCT04020.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-116]
 gb|KCT07348.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-115]
 gb|KCT11138.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-117]
 gb|KCT17357.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-120]
 gb|KCT18595.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-119]
 gb|KCT23738.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-122]
 gb|KCT31163.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-121]
 gb|KCT34346.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-124]
 gb|KCT38389.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-125]
 gb|KCT40801.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-126]
 gb|KCT48736.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-127]
 gb|KCT50151.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-128]
 gb|KCT51454.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-131]
 gb|KCT56341.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-133]
 gb|KCT60182.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-132]
 gb|KCT63242.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-134]
 gb|KCT66735.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-135]
 gb|KCT73951.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-137]
 gb|KCT75467.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-136]
 gb|KCT80811.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-140]
 gb|KCT85777.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-138]
 gb|KCT88905.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-143]
 gb|KCT92141.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-141]
 gb|KCT96637.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-145]
 gb|KCU01647.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-144]
 gb|KCU03105.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-146]
 gb|KCU06488.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-147]
 gb|KCU08098.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-150]
 gb|KCU17309.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-153]
 gb|KCU21948.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-152]
 gb|KCU22738.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-154]
 gb|KCU24171.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-155]
 gb|KCU32146.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-156]
 gb|KCU40413.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-158]
 gb|KCU42406.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-159]
 gb|KCU43274.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-162]
 gb|KCU49926.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-165]
 gb|KCU50819.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-161]
 gb|KCU54823.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-167]
 gb|KCU61709.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-168]
 gb|KCU67532.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-169]
 gb|KCU70239.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-172]
 gb|KCU73487.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-176]
 gb|KCU75278.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-175]
 gb|KCU81666.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-177]
 gb|KCU86604.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-179]
 gb|KCU89144.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-178]
 gb|KDA13793.1| LSU ribosomal protein L6p (L9e) [Mycobacterium tuberculosis]
 gb|KDM96308.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIB47294.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis K]
 gb|KEA67978.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD18]
 gb|KEA72492.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2104HD]
 gb|KEA74851.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis NRITLD28]
 gb|KEA78645.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD18115]
 gb|KEA86926.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05SA_0024]
 gb|KEA89886.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_05MA_0055]
 gb|KEA93335.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_03_0102]
 gb|KEA97960.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2542MS]
 gb|KEB01417.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2092HD]
 gb|KEB05028.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2995AB]
 gb|KEB11405.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2097HD]
 gb|KEB15788.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 2231BH]
 gb|KEB15995.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB13-001]
 gb|KEB25177.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB10-305]
 gb|KEB25971.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB08-395]
 gb|KEB30751.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-327]
 gb|KEB35827.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-314]
 gb|KEB36631.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB07-234]
 gb|KEB45206.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2898]
 gb|KEB45835.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis BTB04-120]
 gb|KEB50934.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2375]
 gb|KEB54076.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H1964]
 gb|KEB58366.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2193]
 gb|KEB61368.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M2084]
 gb|KEB63458.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1307]
 gb|KEB70600.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis M1759]
 gb|KEB73498.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TB_RSA52]
 gb|KEB76383.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020205]
 gb|KEB77456.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL020102]
 gb|KEB86637.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010124]
 gb|KEB88220.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MAL010117]
 gb|KEB95044.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14825]
 gb|KEB97405.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD14839]
 gb|KEC01854.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD13744]
 gb|KEC05729.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15774]
 gb|KEC09581.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15751]
 gb|KEC13806.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD15958]
 gb|KEC16094.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17901]
 gb|KEC20978.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17646]
 gb|KEC28303.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis XTB13-201]
 gb|KEC29016.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis MD17890]
 gb|KEC34157.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0107]
 gb|KEC39758.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis UT0118]
 gb|KEC41556.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0079]
 gb|KEC48606.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0023]
 gb|KEC49417.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK-01-0020]
 gb|KEC50898.1| 50S ribosomal protein L6 [Mycobacterium bovis BCG]
 gb|KEC91749.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis TKK_04_0124]
 gb|AID03791.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KED09338.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis KT-0045]
 gb|KEG28348.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KEG32161.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KEP35179.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KEP58989.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis str. Beijing/DS6701]
 gb|KEY15257.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KEY15956.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KEY16606.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFC56558.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH18643.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH22431.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH26227.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH29868.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH33328.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH36810.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH40124.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH43503.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH46560.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH50123.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH56376.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH58856.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH61793.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH65139.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH68446.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH72064.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH75776.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH79509.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH83259.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH89631.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH93357.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH97116.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIH99934.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KFE89924.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AII89321.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AII93237.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KFL41531.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KFW21858.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW22291.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW24086.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW32514.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW35738.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW35917.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW45785.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW46012.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW47853.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW58427.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW58603.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFW58694.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KFZ75875.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIQ03347.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIQ07337.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AIR46008.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|AIR13449.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis H37Rv]
 emb|CDM08940.1| putative 50S RIBOSOMAL PROTEIN L6 RPLF [Mycobacterium tuberculosis 
49-02]
 gb|KHG69599.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 dbj|BAQ04619.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis str. Kurono]
 gb|KHS04582.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AJF02077.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H37RvSiena]
 gb|KIN22408.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|AJK60756.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis 18b]
 gb|KIU62956.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|KIX86974.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 gb|AJP78724.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 emb|CEJ34479.1| 50S ribosomal protein L6 [Mycobacterium bovis]
 emb|CEJ40179.1| 50S ribosomal protein L6 [Mycobacterium bovis]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_031715051.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KBE56366.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis H2102]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_006946061.1| MULTISPECIES: 50S ribosomal protein L6 [Dermacoccus]
 gb|EFP57448.1| ribosomal protein L6 [Dermacoccus sp. Ellin185]
 gb|AIF40231.1| 50S ribosomal protein L6 [Dermacoccus nishinomiyaensis]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ P+PVPS V + ++GQD  VKGP G L +T P  + + K E G + V +  + R 
Sbjct  2    SRIGRLPVPVPSGVEVTIDGQDVTVKGPKGSLDLTVPAPITVAKGEDGSVEVTRPNDERD  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A   HGL R+L +NM+VGV+ G+ KKL++
Sbjct  62   ARARHGLTRSLINNMVVGVTDGYTKKLEI  90



>gb|AFE12033.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis RGTB423]
Length=180

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_015626848.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 ref|YP_007956895.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis str. Haarlem/NITR202]
 gb|AGL22466.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis str. Haarlem/NITR202]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_033436726.1| 50S ribosomal protein L6 [Saccharothrix sp. NRRL B-16314]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V + ++GQ   VKGP G L +     + +EK E G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIDGQAVSVKGPKGTLSLNIAEPIIIEKAEDGTLEVKRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NM+VGV++G++KK+++
Sbjct  62   SRSLHGLSRTLVQNMVVGVTQGYEKKMEI  90



>ref|WP_007031044.1| 50S ribosomal protein L6 [Amycolatopsis decaplanina]
 gb|EME60510.1| 50S ribosomal protein L6 [Amycolatopsis decaplanina DSM 44594]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + +EGQ  KVKGP G L  T    + +E+ E G L+V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIEGQQIKVKGPKGTLEHTIAEPITVERAEDGTLQVKRPDEERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>ref|WP_030532876.1| MULTISPECIES: 50S ribosomal protein L6 [Prauserella]
 gb|KID32526.1| ribosomal protein L6, bacterial type [Prauserella sp. Am3]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V + ++GQ   VKGP G L  T P  + +E++E G L V++  + R 
Sbjct  2    SRIGKLPITVPSGVEVNIDGQHVSVKGPKGTLEHTVPEPITVERDEDGALLVKRPDDERE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGVS+G++KK+++
Sbjct  62   SRALHGLTRTLVNNLVVGVSEGYEKKMEI  90



>ref|WP_025777917.1| 50S ribosomal protein L6 [Brevibacterium sp. VCM10]
Length=178

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V +K++GQD  VKGP GEL +T    + +  E+ GV+ V +  E R 
Sbjct  2    SRIGKNPISVPSGVEVKVDGQDVAVKGPKGELSVTIAEPITVSLED-GVITVARPDEERE  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NMIVGV+ G+ K L++
Sbjct  61   SRSLHGLSRTLINNMIVGVTDGYSKALEI  89



>ref|WP_037270096.1| 50S ribosomal protein L6 [Rhodococcus rhodnii]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V +++EGQ   VKGP G L  T    +KLE+ E G L V++  + R+
Sbjct  2    SRIGKLPITVPSGVDVQIEGQTVNVKGPKGALTHTIAEPIKLERAEDGTLEVKRPNDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL +N+++GV+ G++KKL++
Sbjct  62   NRALHGLTRTLVNNLVIGVTAGYEKKLEI  90



>ref|WP_008191191.1| 50S ribosomal protein L6 [Moorea producens]
 gb|EGJ28572.1| LSU ribosomal protein L6P [Moorea producens 3L]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+PS VT+ ++GQ  KVKG  GEL    P  +K E +    ++V +  ETR 
Sbjct  2    SRIGKRPIPIPSKVTVTIDGQQVKVKGSKGELDWVLPDTIKAE-QVGETVQVSRREETRT  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NMI GVSKGF+K+L +
Sbjct  61   ARESHGLSRTLVANMIEGVSKGFEKRLDI  89



>ref|WP_015955691.1| 50S ribosomal protein L6 [Cyanothece sp. PCC 7424]
 sp|B7KI01.1|RL6_CYAP7 RecName: Full=50S ribosomal protein L6 [Cyanothece sp. PCC 7424]
 gb|ACK72098.1| ribosomal protein L6 [Cyanothece sp. PCC 7424]
Length=179

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P+ VT+ ++G    VKGP GEL  T P  V +E++E GVLRV +  ++R 
Sbjct  2    SRIGKRPITIPNKVTVNIDGSHVAVKGPKGELQRTLPTLVIVEQDE-GVLRVVRQDDSRT  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A + HGL RTL  NM+ GVSKGF+K+L++
Sbjct  61   ARQRHGLCRTLVSNMVEGVSKGFEKRLEI  89



>ref|WP_018400614.1| 50S ribosomal protein L6 [filamentous cyanobacterium ESFC-1]
Length=181

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P  V+I ++GQ   VKGP G+L  T P EV + +E++ +  V++  E+R 
Sbjct  2    SRIGKRPIPIPDKVSITLDGQHVAVKGPKGQLERTLPPEVVITQEDNTIF-VKRRNESRL  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A + HGL RTL  NM+VGVS+GF K+LQ+
Sbjct  61   ARQRHGLSRTLIANMVVGVSQGFVKRLQI  89



>ref|WP_018682818.1| 50S ribosomal protein L6 [Actinokineospora enzanensis]
Length=179

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PIPVPS V + +EGQD  VKGP G L +     + +E+ E G L+V +  + R+
Sbjct  2    SRIGRLPIPVPSGVDVTIEGQDISVKGPKGTLALKVSEPITVERAEDGTLQVTRPNDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL R+L +N++VGV+ G++KK+++
Sbjct  62   NRALHGLTRSLVNNIVVGVTAGYEKKMEI  90



>ref|WP_039206324.1| 50S ribosomal protein L6 [Brevibacterium linens]
 gb|KHS54249.1| Ribosomal protein L6, subgroup [Brevibacterium linens]
Length=178

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V +K++GQD  VKGP GEL +T    + +  E+ GV+ V +  E R 
Sbjct  2    SRIGKNPISVPSGVEVKVDGQDVAVKGPKGELSVTIAEPITVSLED-GVVTVARPDEERE  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NMIVGV++G+ K L++
Sbjct  61   SRSLHGLSRTLINNMIVGVTEGYSKALEI  89



>ref|WP_040716840.1| 50S ribosomal protein L6 [Nocardia veterana]
Length=179

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIPVP+ V + ++GQ   VKGP G L  T    + + K E+G L V +  + RR
Sbjct  2    SRIGKKPIPVPAGVEVTIDGQHVSVKGPKGTLSHTVAEPITVTKAENGELEVARPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL +NMIVGV++G++KK+++
Sbjct  62   NRSLHGLSRTLINNMIVGVTQGYEKKMEI  90



>ref|WP_026922777.1| 50S ribosomal protein L6 [Glycomyces arizonensis]
Length=179

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI VPS V +K++G    VKGP G+L    P  + +EK E G L+V +  + R+
Sbjct  2    SRIGKQPIQVPSGVDVKIDGATVTVKGPKGQLVRELPEPIGIEKNEDGSLQVTRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL R+L +NM+VGVS+G+ K L++
Sbjct  62   SRALHGLARSLVNNMVVGVSEGYKKSLEI  90



>ref|WP_040157837.1| 50S ribosomal protein L6 [bacterium SIT7]
Length=180

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V +K++GQ   VKGP GEL +T    +++ K + G++ V +  + R 
Sbjct  2    SRIGKLPITVPSGVEVKLDGQHVAVKGPKGELSLTVADPIRINKNDEGLIEVTRPDDERE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NM++GV++GF K+L++
Sbjct  62   SRSLHGLTRTLVNNMVIGVTEGFSKQLEI  90



>ref|WP_015231117.1| 50S ribosomal protein L6 [Dactylococcopsis salina]
 gb|AFZ52143.1| ribosomal protein L6, bacterial type [Dactylococcopsis salina 
PCC 8305]
Length=179

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIP+P  V I ++G+  KVKGP GEL  T P  V +E+EE  +L V +  ++R+
Sbjct  2    SRIGKLPIPIPKKVEITLDGKLVKVKGPKGELEQTMPDFVTIEQEEDRIL-VHRVNDSRK  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NM+ GVS+GF+++LQ+
Sbjct  61   ARERHGLARTLVANMVHGVSQGFERRLQI  89



>ref|WP_033428587.1| 50S ribosomal protein L6 [Saccharothrix syringae]
Length=179

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V + + G++  VKGP G L +T    + +EK E G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIAGREVSVKGPKGTLSLTIAEPIIIEKAEDGTLEVKRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NM++GV++G++KK+++
Sbjct  62   SRSLHGLSRTLVQNMVIGVTQGYEKKMEI  90



>ref|WP_026929011.1| 50S ribosomal protein L6 [Glycomyces tenuis]
Length=179

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI VPS V +K++G    VKGP G+L    P  + +EK E G L+V +  + R+
Sbjct  2    SRIGKQPIQVPSGVDVKIDGATVTVKGPKGQLVRELPEPIGIEKNEDGSLQVTRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL R+L +NM+VGVS+G+ K L++
Sbjct  62   SRALHGLARSLVNNMVVGVSEGYTKSLEI  90



>ref|WP_017986620.1| 50S ribosomal protein L6 [Amycolatopsis methanolica]
 gb|AIJ20759.1| 50S ribosomal protein L6 [Amycolatopsis methanolica 239]
Length=179

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI VPS V + ++GQ+  VKGP G L  T    + +E+ E G L V++  + R 
Sbjct  2    SRIGKQPITVPSGVEVTIDGQNISVKGPKGTLSHTVAEPITVERGEDGALLVKRPDDERE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>ref|WP_026424131.1| 50S ribosomal protein L6 [Actinokineospora inagensis]
Length=179

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PIPVPS V + +EGQ   VKGP G L +T    + +E+ E G L+V +  + R+
Sbjct  2    SRIGRLPIPVPSGVDVTIEGQSVSVKGPKGALSLTVAEPITVERAEDGTLQVTRPNDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL R+L +N++VGV+ G++KK+++
Sbjct  62   NRALHGLTRSLVNNIVVGVTAGYEKKMEI  90



>ref|WP_020417565.1| MULTISPECIES: 50S ribosomal protein L6 [Amycolatopsis]
Length=179

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI VPS V + ++GQ+  VKGP G L  T    + +E+ E G L V++  + R 
Sbjct  2    SRIGKQPITVPSGVEVTIDGQNISVKGPKGTLSHTIAEPITVERGEDGALLVKRPDDERE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>ref|WP_009782735.1| 50S ribosomal protein L6 [Lyngbya sp. PCC 8106]
 gb|EAW38760.1| 50S ribosomal protein L6 [Lyngbya sp. PCC 8106]
Length=181

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P  VT  +EGQ   VKGP GEL    P +V LE++   +L V++  E+R 
Sbjct  2    SRIGKRPIPIPPKVTFTIEGQHIIVKGPKGELSRVLPEKVILEQDGDTLL-VKRRDESRV  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A ++HGL RTL  NM+ GVSKGF+K+L++
Sbjct  61   ARQLHGLSRTLVANMVDGVSKGFEKRLEI  89



>ref|WP_037332683.1| 50S ribosomal protein L6 [Amycolatopsis sp. MJM2582]
 gb|KFZ82847.1| 50S ribosomal protein L6 [Amycolatopsis sp. MJM2582]
Length=179

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQ  KVKGP G L  T    + +EK E G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQQIKVKGPKGTLEHTIAEPITVEKAEDGTLEVKRPDEERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>ref|WP_044096020.1| 50S ribosomal protein L6 [Mycobacterium canettii]
Length=179

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP  V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPPGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_024796212.1| 50S ribosomal protein L6 [Tomitella biformata]
Length=179

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + + GQ   VKGP G L +T    V +EK E G L+V +A + R 
Sbjct  2    SRIGKHPVGVPSGVDVSINGQQITVKGPKGALDLTLNDAVGVEKAEDGSLQVTRANDARE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL DNM++GV+ G+  K+++
Sbjct  62   SRALHGLSRTLVDNMVIGVTAGYTIKMEI  90



>ref|WP_021798532.1| 50S ribosomal protein L6 [Propionibacterium acidifaciens]
 gb|ERK51456.1| ribosomal protein L6 [Propionibacterium acidifaciens F0233]
Length=180

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PI VPS V + +EGQD  VKGP GEL  T P  + + + + G L V +  + R 
Sbjct  2    SRIGRLPIAVPSGVEVTLEGQDVTVKGPKGELSRTIPEPITISRNDEGQLVVERPDDERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NM+VGV++G++K L++
Sbjct  62   SKSLHGLSRTLVNNMVVGVTEGYEKHLEV  90



>ref|WP_043719879.1| 50S ribosomal protein L6 [Nocardia asiatica]
Length=179

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P+ V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKKPIALPAGVDVTIDGQDISVKGPKGTLSLTVAEPITVVKGEDGQLEVARPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NM+VGV++G++KK+++
Sbjct  62   SRALHGLTRTLVSNMVVGVTQGYEKKMEI  90



>ref|WP_040774335.1| 50S ribosomal protein L6 [Nocardia pneumoniae]
Length=178

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P+ V + ++GQD  VKGP G L +T    + + KE+ G L+V +  + RR
Sbjct  2    SRIGKKPIAIPAGVDVTIDGQDVSVKGPKGTLSLTVAEPITIAKED-GQLQVARPDDERR  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NMIVGV++G++KK+++
Sbjct  61   SRALHGLTRTLVSNMIVGVTQGYEKKMEI  89



>ref|WP_009625476.1| 50S ribosomal protein L6 [Pseudanabaena biceps]
 gb|ELS34382.1| LSU ribosomal protein L6P [Pseudanabaena biceps PCC 7429]
Length=187

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P  V + + GQ+  VKGP GEL    P  V++ +EES ++ V +A E+R 
Sbjct  2    SRIGKRPIPLPPKVAVSIVGQEVTVKGPKGELKRVLPPTVEILQEESNLI-VNRANESRP  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A + HGLFRTL  NM+ GVS GF +KL++
Sbjct  61   ARQQHGLFRTLVANMVEGVSTGFKRKLEI  89



>ref|WP_006621330.1| MULTISPECIES: 50S ribosomal protein L6 [Arthrospira]
 gb|EDZ92808.1| ribosomal protein L6 [Arthrospira maxima CS-328]
 emb|CCE20751.1| 50S ribosomal subunit protein L6 [Arthrospira sp. PCC 8005]
 gb|EKD10653.1| ribosomal protein L6 [Arthrospira platensis C1]
 emb|CDM93372.1| 50S ribosomal subunit protein L6 [Arthrospira sp. PCC 8005]
Length=179

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P+ VT+ ++GQ   VKGP GEL    P EV L  EE   L V++  E+R 
Sbjct  2    SRIGKRPIPIPAKVTLTLDGQKVTVKGPKGELSRVLPNEVILSLEED-TLIVKRRDESRV  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A + HGL RTL  NM+ GVS+GF+++L++
Sbjct  61   ARQRHGLCRTLVANMVDGVSQGFERRLEI  89



>ref|WP_011055950.1| 50S ribosomal protein L6 [Thermosynechococcus elongatus]
 ref|NP_680886.1| 50S ribosomal protein L6 [Thermosynechococcus elongatus BP-1]
 sp|Q8DML8.1|RL6_THEEB RecName: Full=50S ribosomal protein L6 [Thermosynechococcus elongatus 
BP-1]
 dbj|BAC07648.1| 50S ribosomal protein L6 [Thermosynechococcus elongatus BP-1]
Length=187

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P NVT+ ++GQ   VKGP G+L   +P EV + +E   ++ V++  ++R 
Sbjct  2    SRIGKRPIPLPKNVTLTLDGQQVTVKGPKGQLSRVFPPEVNVVQEGEAIV-VKRRDDSRP  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NM+ GVS+GF KKL++
Sbjct  61   AKERHGLCRTLLANMVEGVSQGFTKKLEI  89



>ref|WP_020633320.1| 50S ribosomal protein L6 [Amycolatopsis alba]
Length=179

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQ  KVKGP G L  T    + +EK E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQQIKVKGPKGTLEHTIAEPIIVEKAENGTLEVKRPDEERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>ref|WP_030329899.1| 50S ribosomal protein L6 [Micromonospora parva]
Length=180

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V I ++GQ  KVKGP G+L  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGQTVKVKGPKGQLEHTLAEPITIERGEDGELSVNRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_006237995.1| 50S ribosomal protein L6 [Saccharomonospora xinjiangensis]
 gb|EID53845.1| ribosomal protein L6, bacterial type [Saccharomonospora xinjiangensis 
XJ-54]
Length=179

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V + ++GQ   VKGP G L  T P  + +E+ E G L V+++ E R 
Sbjct  2    SRIGKLPITVPSGVDVNIDGQHITVKGPKGTLEHTVPERITVERGEDGALLVKRSDEERE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++K++++
Sbjct  62   SRALHGLTRTLVNNLVVGVTQGYEKRMEI  90



>ref|WP_026877482.1| 50S ribosomal protein L6 [Jiangella gansuensis]
Length=179

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIPVPS V + +EG+   VKGP G L  T P  + +E+ + G L VR+  + R 
Sbjct  2    SRIGKLPIPVPSGVEVTVEGRALTVKGPKGTLNHTLPDVIDVERSDDGTLEVRRPDDERE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NM+ GV++G+ KKL++
Sbjct  62   SRALHGLTRTLVANMVTGVTEGYVKKLEI  90



>ref|WP_003912916.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|EFP14590.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu002]
 gb|EFP20715.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu003]
 gb|EFP24502.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu004]
 gb|EFP25959.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu005]
 gb|EFP31984.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu006]
 gb|EFP35871.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu007]
 gb|EFP39755.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu008]
 gb|EFP44445.1| 50S ribosomal protein L6 rplF [Mycobacterium tuberculosis SUMu009]
Length=179

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G   K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGHTTKMEI  90



>ref|WP_023067381.1| 50S ribosomal protein L6 [Lyngbya aestuarii]
 gb|ERT06416.1| ribosomal protein L6 [Lyngbya aestuarii BL J]
Length=181

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P  VT+ +EGQ   VKGP GEL    P +V  E++   +L V++  E+R 
Sbjct  2    SRIGKRPIPIPPKVTLTIEGQQITVKGPKGELSRVLPAQVLFEQDGETLL-VKRRDESRV  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A + HGL RTL  NM+ GVSKGF+K+L++
Sbjct  61   ARQRHGLSRTLVANMVDGVSKGFEKRLEI  89



>ref|WP_006100646.1| 50S ribosomal protein L6 [Coleofasciculus chthonoplastes]
 gb|EDX76158.1| ribosomal protein L6, putative [Coleofasciculus chthonoplastes 
PCC 7420]
Length=179

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P+ VT+ +EGQ   VKGP GEL    P++V +E +E   + VR+  E+R 
Sbjct  2    SRIGKRPITIPNKVTVTIEGQQVTVKGPKGELQRVLPKQVTIE-QEGETIHVRRRDESRL  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A + HGL RTL  NM+ GVSKGF+++L +
Sbjct  61   ARQRHGLSRTLVANMVEGVSKGFERRLAI  89



>ref|WP_043058732.1| 50S ribosomal protein L6 [Mesorhizobium sp. UASWS1009]
 gb|KIU54917.1| 50S ribosomal protein L6 [Mesorhizobium sp. UASWS1009]
Length=177

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELG--ITYPREVKLEKEESGVLRVRKAMET  407
            SRIGK PI VPS V + + G D  VKGP GELG  I+ P E KLE+    V+R     E+
Sbjct  2    SRIGKLPITVPSGVEVAINGSDVSVKGPKGELGMSISGPIEAKLEENTITVIRPDDERES  61

Query  408  RRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            R    +HGL RTL DNMIVGV+ G+ KKL+L
Sbjct  62   R---SLHGLTRTLIDNMIVGVTAGYSKKLEL  89



>ref|WP_007167853.1| 50S ribosomal protein L6 [Mycobacterium parascrofulaceum]
 gb|EFG76280.1| ribosomal protein L6 [Mycobacterium parascrofulaceum ATCC BAA-614]
Length=179

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQP+P+P+ V + +EGQ+  VKGP G L +T    + +E+ E G + V +  + RR
Sbjct  2    SRIGKQPVPIPAGVDVTIEGQNVSVKGPKGSLNLTVAEPITVERNEDGAIVVTRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTEGYTTKMEI  90



>ref|WP_042182741.1| 50S ribosomal protein L6 [Kibdelosporangium sp. MJ126-NF4]
 emb|CEL15179.1| LSU ribosomal protein L6p (L9e) [Kibdelosporangium sp. MJ126-NF4]
Length=179

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V IK++GQ   VKGP G L  T    + LE+ + G L+V++  + R+
Sbjct  2    SRIGKLPIAVPSGVDIKIDGQTVNVKGPKGTLTHTIVEPISLERADDGTLQVKRPNDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL +N++VGV+ G++KKL++
Sbjct  62   NRALHGLTRTLVNNLVVGVTAGYEKKLEI  90



>ref|WP_018156887.1| 50S ribosomal protein L6 [Demetria terragena]
Length=179

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ P+PVP+ V + +EGQD +VKGP G+L +T    + + K + G + V +  + R 
Sbjct  2    SRIGRLPVPVPNGVEVTIEGQDVQVKGPKGQLALTVTDPITVAKGDDGSVEVARPNDERE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL R+L +NM+VGV+ G+ KKL++
Sbjct  62   SRSLHGLTRSLINNMVVGVADGYTKKLEI  90



>ref|WP_030155107.1| 50S ribosomal protein L6 [Glycomyces sp. NRRL B-16210]
Length=179

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI VPS V +K++G    VKGP G+L    P  + +EK E G + V +  + R+
Sbjct  2    SRIGKQPILVPSGVDVKIDGVTVTVKGPKGQLSRELPEPIGIEKNEDGTVSVTRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL R+L +NM+VGVS+G+ K L++
Sbjct  62   SRALHGLARSLVNNMVVGVSEGYKKSLEI  90



>ref|WP_034266086.1| 50S ribosomal protein L6 [Actinospica robiniae]
Length=179

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PIPVP+ V + ++G D  VKGP G L  T    + +EK E G L+V +  + R 
Sbjct  2    SRIGRLPIPVPAGVEVSIDGSDVTVKGPKGTLSHTVVNPISVEKAEDGTLQVTRPNDERA  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL +NMI+GV+ G+ K +++
Sbjct  62   AKERHGLTRTLINNMIIGVTTGYSKVMEI  90



>ref|WP_009883555.1| 50S ribosomal protein L6 [Brevibacterium linens]
Length=178

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VP+ V +K++GQD  VKGP GEL +T    + +  E+ GV+ V +  E R 
Sbjct  2    SRIGKNPISVPNGVEVKIDGQDVAVKGPKGELSVTIAEPITVSLED-GVVTVARPNEERE  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RT+ +NMIVGV+ G+ K L++
Sbjct  61   SRSLHGLSRTMINNMIVGVTDGYSKALEI  89



>ref|WP_038681115.1| 50S ribosomal protein L6 [Pimelobacter simplex]
 gb|AIY18658.1| LSU ribosomal protein L6p (L9e) [Pimelobacter simplex]
Length=179

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+PVP+ V I++ G D  VKGP G L  T    + +EK E GVL V++  + R+
Sbjct  2    SRIGKLPVPVPAGVDIQINGADVTVKGPKGTLSHTVAAPITVEKGE-GVLDVKRPDDERQ  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NM+VGV++G++KKL++
Sbjct  61   SKALHGLSRTLINNMVVGVTEGYEKKLEI  89



>ref|WP_015203286.1| 50S ribosomal protein L6 [Crinalium epipsammum]
 gb|AFZ13172.1| LSU ribosomal protein L6P [Crinalium epipsammum PCC 9333]
Length=179

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P  VT+ +EGQ   VKGP GEL    P EV +E +E   L V++  E+R 
Sbjct  2    SRIGKRPINIPGKVTVAIEGQHVGVKGPKGELSRVLPAEVTVE-QEGDTLVVKRRNESRP  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A ++HGL RTL  NM+ GVS+GF K+L++
Sbjct  61   ARQLHGLSRTLVANMVDGVSEGFQKRLEI  89



>ref|WP_018720668.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_031581248.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
Length=179

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + +E Q   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEAQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_027649217.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_018729116.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIEQAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_035991895.1| 50S ribosomal protein L6 [Leptolyngbya sp. KIOST-1]
Length=179

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIPVP+ V+I ++GQD +VKGP GEL  T P  V + +E   VL V +  ++R 
Sbjct  2    SRIGKRPIPVPAKVSITIDGQDVQVKGPKGELSRTLPSGVVVVQEGDTVL-VNRRDDSRL  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NM+ GV+ G+ K+L++
Sbjct  61   ARERHGLCRTLVANMVEGVANGYQKRLEI  89



>ref|WP_027940987.1| 50S ribosomal protein L6 [Amycolatopsis taiwanensis]
Length=179

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+PVPS V + ++GQ  +VKGP G L  T    +++E+ E G L V++  + R 
Sbjct  2    SRIGKLPVPVPSGVEVTIDGQHIQVKGPKGTLSHTVAEPIRVERGEDGELLVKRPDDERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  N++VGV+ G++KKL++
Sbjct  62   SKALHGLTRTLVHNLVVGVTSGYEKKLEI  90



>ref|WP_009379212.1| 50S ribosomal protein L6 [Brevibacterium casei]
 gb|EKU46518.1| 50S ribosomal protein L6 [Brevibacterium casei S18]
Length=178

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V +K++GQD  VKGP GEL +T    + +  E+ GV+ V +  + R 
Sbjct  2    SRIGKNPISVPSGVEVKIDGQDVAVKGPKGELSVTIAEPITVSLED-GVVTVARPDDERE  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NMI+GV+ G+ K L++
Sbjct  61   SRSLHGLSRTLINNMIIGVTDGYSKGLEI  89



>ref|WP_013493555.1| 50S ribosomal protein L6 [Intrasporangium calvum]
 gb|ADU49242.1| LSU ribosomal protein L6P [Intrasporangium calvum DSM 43043]
Length=178

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ P+ VPS V + + GQD  VKGP GEL +T P  + +E+ + G + V++  + R 
Sbjct  2    SRIGRLPVTVPSGVDVTLSGQDVTVKGPKGELSLTVPAPITVEQTD-GAIEVKRPNDERE  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A  +HGL R+L +NM++GV++G++KKL++
Sbjct  61   ARSLHGLTRSLLNNMVLGVTEGYEKKLEI  89



>ref|WP_036002394.1| 50S ribosomal protein L6 [Leptolyngbya sp. JSC-1]
Length=179

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIPVP NVT+ +  Q   VKGP GEL  T P EV++ +E   +L V +  ++R 
Sbjct  2    SRIGKRPIPVPKNVTVTIANQHVAVKGPKGELARTLPDEVEVVQEGETIL-VNRRNDSRV  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A + HGL RTL  NM+ GVS+GF K+L++
Sbjct  61   ARQRHGLSRTLVANMVEGVSQGFQKRLEI  89



>ref|WP_020643212.1| 50S ribosomal protein L6 [Amycolatopsis balhimycina]
Length=179

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQ  KVKGP G L  T    + +E++ESG L V++  + R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQQIKVKGPKGTLEHTVAEPITVERDESGTLLVKRPDDERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV+ G++KK+++
Sbjct  62   SKALHGLTRTLVNNLVVGVTAGYEKKMEI  90



>ref|WP_018726241.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_015118729.1| 50S ribosomal protein L6 [Rivularia sp. PCC 7116]
 gb|AFY55156.1| LSU ribosomal protein L6P [Rivularia sp. PCC 7116]
Length=183

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPI VP+ V IK+EG    VKGP GEL    P +V +  +E   L V +  ++R 
Sbjct  2    SRIGKQPIAVPAKVQIKIEGASISVKGPKGELSRELPTQVSVS-QEGDTLTVSRQDDSRV  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
              +MHGL R+L  NM+ GVS+GF +KLQL
Sbjct  61   CRQMHGLSRSLVSNMVEGVSQGFQRKLQL  89



>ref|WP_012593618.1| MULTISPECIES: 50S ribosomal protein L6 [Cyanothece]
 sp|B7K234.1|RL6_CYAP8 RecName: Full=50S ribosomal protein L6 [Cyanothece sp. PCC 8801]
 gb|ACK64341.1| ribosomal protein L6 signature 1 [Cyanothece sp. PCC 8801]
 gb|ACU99203.1| ribosomal protein L6 [Cyanothece sp. PCC 8802]
Length=179

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L  T P +V + +E   +L V++  ++R 
Sbjct  2    SRIGKRPIPIPNKVTIDIQGQHVAVKGPKGSLERTLPDKVNVVQENDTLL-VQREDDSRT  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NM+ GVSKGF+K+L +
Sbjct  61   ARERHGLTRTLVANMVEGVSKGFEKRLSI  89



>ref|WP_019174650.1| 50S ribosomal protein L6 [Brevibacterium massiliense]
Length=178

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI VPS V +K++GQ   VKGP GEL  T    + +  E+ GV+ + +  E R 
Sbjct  2    SRIGKRPISVPSGVEVKIDGQTVNVKGPKGELSHTVAEPITVALED-GVITLERPNEERE  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RT+ DNMI+GV++G++KKL++
Sbjct  61   SRALHGLSRTMVDNMIIGVTQGYEKKLEI  89



>ref|WP_017297633.1| 50S ribosomal protein L6 [Nodosilinea nodulosa]
Length=179

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIPVP+ V+I ++GQD +VKGP GEL  T P  V + ++   +L  RK  ++R 
Sbjct  2    SRIGKRPIPVPAKVSITIDGQDVQVKGPKGELSRTLPSGVVIVQDGDTILVNRKD-DSRI  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NM+ GVS G+ K+L++
Sbjct  61   ARERHGLCRTLVANMVEGVSNGYQKRLEI  89



>ref|WP_015170862.1| 50S ribosomal protein L6 [Geitlerinema sp. PCC 7407]
 gb|AFY65294.1| LSU ribosomal protein L6P [Geitlerinema sp. PCC 7407]
Length=179

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P+ VT+ + GQ   VKGP GEL  T+P  V  E++   +L V++  E+R 
Sbjct  2    SRIGKRPISIPAKVTVSISGQSITVKGPKGELSRTFPAGVVFEQDGETIL-VKRRDESRV  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NM+ GVS+GF K+L++
Sbjct  61   ARERHGLCRTLLSNMVEGVSQGFQKRLEI  89



>ref|WP_018217052.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTIAEPITIEQAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_040931604.1| 50S ribosomal protein L6 [Prochloron didemni]
Length=180

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +P  VT+K+ GQ   VKGP GEL    P  V++ K+E   L VR+  ++R 
Sbjct  2    SRIGKRPIEIPKKVTVKINGQHIAVKGPKGELERVLPALVEV-KQEGETLLVRRENDSRT  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL  NM+ GV+KGF+K+LQ+
Sbjct  61   ARERHGLCRTLVANMVEGVAKGFEKRLQI  89



>ref|WP_037314677.1| 50S ribosomal protein L6 [Amycolatopsis orientalis]
Length=179

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQ  +VKGP G L  T    + +E+ E G L+V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQHIQVKGPKGTLEHTIAEPITVERAEDGTLQVKRPDEERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>ref|WP_027654160.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTIAEPITIERAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMI+GV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIIGVTEGYRKSLEI  90



>ref|WP_012785173.1| 50S ribosomal protein L6 [Catenulispora acidiphila]
 gb|ACU69878.1| ribosomal protein L6 [Catenulispora acidiphila DSM 44928]
Length=180

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PIPVP+ V + + GQD  VKGP G L  T    + +EK E G L V +  + R 
Sbjct  2    SRIGRLPIPVPTGVDVTINGQDVTVKGPKGTLSHTVVNPITIEKGEDGNLVVSRPNDERI  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E HGL RTL +NMI+GV++G+ K L++
Sbjct  62   AKERHGLSRTLVNNMIIGVTQGYTKSLEI  90



>ref|WP_012799441.1| 50S ribosomal protein L6 [Slackia heliotrinireducens]
 gb|ACV23341.1| LSU ribosomal protein L6P [Slackia heliotrinireducens DSM 20476]
Length=181

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIPVP+ V + +EG    VKGPLGEL  TYP  + + +E   ++ V +  + R+
Sbjct  2    SRIGKKPIPVPAGVDVAIEGNTITVKGPLGELTYTYPVVITVAQEGDEII-VTRPNDERQ  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
                HGL R+L +NM+ GVSKGF K+L+L
Sbjct  61   NRAYHGLVRSLINNMVEGVSKGFSKRLEL  89



>ref|WP_003920617.1| 50S ribosomal protein L6 [Mycobacterium xenopi]
 gb|EID14389.1| 50S ribosomal protein L6 [Mycobacterium xenopi RIVM700367]
 gb|EUA52577.1| ribosomal protein L6 [Mycobacterium xenopi 3993]
Length=179

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVP+ V + ++GQ+  VKGP G L +T    + + + E G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIDGQNVSVKGPKGTLSLTVAEPITVSRNEDGAIVVSRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  N++ GV++G+  K+++
Sbjct  62   SRSLHGLSRTLVSNLVTGVTQGYTTKMEI  90



>ref|WP_018801042.1| 50S ribosomal protein L6 [Salinispora arenicola]
Length=180

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + ++GQ  KVKGP G L  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGVLSHTLAEPITVERAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_033357653.1| 50S ribosomal protein L6 [Dactylosporangium aurantiacum]
Length=180

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++PI VP+ V +K++GQ   VKGP GEL  T    + +EK E G   V +  + R+
Sbjct  2    SRIGRKPIAVPAGVDLKVDGQVVTVKGPKGELSHTLAEPITVEKAEDGTFNVVRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NM++GV++G+ K L++
Sbjct  62   AKELHGLSRTLIANMVIGVTEGYRKSLEI  90



>ref|WP_030489593.1| 50S ribosomal protein L6 [Micromonospora chokoriensis]
Length=180

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V I ++GQ  KVKGP G+L       + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGQTVKVKGPKGQLEHILAEPITIERAEDGQLSVNRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_018252463.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMI+GV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIIGVTEGYRKSLEI  90



>ref|WP_005453260.1| 50S ribosomal protein L6 [Saccharomonospora cyanea]
 gb|EHR59435.1| ribosomal protein L6, bacterial type [Saccharomonospora cyanea 
NA-134]
Length=179

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V + ++GQ   VKGP G L  T P  + +E+ E G L V++  E R 
Sbjct  2    SRIGKLPITVPSGVDVNIDGQHITVKGPKGTLEHTVPEPITVERGEDGTLVVKRPDEERE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++K++++
Sbjct  62   SRALHGLTRTLVNNLVVGVTQGYEKRMEI  90



>ref|WP_011628222.1| 50S ribosomal protein L6 [Alkalilimnicola ehrlichii]
 sp|Q0ABG0.1|RL6_ALKEH RecName: Full=50S ribosomal protein L6 [Alkalilimnicola ehrlichii 
MLHE-1]
 gb|ABI55827.1| LSU ribosomal protein L6P [Alkalilimnicola ehrlichii MLHE-1]
Length=177

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SR+ K+P+ VPS V +K++GQD KVKGP GEL  T    V +E+ + G LRV+  ++ RR
Sbjct  2    SRVAKRPVKVPSGVEVKLDGQDVKVKGPKGELAWTVHDWVAVEQAD-GELRVQAQLDDRR  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A  + G  R L +NM+ GVS+GF++KL+L
Sbjct  61   AVALAGTTRALLNNMVTGVSQGFERKLEL  89



>ref|WP_022874123.1| 50S ribosomal protein L6 [Arthrobacter sp. PAO19]
Length=178

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PI VP+NV + ++GQ   VKGP GEL IT    + + K+E+ V  VR   ++R 
Sbjct  2    SRIGRLPITVPANVELNIDGQLVAVKGPKGELSITVSAPITVSKDENTVTVVR-PNDSRE  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A  +HGL RTL +NMI+GV++G++KKL++
Sbjct  61   ARSLHGLTRTLINNMIIGVTEGYEKKLEI  89



>ref|WP_022871372.1| 50S ribosomal protein L6 [Yaniella halotolerans]
Length=177

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITY--PREVKLEKEESGVLRVRKAMET  407
            SRIGK PI VPS V + + G D  VKGP GELG++   P E KLE+    ++ V +  E 
Sbjct  2    SRIGKLPITVPSGVEVAINGSDVSVKGPKGELGMSIDGPIEAKLEEN---IITVMRPDEE  58

Query  408  RRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            R +  +HGL RTL +NMIVGV++G+ KKL+L
Sbjct  59   RESRSLHGLTRTLINNMIVGVTEGYSKKLEL  89



>ref|XP_003060321.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55090.1| predicted protein [Micromonas pusilla CCMP1545]
Length=218

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = +3

Query  231  ESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  410
            ESR+GKQP+ VP  VT  ++     VKGP G L   +P +  +  E+   +++ KA E+R
Sbjct  42   ESRVGKQPVKVPKGVTYTLKDNHLAVKGPKGSLEFQFP-DTMVFTEDGDEIKLSKADESR  100

Query  411  RANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
             A E HGL+RTLT+NM+VGVS GF+KKL+L
Sbjct  101  TAREGHGLYRTLTNNMMVGVSTGFEKKLKL  130



>ref|WP_018347778.1| 50S ribosomal protein L6 [Longispora albida]
Length=180

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++PI VPS V I ++GQ  KVKGP G L  T    +  E+E++G + V +  + R+
Sbjct  2    SRIGRKPIDVPSGVDITIDGQTVKVKGPKGSLEHTLAEPITAEREDNGQISVIRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV+ G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTTGYKKTLEI  90



>ref|WP_009233265.1| MULTISPECIES: 50S ribosomal protein L6 [Actinomyces]
 gb|EHM94688.1| 50S ribosomal protein L6 [Actinomyces sp. oral taxon 849 str. 
F0330]
Length=179

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ P+PVP+ V + ++GQD  VKGP G L  T    + + ++E G + V +  + RR
Sbjct  2    SRIGRLPVPVPAGVDVTIDGQDVTVKGPKGTLSRTISEPLSVTRQEDGSILVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NM++GV++G+ KKL++
Sbjct  62   SRSLHGLSRTLINNMVIGVTEGYSKKLEI  90



>ref|WP_009152392.1| 50S ribosomal protein L6 [Saccharomonospora marina]
 gb|EHR49004.1| ribosomal protein L6, bacterial type [Saccharomonospora marina 
XMU15]
Length=179

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V + ++GQ   VKGP G L    P  + +E+ E G L+VR+  + R 
Sbjct  2    SRIGKLPITVPSGVEVTIDGQHVTVKGPKGTLEHNVPEPIMVERAEDGTLQVRRPDDERE  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV+ GF+K++++
Sbjct  62   SRSLHGLTRTLVNNLVVGVTDGFEKRMEI  90



>ref|WP_037816261.1| MULTISPECIES: 50S ribosomal protein L6 [Actinomycetales]
Length=179

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQ+ KVKGP G L  T    + +E++E G L V++  + R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQNVKVKGPKGTLEHTVAEPIVVERDEDGALLVKRPDDERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>ref|WP_025616601.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTIAEPITVERAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMI+GV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIIGVTEGYRKSLEI  90



>ref|WP_010595601.1| 50S ribosomal protein L6 [Rhodococcus sp. P14]
Length=179

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKLPVTVPSGVEVTIDGQDVAVKGPKGNLSLTIAEPITIAKGEDGALNVSRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  N+IVGV++G+  K+++
Sbjct  62   SRALHGLSRTLVQNLIVGVTEGYTTKMEI  90



>ref|WP_019707835.1| 50S ribosomal protein L6 [Streptomyces xinghaiensis]
Length=179

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIPVP+ V + ++GQ   VKGP G L  T    +++ K E GV+ V +  + R+
Sbjct  2    SRIGKLPIPVPAGVDVTIDGQTVAVKGPKGSLSHTVAAPIEVSKGEDGVITVSRPNDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  NMI GV++G+ KKL++
Sbjct  62   NKALHGLSRTLVANMITGVTQGYSKKLEI  90



>ref|WP_006515901.1| 50S ribosomal protein L6 [Leptolyngbya sp. PCC 7375]
 gb|EKV01506.1| LSU ribosomal protein L6P [Leptolyngbya sp. PCC 7375]
Length=178

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+P+PVPS VT+ +  Q   VKGP GEL    P EV + +E   V+  R+  E+R 
Sbjct  2    SRIGKKPVPVPSGVTVSINAQSVVVKGPKGELSRILPGEVNITQEGEQVIVTRQD-ESRA  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A   HGL RTL  NM+ GVSKGF+K+L++
Sbjct  61   ARACHGLSRTLIANMVEGVSKGFEKRLEI  89



>ref|WP_026137931.1| 50S ribosomal protein L6, partial [Rhodococcus ruber]
Length=174

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKLPVTVPSGVEVTIDGQDVAVKGPKGNLSLTIAEPITIAKGEDGALNVSRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  N+IVGV+ G+  K+++
Sbjct  62   SRALHGLSRTLVQNLIVGVTDGYTTKMEI  90



>ref|WP_040833621.1| 50S ribosomal protein L6 [Nocardia brevicatena]
Length=179

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + + GQD  VKGP G+L +T    + + + + G + V +  + RR
Sbjct  2    SRIGKHPVLVPSGVEVTLNGQDVAVKGPKGQLALTVAEPIAVSRNDDGAIVVSRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NMI GV++G++KK+++
Sbjct  62   SRSLHGLTRTLIANMITGVTQGYEKKMEI  90



>ref|WP_043368788.1| 50S ribosomal protein L6 [Cyanobium sp. PCC 7001]
Length=179

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIPVP  VT+ + G    VKGP GEL  T P  V + +E S ++ V    E+RR
Sbjct  2    SRIGKAPIPVPDKVTVSLSGLAVTVKGPKGELSRTLPEGVSVAQEGSTIV-VSPTSESRR  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            + E HGL RTL  NM+ GVS+G+ +KL++
Sbjct  61   SRERHGLCRTLVANMVEGVSQGYTRKLEI  89



>ref|WP_010850863.1| 50S ribosomal protein L6 [Tetrasphaera elongata]
 emb|CCH71027.1| ribosomal protein L6 (BL8) [Tetrasphaera elongata Lp2]
Length=179

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+QP+ +PS VT+ ++GQ   VKGP GEL  T    + +E+ ESG L V++  + R 
Sbjct  2    SRIGRQPVAIPSGVTVNVDGQTVTVKGPKGELTHTVVSPITVEQGESG-LEVKRPNDERD  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +   HGL RTL +NM++GV++G++KKL++
Sbjct  61   SRSRHGLTRTLINNMVIGVTEGYEKKLEI  89



>ref|WP_005166793.1| MULTISPECIES: 50S ribosomal protein L6 [Amycolatopsis]
 gb|EMD22584.1| LSU ribosomal protein L6p (L9e) [Amycolatopsis azurea DSM 43854]
 gb|AIG80054.1| 50S ribosomal protein L6 [Amycolatopsis japonica]
Length=179

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQ  KV+GP G L  T    + +E+ E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVKVTIDGQQIKVEGPKGTLEHTIAEPITVEQAENGTLEVKRPDEERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>ref|WP_007356156.1| MULTISPECIES: 50S ribosomal protein L6 [Kamptonema]
 emb|CBN56952.1| 50S ribosomal protein L6 [ [[Oscillatoria] sp. PCC 6506]
Length=181

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI +PS VT+ ++GQ   VKGP GEL    P EV LE E   +L  R+  E+R 
Sbjct  2    SRIGKRPISIPSKVTVTIDGQHVAVKGPKGELSRLLPAEVVLELEGETLLVTRRD-ESRT  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A ++HGL RTL  NM+ GVS GF ++L++
Sbjct  61   ARQLHGLCRTLVSNMVEGVSNGFQRRLEI  89



>ref|WP_043503332.1| 50S ribosomal protein L6 [Streptomyces glaucescens]
 gb|AIR99994.1| 50S ribosomal protein L6 [Streptomyces glaucescens]
Length=179

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIPVP+ V + ++G+  KVKGP GEL  T    + + K E G L+V +  + R+
Sbjct  2    SRIGKLPIPVPAGVDVTIDGRTVKVKGPKGELTHTVAAPIDIAKGEDGTLQVLRPNDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  NMI GV++G+ KKL++
Sbjct  62   SKALHGLSRTLVANMITGVTQGYVKKLEI  90



>ref|WP_006456930.1| 50S ribosomal protein L6 [Synechococcus sp. PCC 7335]
 gb|EDX87146.1| ribosomal protein L6, putative [Synechococcus sp. PCC 7335]
Length=178

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEK--EESGVLRVRKAMET  407
            SRIGKQP+P+P  VT+ ++GQ    KG  GEL   +P E+ +E+  EE  V RV    E+
Sbjct  2    SRIGKQPVPIPKGVTVTIDGQMLTAKGSKGELSREFPPEIAIEQTGEEVVVTRVN---ES  58

Query  408  RRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            R A + HGL RTL  NM+ GVSKG++KKL++
Sbjct  59   RNARQRHGLVRTLVANMVEGVSKGYEKKLEI  89



>ref|XP_002966651.1| hypothetical protein SELMODRAFT_6327, partial [Selaginella moellendorffii]
 ref|XP_002978092.1| hypothetical protein SELMODRAFT_6323, partial [Selaginella moellendorffii]
 gb|EFJ20749.1| hypothetical protein SELMODRAFT_6323, partial [Selaginella moellendorffii]
 gb|EFJ32678.1| hypothetical protein SELMODRAFT_6327, partial [Selaginella moellendorffii]
Length=171

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +3

Query  243  GKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANE  422
            G++P+PVP  VT+K++GQ  +V GPLG L  T+  EV++  E    L +++ MET+++  
Sbjct  1    GRKPVPVPKGVTVKIDGQLVEVTGPLGSLSWTFRDEVRITLEND-TLILKRVMETKKSRA  59

Query  423  MHGLFRTLTDNMIVGVSKGFDKKL  494
            MHGL R L  NM+VGVS+GF+KKL
Sbjct  60   MHGLSRQLLSNMVVGVSQGFEKKL  83



>ref|WP_018222588.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R 
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_035279546.1| 50S ribosomal protein L6 [Actinokineospora sp. EG49]
 gb|EWC63567.1| LSU ribosomal protein L6p (L9e) [Actinokineospora sp. EG49]
Length=179

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PIPVP+ V I ++GQ    KGP G L +T    + +E+ E G L V++  + R+
Sbjct  2    SRIGRLPIPVPTGVDITIDGQQLSAKGPKGTLTLTVSEPIVVERAEDGTLEVKRPNDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL R+L +N++VGV+ GF+KKL++
Sbjct  62   NRALHGLTRSLVNNVVVGVTAGFEKKLEI  90



>ref|WP_006554596.1| MULTISPECIES: 50S ribosomal protein L6 [Rhodococcus]
 gb|EHK80605.1| 50S ribosomal protein L6 [Rhodococcus pyridinivorans AK37]
 gb|AHD20706.1| 50S ribosomal protein L6 [Rhodococcus pyridinivorans SB3094]
 gb|KHJ73287.1| 50S ribosomal protein L6 [Rhodococcus sp. Chr-9]
Length=179

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V I ++GQD  VKGP G L +T    + + K E G + V +  + RR
Sbjct  2    SRIGKLPVAVPSGVEITIDGQDVAVKGPKGNLSLTIAEPIAVAKGEDGAINVTRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  N+IVGV++G+  K+++
Sbjct  62   SRALHGLSRTLVQNLIVGVTEGYTTKMEI  90



>ref|WP_016331093.1| 50S ribosomal protein L6 [Amycolatopsis orientalis]
 gb|AGM03261.1| large subunit ribosomal protein L6 [Amycolatopsis orientalis 
HCCB10007]
Length=179

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQ  KV+GP G L  T    + +E+ E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVKVTIDGQQIKVEGPKGTLEHTIAEPITVEQAENGTLEVKRPDEERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +N++VGV++G++KKL++
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEI  90



>ref|WP_043466731.1| 50S ribosomal protein L6 [Streptomyces fradiae]
 gb|KDS86718.1| 50S ribosomal protein L6 [Streptomyces fradiae]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIPVP+ V + ++GQ   VKGP G L  T    +++ K E GV+ V +  + R+
Sbjct  2    SRIGKLPIPVPAGVDVTIDGQTVAVKGPKGSLSHTVAAPIEVSKGEDGVITVTRPNDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  NMI GV++G+ KKL++
Sbjct  62   NKALHGLSRTLVANMITGVTQGYSKKLEI  90



>ref|WP_040272340.1| 50S ribosomal protein L6 [Rhodococcus ruber]
 emb|CDZ89187.1| 50S ribosomal subunit protein L6 [Rhodococcus ruber]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VPS V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKLPVTVPSGVEVTIDGQDVAVKGPKGNLSLTIAEPITIAKGEDGALNVSRPNDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  N+IVGV+ G+  K+++
Sbjct  62   SRALHGLSRTLVQNLIVGVTDGYTTKMEI  90



>ref|WP_028656356.1| 50S ribosomal protein L6 [Nocardioides sp. J54]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PIPVP+ V +++ G D  VKGP G L  T    + +EK E GVL V++  + R 
Sbjct  2    SRIGKLPIPVPAGVDVQINGADVTVKGPKGTLSHTVAAPITVEKGE-GVLDVKRPDDERV  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NM+VGV++G++KKL++
Sbjct  61   SRSLHGLSRTLINNMVVGVTEGYEKKLEI  89



>ref|WP_033384207.1| 50S ribosomal protein L6 [Kibdelosporangium aridum]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V ++++GQ   VKGP G L  T    + +E+ E G L+V++  + R+
Sbjct  2    SRIGKLPITVPSGVDVQIDGQTVNVKGPKGTLTHTIAEPITVERAEDGTLQVKRPNDERQ  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL +N++VGV+ G++KKL++
Sbjct  62   NRALHGLTRTLVNNLVVGVTAGYEKKLEI  90



>emb|CCQ60081.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 0401]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V +++E   V+ V    ++R 
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSKVSVKQEGENVV-VTTDDDSRT  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A+E HGL RTL  NM+ GVSKGF+K+L +
Sbjct  61   AHERHGLSRTLVANMVEGVSKGFEKRLSI  89



>ref|WP_038992188.1| 50S ribosomal protein L6 [Arthrobacter sp. W1]
Length=178

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ PI VP+NV + ++GQ   VKGP GEL IT    + + K+E+ V  V +  ++R 
Sbjct  2    SRIGRLPISVPANVELNVDGQLVAVKGPKGELSITVKAPITVAKDENTVT-VSRPNDSRE  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A  +HGL RTL +NMIVGV++G++KKL++
Sbjct  61   ARSLHGLTRTLINNMIVGVTEGYEKKLEI  89



>ref|WP_015619007.1| 50S ribosomal protein L6 [Actinoplanes sp. N902-109]
 gb|AGL14449.1| 50S ribosomal protein L6 [Actinoplanes sp. N902-109]
Length=180

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ I VP+ V + + GQ  KVKGP GEL  T    + +EK E+G L V +  + R+
Sbjct  2    SRIGRKSITVPAGVDVTISGQTVKVKGPKGELSHTVAEPITVEKAENGELVVNRPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYKKTLEI  90



>ref|WP_023071150.1| 50S ribosomal protein L6 [Leptolyngbya sp. Heron Island J]
 gb|ESA38002.1| 50s ribosomal protein l6 [Leptolyngbya sp. Heron Island J]
Length=178

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+P+PVPS VT+ ++ Q   VKGP GEL    P EV + +E   V+  R+  ++R 
Sbjct  2    SRIGKKPVPVPSGVTVSIDAQSVVVKGPKGELSRVLPGEVNIAQEGEQVVVTRQD-DSRT  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A   HGL RTL  NM+ GVSKGF+K+L++
Sbjct  61   ARARHGLSRTLIANMVEGVSKGFEKRLEI  89



>ref|WP_015186046.1| 50S ribosomal protein L6 [Microcoleus sp. PCC 7113]
 gb|AFZ21918.1| LSU ribosomal protein L6P [Microcoleus sp. PCC 7113]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK+PI VP  VT+ ++GQ   VKGP GEL    P +V +E++    LRV +  E+R 
Sbjct  2    SRIGKRPITVPGKVTVNIDGQHVAVKGPKGELSRILPEQVAIEQDGE-TLRVVRRDESRA  60

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A + HGL RTL  NM+ GVS+GF+K+L +
Sbjct  61   ARQRHGLSRTLVANMVEGVSQGFEKRLSI  89



>ref|WP_012015113.1| MULTISPECIES: 50S ribosomal protein L6 [Salinispora]
 sp|A4XBN1.1|RL6_SALTO RecName: Full=50S ribosomal protein L6 [Salinispora tropica CNB-440]
 gb|ABP56338.1| LSU ribosomal protein L6P [Salinispora tropica CNB-440]
Length=180

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +++ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPTGVDVTIAGQTVTVKGPKGELSHTIAEPITIDRAEDGQLNVARPNDERK  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_029254913.1| 50S ribosomal protein L6 [Rhodococcus erythropolis]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK P+ VP+ V + + GQD  VKGP G L +T    + +EK E G L V +  + RR
Sbjct  2    SRIGKIPVTVPAGVDVTISGQDVTVKGPKGTLALTISEPIAIEKAEDGSLSVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL  N+I GV++G+ KK+++
Sbjct  62   SRALHGLSRTLVANIITGVTQGYTKKMEI  90



>ref|WP_006502869.1| 50S ribosomal protein L6 [Austwickia chelonae]
 dbj|GAB78115.1| 50S ribosomal protein L6 [Austwickia chelonae NBRC 105200]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG+ P+ VPS V + +EGQD +VKGP GEL I     + + + + G ++V +  + R 
Sbjct  2    SRIGRLPVSVPSGVEVTIEGQDVRVKGPKGELSIHVREPITVARCDDGSVQVSRPNDERM  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            +  +HGL RTL +NMI+GV+ G++KKL++
Sbjct  62   SRSLHGLTRTLINNMIIGVTSGYEKKLEI  90



>ref|WP_029127897.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R 
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITVERAEDGQLNVARPNDERT  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
            A E+HGL RTL  NMIVGV++G+ K L++
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEI  90



>ref|WP_010840030.1| 50S ribosomal protein L6 [Rhodococcus rhodnii]
 gb|EOM74672.1| ribosomal protein L6 RplF [Rhodococcus rhodnii LMG 5362]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGK PI VPS V   ++GQD  VKGP GEL +T P  + + K E G + V +  + RR
Sbjct  2    SRIGKLPIAVPSGVEFTLDGQDVTVKGPKGELSLTLPEPITIAKNEDGTVSVSRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GV++G+  K+++
Sbjct  62   NRSLHGLSRTLVANLVTGVTEGYVTKMEI  90



>ref|WP_019737211.1| 50S ribosomal protein L6 [Mycobacterium avium]
Length=179

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  413
            SRIGKQPIPVPS V + ++GQ   VKGP G L +T    +++ + + G L V +  + RR
Sbjct  2    SRIGKQPIPVPSGVDVTIDGQQVSVKGPKGTLELTVAEPIRVARNDDGALVVTRPDDERR  61

Query  414  ANEMHGLFRTLTDNMIVGVSKGFDKKLQL  500
               +HGL RTL  N++ GVS+G+ +K+++
Sbjct  62   NRSLHGLSRTLVANLVTGVSEGYVRKMEI  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300