BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H06

Length=540
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630249.1|  PREDICTED: uncharacterized protein LOC104120218    178   2e-52   Nicotiana tomentosiformis
ref|XP_006347674.1|  PREDICTED: 3'-5' exoribonuclease 1-like            174   1e-48   Solanum tuberosum [potatoes]
ref|XP_009771511.1|  PREDICTED: 3'-5' exoribonuclease 1-like            172   3e-48   Nicotiana sylvestris
ref|XP_004230041.1|  PREDICTED: 3'-5' exoribonuclease 1-like            171   1e-47   
emb|CDP12566.1|  unnamed protein product                                163   1e-44   Coffea canephora [robusta coffee]
ref|XP_003633521.2|  PREDICTED: uncharacterized protein LOC100853630    150   1e-39   Vitis vinifera
emb|CBI35099.3|  unnamed protein product                                150   2e-39   Vitis vinifera
ref|XP_007010835.1|  Uncharacterized protein TCM_044782                 145   4e-38   Theobroma cacao [chocolate]
ref|XP_004307079.1|  PREDICTED: uncharacterized protein LOC101295945    140   4e-36   Fragaria vesca subsp. vesca
gb|KJB73179.1|  hypothetical protein B456_011G220200                    140   6e-36   Gossypium raimondii
gb|KHG06287.1|  ERI1 exoribonuclease 2                                  139   8e-36   Gossypium arboreum [tree cotton]
gb|KJB67868.1|  hypothetical protein B456_010G215900                    139   1e-35   Gossypium raimondii
gb|KHG02983.1|  ERI1 exoribonuclease 2                                  138   2e-35   Gossypium arboreum [tree cotton]
ref|XP_011085889.1|  PREDICTED: ERI1 exoribonuclease 2-like isofo...    136   1e-34   Sesamum indicum [beniseed]
ref|XP_002529994.1|  conserved hypothetical protein                     135   2e-34   Ricinus communis
ref|XP_011034710.1|  PREDICTED: uncharacterized protein LOC105132738    134   8e-34   Populus euphratica
ref|XP_009361895.1|  PREDICTED: uncharacterized protein LOC103952092    134   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_008348713.1|  PREDICTED: uncharacterized protein LOC103411872    130   9e-34   
ref|XP_007220468.1|  hypothetical protein PRUPE_ppa006353mg             133   2e-33   Prunus persica
ref|XP_008231638.1|  PREDICTED: uncharacterized protein LOC103330804    132   5e-33   Prunus mume [ume]
ref|XP_008375340.1|  PREDICTED: uncharacterized protein LOC103438...    132   5e-33   
ref|XP_011085877.1|  PREDICTED: ERI1 exoribonuclease 2-like isofo...    131   9e-33   Sesamum indicum [beniseed]
ref|XP_008375341.1|  PREDICTED: uncharacterized protein LOC103438...    129   5e-32   
ref|XP_009372795.1|  PREDICTED: uncharacterized protein LOC103961...    129   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_011091862.1|  PREDICTED: 3'-5' exoribonuclease 1-like            127   2e-31   Sesamum indicum [beniseed]
gb|KJB73180.1|  hypothetical protein B456_011G220200                    127   2e-31   Gossypium raimondii
gb|ABK96614.1|  unknown                                                 127   3e-31   Populus trichocarpa x Populus deltoides
ref|XP_009372796.1|  PREDICTED: uncharacterized protein LOC103961...    127   4e-31   Pyrus x bretschneideri [bai li]
ref|XP_011020436.1|  PREDICTED: 3'-5' exoribonuclease 1-like isof...    126   5e-31   Populus euphratica
ref|XP_006368641.1|  hypothetical protein POPTR_0001s06840g             125   8e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002299190.1|  hypothetical protein POPTR_0001s06840g             125   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008363271.1|  PREDICTED: 3'-5' exoribonuclease 1-like            121   3e-29   
ref|XP_006432415.1|  hypothetical protein CICLE_v10001735mg             120   6e-29   
ref|XP_006465769.1|  PREDICTED: uncharacterized protein LOC102610428    119   2e-28   Citrus sinensis [apfelsine]
gb|ACU18154.1|  unknown                                                 112   4e-27   Glycine max [soybeans]
ref|XP_003542802.1|  PREDICTED: uncharacterized protein LOC100811151    113   2e-26   Glycine max [soybeans]
ref|XP_011020437.1|  PREDICTED: 3'-5' exoribonuclease 1-like isof...    113   2e-26   Populus euphratica
ref|XP_002303940.1|  hypothetical protein POPTR_0003s19370g             112   6e-26   
ref|XP_003546701.1|  PREDICTED: uncharacterized protein LOC100780340    112   8e-26   Glycine max [soybeans]
gb|KHN37717.1|  ERI1 exoribonuclease 2                                  111   1e-25   Glycine soja [wild soybean]
ref|XP_010247483.1|  PREDICTED: uncharacterized protein LOC104590494    110   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_003627960.1|  ERI1 exoribonuclease                               110   4e-25   
ref|XP_008445374.1|  PREDICTED: 3'-5' exoribonuclease 1-like            108   1e-24   Cucumis melo [Oriental melon]
gb|KDO44621.1|  hypothetical protein CISIN_1g0150172mg                  107   2e-24   Citrus sinensis [apfelsine]
gb|KDO44620.1|  hypothetical protein CISIN_1g0150172mg                  107   3e-24   Citrus sinensis [apfelsine]
gb|KDO44618.1|  hypothetical protein CISIN_1g0150172mg                  107   3e-24   Citrus sinensis [apfelsine]
gb|KDP40557.1|  hypothetical protein JCGZ_24556                         107   3e-24   Jatropha curcas
ref|XP_004146778.1|  PREDICTED: 3'-5' exoribonuclease 1-like            107   3e-24   Cucumis sativus [cucumbers]
gb|EYU42919.1|  hypothetical protein MIMGU_mgv1a007402mg                105   2e-23   Erythranthe guttata [common monkey flower]
gb|EYU38300.1|  hypothetical protein MIMGU_mgv1a008162mg              97.8    6e-21   Erythranthe guttata [common monkey flower]
ref|XP_008788490.1|  PREDICTED: ERI1 exoribonuclease 2-like           97.8    1e-20   Phoenix dactylifera
ref|XP_007133698.1|  hypothetical protein PHAVU_011G2015001g          92.0    5e-20   Phaseolus vulgaris [French bean]
ref|XP_010922083.1|  PREDICTED: ERI1 exoribonuclease 2-like           93.2    4e-19   Elaeis guineensis
ref|XP_010557919.1|  PREDICTED: 3'-5' exoribonuclease 1-like          92.0    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_008786828.1|  PREDICTED: uncharacterized protein LOC103705...  92.0    1e-18   Phoenix dactylifera
ref|XP_010904685.1|  PREDICTED: cell death-related nuclease 4-like    90.5    5e-18   Elaeis guineensis
ref|XP_008786829.1|  PREDICTED: uncharacterized protein LOC103705...  85.9    2e-16   Phoenix dactylifera
gb|KCW51075.1|  hypothetical protein EUGRSUZ_J00681                   82.4    8e-16   Eucalyptus grandis [rose gum]
ref|XP_004511053.1|  PREDICTED: 3'-5' exoribonuclease 1-like          82.8    2e-15   Cicer arietinum [garbanzo]
ref|XP_010031708.1|  PREDICTED: 3'-5' exoribonuclease 1-like isof...  82.4    4e-15   Eucalyptus grandis [rose gum]
ref|XP_010031707.1|  PREDICTED: 3'-5' exoribonuclease 1-like isof...  80.1    2e-14   Eucalyptus grandis [rose gum]
ref|XP_010520080.1|  PREDICTED: ERI1 exoribonuclease 3-like           75.5    6e-13   Tarenaya hassleriana [spider flower]
ref|XP_010651532.1|  PREDICTED: uncharacterized protein LOC100263...  75.9    7e-13   Vitis vinifera
gb|KHN32001.1|  ERI1 exoribonuclease 2                                75.1    9e-13   Glycine soja [wild soybean]
ref|XP_008672776.1|  PREDICTED: uncharacterized protein LOC100280...  72.4    1e-11   
ref|NP_001266573.1|  histone mRNA exonuclease 1                       72.4    1e-11   
ref|XP_008672771.1|  PREDICTED: uncharacterized protein LOC100280...  72.0    1e-11   Zea mays [maize]
ref|XP_002457669.1|  hypothetical protein SORBIDRAFT_03g011390        70.9    4e-11   Sorghum bicolor [broomcorn]
ref|XP_004967671.1|  PREDICTED: uncharacterized protein LOC101770...  70.5    4e-11   Setaria italica
tpg|DAA54202.1|  TPA: hypothetical protein ZEAMMB73_728544            67.4    5e-10   
ref|XP_008672769.1|  PREDICTED: uncharacterized protein LOC100280...  67.4    6e-10   Zea mays [maize]
ref|XP_008672772.1|  PREDICTED: uncharacterized protein LOC100280...  67.4    6e-10   Zea mays [maize]
ref|XP_008672770.1|  PREDICTED: uncharacterized protein LOC100280...  67.0    7e-10   
ref|NP_001146741.1|  uncharacterized protein LOC100280343             67.0    7e-10   
ref|XP_008672773.1|  PREDICTED: uncharacterized protein LOC100280...  67.0    8e-10   Zea mays [maize]
emb|CBI24268.3|  unnamed protein product                              65.1    3e-09   Vitis vinifera
ref|XP_002262814.2|  PREDICTED: uncharacterized protein LOC100263...  65.1    3e-09   Vitis vinifera
ref|XP_006432414.1|  hypothetical protein CICLE_v10001735mg           61.6    2e-08   
ref|XP_010099809.1|  ERI1 exoribonuclease 2                           61.6    4e-08   Morus notabilis
ref|XP_003567334.1|  PREDICTED: ERI1 exoribonuclease 2-like           61.2    5e-08   Brachypodium distachyon [annual false brome]
emb|CDM82920.1|  unnamed protein product                              60.8    7e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009412196.1|  PREDICTED: ERI1 exoribonuclease 2-like           59.7    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT10995.1|  Exonuclease domain-containing protein 1               58.9    3e-07   
ref|XP_010102112.1|  ERI1 exoribonuclease 2                           57.0    1e-06   
ref|XP_010673774.1|  PREDICTED: uncharacterized protein LOC104890...  57.0    1e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010067708.1|  PREDICTED: 3'-5' exoribonuclease 1-like          56.2    3e-06   Eucalyptus grandis [rose gum]
gb|KCW65878.1|  hypothetical protein EUGRSUZ_G03212                   55.8    3e-06   Eucalyptus grandis [rose gum]
gb|EEC70411.1|  hypothetical protein OsI_01406                        56.2    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_006832854.1|  hypothetical protein AMTR_s00095p00056830        53.1    2e-05   Amborella trichopoda
ref|XP_006644066.1|  PREDICTED: ERI1 exoribonuclease 2-like           52.8    3e-05   Oryza brachyantha
ref|NP_001042752.1|  Os01g0280000                                     52.0    5e-05   
ref|XP_010673775.1|  PREDICTED: uncharacterized protein LOC104890...  51.2    1e-04   
gb|KDO44617.1|  hypothetical protein CISIN_1g0150172mg                49.3    4e-04   Citrus sinensis [apfelsine]
gb|KDO44619.1|  hypothetical protein CISIN_1g0150172mg                49.3    4e-04   Citrus sinensis [apfelsine]
ref|XP_009419681.1|  PREDICTED: uncharacterized protein LOC103999613  48.5    9e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_009630249.1| PREDICTED: uncharacterized protein LOC104120218 [Nicotiana tomentosiformis]
Length=208

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            MIA+EHKDTM  NCEA +RCLQN GYP ++HY+  A+   PE ++G Y  P GD++D + 
Sbjct  1    MIAVEHKDTMHTNCEASVRCLQNAGYPHNLHYSRTAVNVLPEPSDGAYIHPGGDSLDGTL  60

Query  275  SSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGP  454
            S  +PIDSSKESP   V QH  G WSAFYP S NM + +V+A E+Q +PY VD+ +HY  
Sbjct  61   SG-EPIDSSKESPNHTVYQHGFGLWSAFYPNS-NMHLRSVNAIESQLFPYPVDNHYHYSL  118

Query  455  FNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             N  PQ Y Y+++FQDFQYFVVIDFEAT
Sbjct  119  LNMFPQNYQYDYRFQDFQYFVVIDFEAT  146



>ref|XP_006347674.1| PREDICTED: 3'-5' exoribonuclease 1-like [Solanum tuberosum]
Length=412

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            MIA+EHKDTM  NCEA +RCL +  YP ++HY+  A+K  PE ++GTY  P GD++DC+ 
Sbjct  1    MIAVEHKDTMHTNCEASVRCLPSASYPHNLHYSRTAVKVLPEPSDGTYIHPGGDSLDCTL  60

Query  275  SSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGP  454
            +  +PI+SSKESP   V QH  G WSAFYP S NM + +V+A E+Q YPYSVD+ +HY  
Sbjct  61   TG-EPIESSKESPSHTVYQHGFGLWSAFYPNS-NMHLRSVNAIESQPYPYSVDNHYHYSL  118

Query  455  FNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             N  PQ Y  +++FQDFQYFVVIDFEAT
Sbjct  119  LNMFPQNYQCDYRFQDFQYFVVIDFEAT  146



>ref|XP_009771511.1| PREDICTED: 3'-5' exoribonuclease 1-like [Nicotiana sylvestris]
Length=412

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            MIA+EHKDTM  NCEA +RCLQN GYP ++HY+  A+K  PE ++G Y  P GD++D + 
Sbjct  1    MIAVEHKDTMHTNCEASVRCLQNAGYPHNLHYSRTAVKVLPEPSDGAYIHPGGDSLDGTL  60

Query  275  SSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGP  454
            S +  IDSSKESP   V Q+  G WSAFYP S NM + +V+A E+Q +PY +D+ +HY  
Sbjct  61   SGES-IDSSKESPNHTVYQNGFGLWSAFYPNS-NMHLRSVNAIESQIFPYPMDNHYHYSL  118

Query  455  FNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             N  PQ Y Y+++FQDFQYFVVIDFEAT
Sbjct  119  LNMFPQNYQYDYRFQDFQYFVVIDFEAT  146



>ref|XP_004230041.1| PREDICTED: 3'-5' exoribonuclease 1-like [Solanum lycopersicum]
Length=412

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            MIA+EHKDTM  NCEA +RCL + GYP ++HY+  A+K  PE ++ TY  P GD++DC+ 
Sbjct  1    MIAIEHKDTMHTNCEASVRCLPSAGYPHNLHYSRTAVKVLPEPSDDTYIHPGGDSLDCTL  60

Query  275  SSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGP  454
            +  +PI+SSKESP   V QH  G WSAFYP S NM + +++A E+Q YPYSV++ +HY  
Sbjct  61   TG-EPIESSKESPSHTVYQHGFGLWSAFYPNS-NMHLRSLNAIESQPYPYSVENHYHYSL  118

Query  455  FNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             N  PQ Y  +++FQDFQYFVVIDFEAT
Sbjct  119  LNMFPQNYQCDYRFQDFQYFVVIDFEAT  146



>emb|CDP12566.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 105/151 (70%), Gaps = 4/151 (3%)
 Frame = +2

Query  95   MIALEHKDTMQ-VNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNI--D  265
            MIA+EHKD+++ +  E P+ CLQN G+P ++ Y    I+ F E  +G    P  D +  D
Sbjct  1    MIAVEHKDSIEHIPREVPVNCLQNNGFPCNLQYTRIPIEGFQELKDGIRGHPARDIVEPD  60

Query  266  CSFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFH  445
             SF+SD  ++S KE+PKKP+ QH    WS++YP S NM MC ++AFEAQFYP  VD+R  
Sbjct  61   NSFNSDS-LESPKETPKKPINQHEFSMWSSYYPESPNMTMCPMNAFEAQFYPCFVDNRIR  119

Query  446  YGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            Y P N IPQ YP+E+QFQDFQYFVVIDFEAT
Sbjct  120  YAPLNMIPQSYPHEYQFQDFQYFVVIDFEAT  150



>ref|XP_003633521.2| PREDICTED: uncharacterized protein LOC100853630 [Vitis vinifera]
Length=449

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 102/163 (63%), Gaps = 1/163 (1%)
 Frame = +2

Query  53   I*CTCSRILTTYNTMIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEG  232
            I CT   I TT   MIALEHK+TMQ NCEA ++CLQ+  +P  +   G  I+ F E  + 
Sbjct  21   ISCTRLWITTTSTIMIALEHKETMQRNCEASVKCLQSKRFPYKLPCKGNPIEGFSELKDE  80

Query  233  TYSQPVGDNIDCSFS-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEA  409
            T     GD ++   S S + +  S E   KP+ Q+  GSW  FYP S  ++ C ++AFE+
Sbjct  81   TSVHAGGDIVERERSLSSESLKPSNEFHNKPIYQNDFGSWPTFYPDSQKVQQCQLNAFES  140

Query  410  QFYPYSVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            Q+YP+ VD++F Y PF+   Q YPYEF  QDFQYFVVIDFEAT
Sbjct  141  QYYPFPVDNQFLYAPFHAFSQGYPYEFMLQDFQYFVVIDFEAT  183



>emb|CBI35099.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 102/163 (63%), Gaps = 1/163 (1%)
 Frame = +2

Query  53   I*CTCSRILTTYNTMIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEG  232
            I CT   I TT   MIALEHK+TMQ NCEA ++CLQ+  +P  +   G  I+ F E  + 
Sbjct  92   ISCTRLWITTTSTIMIALEHKETMQRNCEASVKCLQSKRFPYKLPCKGNPIEGFSELKDE  151

Query  233  TYSQPVGDNIDCSFS-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEA  409
            T     GD ++   S S + +  S E   KP+ Q+  GSW  FYP S  ++ C ++AFE+
Sbjct  152  TSVHAGGDIVERERSLSSESLKPSNEFHNKPIYQNDFGSWPTFYPDSQKVQQCQLNAFES  211

Query  410  QFYPYSVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            Q+YP+ VD++F Y PF+   Q YPYEF  QDFQYFVVIDFEAT
Sbjct  212  QYYPFPVDNQFLYAPFHAFSQGYPYEFMLQDFQYFVVIDFEAT  254



>ref|XP_007010835.1| Uncharacterized protein TCM_044782 [Theobroma cacao]
 gb|EOY19645.1| Uncharacterized protein TCM_044782 [Theobroma cacao]
Length=414

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+K+TMQ NCEA ++CLQ  G+P ++   G +I+  PE  +G    P GD ++  C
Sbjct  1    MMALENKETMQ-NCEAALKCLQTKGFPYNLQCTGNSIEGLPELKDGIGVHPGGDVVEPVC  59

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
            S S +  ++   E   KP  QH  GSW  FYP S+ ++   ++AF +QFY + VD+RFHY
Sbjct  60   SLSGEF-MELPSEFYHKPTLQHEYGSWPTFYPDSHKLQPYPMNAFGSQFYHFPVDNRFHY  118

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             PFN I   YPYEFQ QDFQYFVVIDFEAT
Sbjct  119  SPFNVITHGYPYEFQLQDFQYFVVIDFEAT  148



>ref|XP_004307079.1| PREDICTED: uncharacterized protein LOC101295945 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 9/153 (6%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE  + MQ NCEA ++CLQ+ G+P ++  NG  I+ FPE  +   + P G N +   
Sbjct  1    MMALEQSENMQRNCEASLKCLQSKGFPYNLQCNGNPIEGFPEHKDELSNHPGGGNSE---  57

Query  275  SSDQPIDSS-----KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSR  439
             SD+P+ S       E   KP   H  G WSAF+  S  ++ C +++FE+QFY   VDSR
Sbjct  58   -SDRPMGSEFLEPPTECHNKPTYHHDFGYWSAFHFDSQKLQQCQMNSFESQFYQNPVDSR  116

Query  440  FHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            FHY PFN   Q YP E QFQDFQYFVVIDFEAT
Sbjct  117  FHYVPFNVFAQSYPNELQFQDFQYFVVIDFEAT  149



>gb|KJB73179.1| hypothetical protein B456_011G220200 [Gossypium raimondii]
 gb|KJB73181.1| hypothetical protein B456_011G220200 [Gossypium raimondii]
Length=409

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 97/150 (65%), Gaps = 9/150 (6%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+K+TMQ NCEA ++CLQ  G+P ++   G +I+  PE  +   + P GD ++  C
Sbjct  1    MMALENKETMQ-NCEATLKCLQTKGFPYNLQCTGNSIEGLPEHKDEICTHPGGDVVEPVC  59

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
            S      ++       KP  QH SGSWS FYP ++ ++    +AF  QFY + +D+RFHY
Sbjct  60   S------LNGQFMEYHKPTLQHESGSWSTFYPDTHKLQPYPPNAFGGQFYHFPMDNRFHY  113

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             PFN +   YPYEFQFQDFQYFVVIDFEAT
Sbjct  114  APFNMVTHGYPYEFQFQDFQYFVVIDFEAT  143



>gb|KHG06287.1| ERI1 exoribonuclease 2 [Gossypium arboreum]
Length=414

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+K+TMQ NCEA ++CLQ  G+P ++  N  +++  PE      + P  D ++  C
Sbjct  1    MMALENKETMQ-NCEATLKCLQTKGFPYNLQCNRNSVEGIPELKHEFGTHPGRDVVEPVC  59

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
            S S +  ++   E   KP   H  GSWS FYP S+ ++   ++AF  Q Y + VD+RFHY
Sbjct  60   SLSGEF-VELPNEFYHKPTLHHECGSWSTFYPDSHKLQAYQLNAFGGQVYHFPVDNRFHY  118

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             PFN I   YPYEFQFQDFQYFVVIDFEAT
Sbjct  119  APFNVITHGYPYEFQFQDFQYFVVIDFEAT  148



>gb|KJB67868.1| hypothetical protein B456_010G215900 [Gossypium raimondii]
 gb|KJB67869.1| hypothetical protein B456_010G215900 [Gossypium raimondii]
Length=414

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+K+TMQ NCEA ++CLQ  G+P ++  N  +++  PE      + P  D ++  C
Sbjct  1    MMALENKETMQ-NCEATLKCLQTKGFPYNLQCNRNSVEGIPELKHDFGTHPGRDVVEPVC  59

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
            S S +  ++   E   KP   H  GSWS FYP S+ ++   ++AF  Q Y + VD+RFHY
Sbjct  60   SLSGEF-MELPNEFYHKPTLHHECGSWSTFYPDSHKLQAYPLNAFGGQVYHFPVDNRFHY  118

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             PFN I   YPYEFQFQDFQYFVVIDFEAT
Sbjct  119  APFNVITHGYPYEFQFQDFQYFVVIDFEAT  148



>gb|KHG02983.1| ERI1 exoribonuclease 2 [Gossypium arboreum]
Length=409

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 97/150 (65%), Gaps = 9/150 (6%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+K+TMQ NCEA ++CLQ  G+P ++   G +I+  PE  +   + P GD ++  C
Sbjct  1    MMALENKETMQ-NCEATLKCLQTKGFPYNLQCTGNSIEGRPELKDEICTHPGGDVVERVC  59

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
            S      ++       KP  +H SGSWS FYP ++ ++    +AF  QFY + +D+RFHY
Sbjct  60   S------LNGQFMEYHKPTLRHESGSWSTFYPDTHKLQPYPPNAFGGQFYHFPMDNRFHY  113

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             PFN +   YPYEFQFQDFQYFVVIDFEAT
Sbjct  114  APFNMVTHGYPYEFQFQDFQYFVVIDFEAT  143



>ref|XP_011085889.1| PREDICTED: ERI1 exoribonuclease 2-like isoform X2 [Sesamum indicum]
Length=415

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 102/150 (68%), Gaps = 4/150 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            MIALEHKDTMQ N EA ++CLQN GYP  +  N   ++ FP+   G  ++P G+ ID  C
Sbjct  2    MIALEHKDTMQRNHEASMKCLQNKGYPCTLQNNTTYVEGFPKIQNGLGARPCGNVIDQDC  61

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
              +S +P++SS+E  ++P+  H  GSWSA  P S ++ +  ++AF  Q  P++V+ RF Y
Sbjct  62   -LASSEPLESSEECTQRPIYHHDFGSWSA-NPDSKSVSLGQLNAFRGQLNPFAVNYRFQY  119

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             P N  PQ YPY++QFQDFQYFVVIDFEAT
Sbjct  120  APVNMFPQNYPYDYQFQDFQYFVVIDFEAT  149



>ref|XP_002529994.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32399.1| conserved hypothetical protein [Ricinus communis]
Length=409

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID-CS  271
            M+ALE+++T+Q +CEA ++CLQ  G+P      G  I  FPE  E     P GD ++   
Sbjct  1    MMALENQETIQRSCEASLKCLQTKGFPY-----GNPIDVFPELKEAISVHPGGDVVEPVH  55

Query  272  FSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
              S + ++   E   KP   H  GSWS FYP S  ++ C V+ FE+QFYP+ +++R+HY 
Sbjct  56   TVSSEFLELPSEFHTKPTYHHDFGSWSTFYPDSQKVQQCQVNCFESQFYPFPMETRYHYA  115

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            PFN   Q  PYE  FQDFQYFVVIDFEAT
Sbjct  116  PFNIYSQGCPYELHFQDFQYFVVIDFEAT  144



>ref|XP_011034710.1| PREDICTED: uncharacterized protein LOC105132738 [Populus euphratica]
 ref|XP_011000623.1| PREDICTED: uncharacterized protein LOC105108129 [Populus euphratica]
Length=409

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 94/149 (63%), Gaps = 6/149 (4%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE K+TMQ +CEA ++CLQ  G+P      G + + FPEF E   + P  D ++   
Sbjct  1    MMALESKETMQRSCEASLKCLQIKGFP-----CGNSFEGFPEFKEEIGAHPGRDAVEPVH  55

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
            S S + ++   E   KP   H  GSW  FYP S  M+   ++ FE+QFYP+ +++RFHY 
Sbjct  56   SLSSEFLELPSEFHNKPAYHHDFGSWPTFYPDSQKMQQHQMNCFESQFYPFPLETRFHYA  115

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            PF+   Q YP+E QFQDFQYFVVIDFEAT
Sbjct  116  PFSMFSQGYPFEIQFQDFQYFVVIDFEAT  144



>ref|XP_009361895.1| PREDICTED: uncharacterized protein LOC103952092 [Pyrus x bretschneideri]
Length=414

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 95/153 (62%), Gaps = 10/153 (7%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE  + M+  CEA ++CL N G+P ++  NG+ I+ FP   +   + PVGD  +   
Sbjct  1    MMALEQPEHMERTCEASLKCLHN-GFPYNLQCNGSPIEGFPNLKDAISNHPVGDVPE---  56

Query  275  SSDQPIDSS-----KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSR  439
             SD+P+ S       E   KP   H  G WS F+  S  ++ C  +AFE+QFYP+ +++R
Sbjct  57   -SDRPLGSEFLEPPTECHDKPNYHHDFGYWSTFHYDSQKVQQCQTNAFESQFYPFPMENR  115

Query  440  FHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            FHY PFN   Q YP +FQFQDFQYFVVIDFEAT
Sbjct  116  FHYAPFNMFAQSYPNDFQFQDFQYFVVIDFEAT  148



>ref|XP_008348713.1| PREDICTED: uncharacterized protein LOC103411872 [Malus domestica]
Length=224

 Score =   130 bits (326),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 94/153 (61%), Gaps = 10/153 (7%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE  + M+  CEA ++CL + G+P ++  NG  I+ FPE  +   + P GD  +   
Sbjct  1    MMALEQTEDMERTCEASLKCL-HKGFPYNLKCNGNPIEGFPEXKDEISNHPAGDVXE---  56

Query  275  SSDQPIDSSKESP-----KKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSR  439
             S++P+ S    P      KP   H  G WS F+  S   + C ++AFE+QFYP+ +++R
Sbjct  57   -SBRPLGSEFLEPPTGCYNKPTYHHDFGYWSTFHNDSQKXQQCQMNAFESQFYPFPMENR  115

Query  440  FHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            FHY PFN   Q YP +FQFQDFQYFVVIDFEAT
Sbjct  116  FHYVPFNMFAQSYPNDFQFQDFQYFVVIDFEAT  148



>ref|XP_007220468.1| hypothetical protein PRUPE_ppa006353mg [Prunus persica]
 gb|EMJ21667.1| hypothetical protein PRUPE_ppa006353mg [Prunus persica]
Length=415

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 92/153 (60%), Gaps = 9/153 (6%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE  + MQ NCEA ++CL N G+P ++  NG  I+ F E  +   + P GD  +   
Sbjct  1    MMALEQTENMQRNCEASLKCLHNKGFPYNLQCNGNPIEGFAEHKDDISTHPGGDVAE---  57

Query  275  SSDQPIDSS-----KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSR  439
              D+P+         E   KP   H  G WS F+  S  ++ C ++AFE+QF+P+ V++R
Sbjct  58   -PDRPVGGEFLEPPTECHNKPTYHHDFGYWSTFHFDSQKVQQCQINAFESQFHPFPVENR  116

Query  440  FHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            F+Y P N   Q YP EFQFQDFQYFVVIDFEAT
Sbjct  117  FNYVPLNMFAQSYPNEFQFQDFQYFVVIDFEAT  149



>ref|XP_008231638.1| PREDICTED: uncharacterized protein LOC103330804 [Prunus mume]
Length=415

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 92/153 (60%), Gaps = 9/153 (6%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE  + MQ NCEA ++CL N G+P ++  NG  I+ F E  +   + P GD  +   
Sbjct  1    MMALEQTENMQRNCEASLKCLHNKGFPYNLQCNGNPIEGFAEQKDDISTHPGGDVAE---  57

Query  275  SSDQPIDSS-----KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSR  439
              D+P+         E   KP   H  G WS F+  S  ++ C ++AFE+QF+P+ V++R
Sbjct  58   -PDRPVGGEFLEPPTECHNKPTYHHDFGYWSTFHFDSQKVQQCQINAFESQFHPFPVENR  116

Query  440  FHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            F+Y P N   Q YP EFQFQDFQYFVVIDFEAT
Sbjct  117  FNYVPLNMFAQSYPNEFQFQDFQYFVVIDFEAT  149



>ref|XP_008375340.1| PREDICTED: uncharacterized protein LOC103438591 isoform X1 [Malus 
domestica]
Length=414

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 94/153 (61%), Gaps = 10/153 (7%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE  + M+  CEA ++CL   G+P ++  NG+ I+ FP   +   + PVGD  +   
Sbjct  1    MMALEQXEDMERTCEASLKCLHK-GFPYNLQCNGSPIEGFPNLKDAISNHPVGDVPE---  56

Query  275  SSDQPIDSS-----KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSR  439
             SD P+ S       E   KP   H  G WS F+  S  ++ C ++AFE+QFYP+ +++R
Sbjct  57   -SDPPLGSEFLEPPTECHNKPNYHHDFGYWSTFHYDSQKVQQCQMNAFESQFYPFPMENR  115

Query  440  FHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            FHY PFN   Q YP +FQFQDFQYFVVIDFEAT
Sbjct  116  FHYAPFNMFAQSYPNDFQFQDFQYFVVIDFEAT  148



>ref|XP_011085877.1| PREDICTED: ERI1 exoribonuclease 2-like isoform X1 [Sesamum indicum]
 ref|XP_011085884.1| PREDICTED: ERI1 exoribonuclease 2-like isoform X1 [Sesamum indicum]
Length=417

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 6/152 (4%)
 Frame = +2

Query  95   MIALEHKD--TMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID-  265
            MIALEHKD  TMQ N EA ++CLQN GYP  +  N   ++ FP+   G  ++P G+ ID 
Sbjct  2    MIALEHKDADTMQRNHEASMKCLQNKGYPCTLQNNTTYVEGFPKIQNGLGARPCGNVIDQ  61

Query  266  -CSFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRF  442
             C  +S +P++SS+E  ++P+  H  GSWSA  P S ++ +  ++AF  Q  P++V+ RF
Sbjct  62   DC-LASSEPLESSEECTQRPIYHHDFGSWSA-NPDSKSVSLGQLNAFRGQLNPFAVNYRF  119

Query  443  HYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             Y P N  PQ YPY++QFQDFQYFVVIDFEAT
Sbjct  120  QYAPVNMFPQNYPYDYQFQDFQYFVVIDFEAT  151



>ref|XP_008375341.1| PREDICTED: uncharacterized protein LOC103438591 isoform X2 [Malus 
domestica]
Length=413

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 94/153 (61%), Gaps = 11/153 (7%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE  D M+  CEA ++CL   G+P ++  NG+ I+ FP   +   + PVGD  +   
Sbjct  1    MMALEQXD-MERTCEASLKCLHK-GFPYNLQCNGSPIEGFPNLKDAISNHPVGDVPE---  55

Query  275  SSDQPIDSS-----KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSR  439
             SD P+ S       E   KP   H  G WS F+  S  ++ C ++AFE+QFYP+ +++R
Sbjct  56   -SDPPLGSEFLEPPTECHNKPNYHHDFGYWSTFHYDSQKVQQCQMNAFESQFYPFPMENR  114

Query  440  FHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            FHY PFN   Q YP +FQFQDFQYFVVIDFEAT
Sbjct  115  FHYAPFNMFAQSYPNDFQFQDFQYFVVIDFEAT  147



>ref|XP_009372795.1| PREDICTED: uncharacterized protein LOC103961879 isoform X1 [Pyrus 
x bretschneideri]
Length=414

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 94/153 (61%), Gaps = 10/153 (7%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE  + M+  CEA ++CL   G+P ++  NG  I+ FPE  + T + PVGD  +   
Sbjct  1    MMALEQTEDMERTCEASLKCLHK-GFPYNLKCNGNPIEGFPELKDETSNHPVGDVPE---  56

Query  275  SSDQPIDSSKESP-----KKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSR  439
             SD P+ S    P      KP   H  G WS F+  S  ++   ++AFE+QFYP+ +++R
Sbjct  57   -SDCPLGSEFLEPPTGCYNKPTYHHDFGYWSTFHNDSQKVQQYQMNAFESQFYPFPMENR  115

Query  440  FHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            FHY PFN   Q YP +FQFQDFQYFVVIDFEAT
Sbjct  116  FHYVPFNMFAQSYPNDFQFQDFQYFVVIDFEAT  148



>ref|XP_011091862.1| PREDICTED: 3'-5' exoribonuclease 1-like [Sesamum indicum]
Length=415

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 6/151 (4%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            MI+LEHKDTMQ   +A I+ L+N  YP    YNG   + F EF  G ++QP  +  D  C
Sbjct  2    MISLEHKDTMQSYHKASIKSLENKCYPCTPQYNGTYFEGFKEFEGGLHAQPGWNATDPDC  61

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSA-FYPGSNNMRMCAVSAFEAQFYPYSVDSRFH  445
            S SS +P++SS++  ++PV  H  G+WS    PG+   R   ++AF+  F+P++V+ R  
Sbjct  62   SLSS-KPLESSEDYMQRPVYHHDYGTWSPNLDPGNAPRRQ--LNAFQGHFHPFAVNRRLQ  118

Query  446  YGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
              P N  PQ YPY+++FQDFQYFVVIDFEAT
Sbjct  119  CAPVNMFPQTYPYDYRFQDFQYFVVIDFEAT  149



>gb|KJB73180.1| hypothetical protein B456_011G220200 [Gossypium raimondii]
Length=400

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 8/138 (6%)
 Frame = +2

Query  131  NCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--CSFSSDQPIDSSK  304
            NCEA ++CLQ  G+P ++   G +I+  PE  +   + P GD ++  CS      ++   
Sbjct  3    NCEATLKCLQTKGFPYNLQCTGNSIEGLPEHKDEICTHPGGDVVEPVCS------LNGQF  56

Query  305  ESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTIPQRYPY  484
                KP  QH SGSWS FYP ++ ++    +AF  QFY + +D+RFHY PFN +   YPY
Sbjct  57   MEYHKPTLQHESGSWSTFYPDTHKLQPYPPNAFGGQFYHFPMDNRFHYAPFNMVTHGYPY  116

Query  485  EFQFQDFQYFVVIDFEAT  538
            EFQFQDFQYFVVIDFEAT
Sbjct  117  EFQFQDFQYFVVIDFEAT  134



>gb|ABK96614.1| unknown [Populus trichocarpa x Populus deltoides]
Length=409

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE K+TMQ +CEA ++CLQ  G+P      G + + FPEF E   S P  D ++   
Sbjct  1    MMALESKETMQRSCEASLKCLQIKGFP-----CGNSFEGFPEFKEEIGSHPGRDAVEPVH  55

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
            S S + ++   E   KP   H  GSW  FYP S  M+   ++ FE+QFYP+  ++RF + 
Sbjct  56   SLSSEFLELPSEFHNKPAYHHDFGSWPTFYPDSQKMQQHQMNCFESQFYPFPPETRFQHA  115

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            PF+   Q +P+E QFQDFQYFVVIDFEAT
Sbjct  116  PFSMFSQGHPFEIQFQDFQYFVVIDFEAT  144



>ref|XP_009372796.1| PREDICTED: uncharacterized protein LOC103961879 isoform X2 [Pyrus 
x bretschneideri]
Length=413

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 94/153 (61%), Gaps = 11/153 (7%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE  D M+  CEA ++CL   G+P ++  NG  I+ FPE  + T + PVGD  +   
Sbjct  1    MMALEQTD-MERTCEASLKCLHK-GFPYNLKCNGNPIEGFPELKDETSNHPVGDVPE---  55

Query  275  SSDQPIDSSKESP-----KKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSR  439
             SD P+ S    P      KP   H  G WS F+  S  ++   ++AFE+QFYP+ +++R
Sbjct  56   -SDCPLGSEFLEPPTGCYNKPTYHHDFGYWSTFHNDSQKVQQYQMNAFESQFYPFPMENR  114

Query  440  FHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            FHY PFN   Q YP +FQFQDFQYFVVIDFEAT
Sbjct  115  FHYVPFNMFAQSYPNDFQFQDFQYFVVIDFEAT  147



>ref|XP_011020436.1| PREDICTED: 3'-5' exoribonuclease 1-like isoform X1 [Populus euphratica]
Length=409

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 91/149 (61%), Gaps = 6/149 (4%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE+K+TMQ +CEA ++CLQ  G+P      G   ++ P F +   +   GD ++   
Sbjct  1    MMALENKETMQRSCEASLKCLQIKGFP-----CGNTFESLPRFKKEIGAHLGGDVVEPVH  55

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
            S S + ++   E   KP   H SGSWS FYP S  M  C ++ FE+QFYP+ ++++F Y 
Sbjct  56   SLSSEFLELPSEFQNKPAYHHDSGSWSTFYPDSQKMPPCQMNCFESQFYPFPLETQFQYA  115

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            P N   Q YP E Q QDFQYFVVIDFEAT
Sbjct  116  PSNIFSQGYPCEIQLQDFQYFVVIDFEAT  144



>ref|XP_006368641.1| hypothetical protein POPTR_0001s06840g [Populus trichocarpa]
 gb|ERP65210.1| hypothetical protein POPTR_0001s06840g [Populus trichocarpa]
Length=393

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE K+TMQ +CEA ++CLQ  G+P      G + + FPEF E   + P  D ++   
Sbjct  1    MMALESKETMQRSCEASLKCLQIKGFP-----CGNSFEGFPEFKEEIGAHPGRDVVEPVH  55

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
            S S + ++   E   KP   H  GSW  FYP S  M+   ++ FE+QFYP+  ++RF + 
Sbjct  56   SLSSEFLELPSEFHNKPAYHHDFGSWPTFYPDSQKMQQHQMNCFESQFYPFPPETRFQHA  115

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            PF+   Q +P+E QFQDFQYFVVIDFEAT
Sbjct  116  PFSMFSQGHPFEIQFQDFQYFVVIDFEAT  144



>ref|XP_002299190.1| hypothetical protein POPTR_0001s06840g [Populus trichocarpa]
 ref|XP_006368642.1| hypothetical protein POPTR_0001s06840g [Populus trichocarpa]
 gb|EEE83995.1| hypothetical protein POPTR_0001s06840g [Populus trichocarpa]
 gb|ERP65211.1| hypothetical protein POPTR_0001s06840g [Populus trichocarpa]
Length=409

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE K+TMQ +CEA ++CLQ  G+P      G + + FPEF E   + P  D ++   
Sbjct  1    MMALESKETMQRSCEASLKCLQIKGFP-----CGNSFEGFPEFKEEIGAHPGRDVVEPVH  55

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
            S S + ++   E   KP   H  GSW  FYP S  M+   ++ FE+QFYP+  ++RF + 
Sbjct  56   SLSSEFLELPSEFHNKPAYHHDFGSWPTFYPDSQKMQQHQMNCFESQFYPFPPETRFQHA  115

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            PF+   Q +P+E QFQDFQYFVVIDFEAT
Sbjct  116  PFSMFSQGHPFEIQFQDFQYFVVIDFEAT  144



>ref|XP_008363271.1| PREDICTED: 3'-5' exoribonuclease 1-like [Malus domestica]
Length=405

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 88/144 (61%), Gaps = 10/144 (7%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQPIDSS  301
            M+  CEA ++CL   G+P ++  NG  I+ FPE  +   + P GD  +    S++P+ S 
Sbjct  1    MERTCEASLKCLHK-GFPYNLKCNGNPIEGFPELKDEISNHPAGDVPE----SNRPLGSE  55

Query  302  KESP-----KKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTI  466
               P      KP   H  G WS F+  S  ++ C ++AFE+QFYP+ +++RFHY PFN  
Sbjct  56   FLEPPTGCYNKPTYHHDFGYWSTFHNDSQKVQQCQMNAFESQFYPFPMENRFHYVPFNMF  115

Query  467  PQRYPYEFQFQDFQYFVVIDFEAT  538
             Q YP +FQFQDFQYFVVIDFEAT
Sbjct  116  AQSYPNDFQFQDFQYFVVIDFEAT  139



>ref|XP_006432415.1| hypothetical protein CICLE_v10001735mg [Citrus clementina]
 gb|ESR45655.1| hypothetical protein CICLE_v10001735mg [Citrus clementina]
Length=341

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 4/149 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALEH + MQ  CEA ++ LQ+ G   ++ YN     N  E  + T   P GD  +   
Sbjct  1    MMALEHNEAMQRMCEASLKGLQSRGIRCNLQYNNG---NSVELKDDTIVHPGGDAGESIH  57

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
              S + ++ S E    P  QH  GSWS FYP S  +  C +++FE+QFYP+ V++RF + 
Sbjct  58   QLSSEFVEYSNEFYNNPTYQHDFGSWSTFYPDSQKVHHCQMNSFESQFYPFPVENRFQFA  117

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            P+N +   +PY+FQ Q+FQYFVVIDFEAT
Sbjct  118  PYNMLTPAHPYDFQPQEFQYFVVIDFEAT  146



>ref|XP_006465769.1| PREDICTED: uncharacterized protein LOC102610428 [Citrus sinensis]
Length=414

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 4/149 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALEH + MQ  CEA ++ LQ+ G   ++ YN     N  E  + T   P GD  +   
Sbjct  1    MMALEHNEAMQRMCEASLKGLQSRGIRCNLQYNNG---NSVELKDDTIVHPGGDAGESIH  57

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
              S + ++ S E    P  QH  GSWS FYP S  +  C +++FE+QFYP+ V++RF + 
Sbjct  58   QLSSEFVEYSNEFYNNPTYQHDFGSWSTFYPDSQKVHHCQMNSFESQFYPFPVENRFQFA  117

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            P+N +   +PY+FQ Q+FQYFVVIDFEAT
Sbjct  118  PYNMLTPAHPYDFQPQEFQYFVVIDFEAT  146



>gb|ACU18154.1| unknown [Glycine max]
Length=197

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 91/150 (61%), Gaps = 4/150 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+ + MQ+NCEA ++CLQ+ G+P +   NG +++ + E      + P GD  +  C
Sbjct  1    MMALENSENMQINCEASLKCLQSKGFPCNFQSNGNSMEGYTELKNEPGTHPAGDVAEPNC  60

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
               S+  ++ S E   KP       +W+  +  S+ ++ C ++AFE+ +YPY V++   Y
Sbjct  61   HLGSEF-LEPSNEFHTKPTYHQNYSTWTPCHFNSHKVQQCQMNAFESHYYPYPVENPLQY  119

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             P N + Q YP E Q+Q+FQYFVVIDFEAT
Sbjct  120  VPINMVAQGYPRE-QYQEFQYFVVIDFEAT  148



>ref|XP_003542802.1| PREDICTED: uncharacterized protein LOC100811151 [Glycine max]
Length=414

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 91/150 (61%), Gaps = 4/150 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+ + MQ+NCEA ++CLQ  G+P +   NG++++ F E      + P GD  +  C
Sbjct  1    MMALENSENMQINCEASLKCLQGKGFPCNFQSNGSSMEGFTELKNEPGTHPSGDVAEPNC  60

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
               S+  ++ S E   KP       +W+  +  S+ ++ C ++AFE+ +YPY V++   Y
Sbjct  61   HLGSEF-LEPSNEFHTKPTYHQNYSTWTPCHFNSHKVQQCQMNAFESHYYPYPVENPLQY  119

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             P N + Q YP E Q+Q+FQYFVVIDFEAT
Sbjct  120  VPINMVAQGYPRE-QYQEFQYFVVIDFEAT  148



>ref|XP_011020437.1| PREDICTED: 3'-5' exoribonuclease 1-like isoform X2 [Populus euphratica]
Length=400

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 82/140 (59%), Gaps = 6/140 (4%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFS-SDQPIDS  298
            MQ +CEA ++CLQ  G+P      G   ++ P F +   +   GD ++   S S + ++ 
Sbjct  1    MQRSCEASLKCLQIKGFP-----CGNTFESLPRFKKEIGAHLGGDVVEPVHSLSSEFLEL  55

Query  299  SKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTIPQRY  478
              E   KP   H SGSWS FYP S  M  C ++ FE+QFYP+ ++++F Y P N   Q Y
Sbjct  56   PSEFQNKPAYHHDSGSWSTFYPDSQKMPPCQMNCFESQFYPFPLETQFQYAPSNIFSQGY  115

Query  479  PYEFQFQDFQYFVVIDFEAT  538
            P E Q QDFQYFVVIDFEAT
Sbjct  116  PCEIQLQDFQYFVVIDFEAT  135



>ref|XP_002303940.1| hypothetical protein POPTR_0003s19370g [Populus trichocarpa]
 gb|EEE78919.1| hypothetical protein POPTR_0003s19370g [Populus trichocarpa]
Length=399

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 82/140 (59%), Gaps = 7/140 (5%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFS-SDQPIDS  298
            MQ +CEA ++CLQ  G+P      G   ++F  F E   + P  D ++   S S + ++ 
Sbjct  1    MQRSCEASLKCLQIKGFPY-----GNTFESF-RFKEEIGAHPGRDVVEPVHSLSSEFLEL  54

Query  299  SKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTIPQRY  478
              E   KP   H  GSWS FYP S  M  C ++ FE+QFYP+ +++RF Y PFN   Q Y
Sbjct  55   PSEFQNKPAYHHDFGSWSTFYPDSQKMPPCQMNCFESQFYPFPLETRFQYAPFNMFSQGY  114

Query  479  PYEFQFQDFQYFVVIDFEAT  538
            P E Q QDFQYFVVIDFEAT
Sbjct  115  PCEIQLQDFQYFVVIDFEAT  134



>ref|XP_003546701.1| PREDICTED: uncharacterized protein LOC100780340 [Glycine max]
Length=414

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 91/150 (61%), Gaps = 4/150 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+ + MQ+NCEA ++CLQ+ G+P +   NG +++ + E      + P GD  +  C
Sbjct  1    MMALENSENMQINCEASLKCLQSKGFPCNFQSNGNSMEGYTELKNEPGTHPAGDVAEPNC  60

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
               S+  ++ S E   KP       +W+  +  S+ ++ C ++AFE+ +YPY V++   Y
Sbjct  61   HLGSEF-LEPSNEFHTKPTYHQNYSTWTPCHFNSHKVQQCQMNAFESHYYPYPVENPLQY  119

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             P N + Q YP E Q+Q+FQYFVVIDFEAT
Sbjct  120  VPINMVAQGYPRE-QYQEFQYFVVIDFEAT  148



>gb|KHN37717.1| ERI1 exoribonuclease 2 [Glycine soja]
Length=414

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 90/150 (60%), Gaps = 4/150 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+ + MQ+NCEA ++CLQ  G+P +   NG++++ F E      + P G   +  C
Sbjct  1    MMALENSENMQINCEASLKCLQGKGFPCNFQSNGSSMEGFTELKNEPGTHPAGHVAEPNC  60

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
               S+  ++ S E   KP       +W+  +  S+ ++ C ++AFE+ +YPY V++   Y
Sbjct  61   HLGSEF-LEPSNEFHTKPTYHQNYSTWTPCHFNSHKVQQCQMNAFESHYYPYPVENPLQY  119

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             P N + Q YP E Q+Q+FQYFVVIDFEAT
Sbjct  120  VPINMVAQGYPRE-QYQEFQYFVVIDFEAT  148



>ref|XP_010247483.1| PREDICTED: uncharacterized protein LOC104590494 [Nelumbo nucifera]
 ref|XP_010247485.1| PREDICTED: uncharacterized protein LOC104590494 [Nelumbo nucifera]
Length=432

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 88/156 (56%), Gaps = 9/156 (6%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNI--DC  268
            M++ EHK+ MQ N EA IRCLQN  +  ++  NG +++ FPE  + T   P G ++  D 
Sbjct  1    MVSPEHKEAMQKNREASIRCLQNKAFSCNLQENGNSVEGFPEPKDETSVHPRGGSVEPDN  60

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFY------PYSV  430
            S SS+       E   +P+ Q     WS F+P     +    +AFE  FY      P+ V
Sbjct  61   SLSSEF-FAPPSEVYHRPMYQQDFYMWSNFHPDFQKAQQNQWNAFENHFYSMNHEYPFPV  119

Query  431  DSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            D+R+ Y PF      YPYEFQFQ+FQYFVVIDFEAT
Sbjct  120  DNRYQYAPFKMYSHGYPYEFQFQEFQYFVVIDFEAT  155



>ref|XP_003627960.1| ERI1 exoribonuclease [Medicago truncatula]
 gb|AFK45790.1| unknown [Medicago truncatula]
Length=415

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 90/149 (60%), Gaps = 2/149 (1%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE+ + MQ+ CEA ++CLQ  G P     NG++++ FPE N    + P G+  + + 
Sbjct  1    MMALENSENMQITCEASLKCLQGKGPPFTFQCNGSSMEVFPELNNEPGNHPSGNVPEPNH  60

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
                + ++ S E   KP   H   +W+A +   + M+ C ++AFE  FYP+ V+++F Y 
Sbjct  61   RLGSEFLEPSNEFHNKPTYHHDYSTWTACHFHPHKMQQCQMNAFENHFYPHPVENQFQYA  120

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            P N + Q YP E Q+Q+FQ FVVIDFEAT
Sbjct  121  PINMVSQGYPRE-QYQEFQNFVVIDFEAT  148



>ref|XP_008445374.1| PREDICTED: 3'-5' exoribonuclease 1-like [Cucumis melo]
 ref|XP_008445375.1| PREDICTED: 3'-5' exoribonuclease 1-like [Cucumis melo]
Length=414

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 86/158 (54%), Gaps = 20/158 (13%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE K++MQ NCEA I+CLQN G P  + ++G +   F         Q + D I C  
Sbjct  1    MMALERKESMQRNCEASIKCLQNNGMPFSLQHSGNSADGF---------QELTDEISCHA  51

Query  275  SSDQP----------IDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPY  424
            ++D P          I+   E   KP  QH S SW AF+  S  ++ C +SA + QFY  
Sbjct  52   NNDIPETNHPLVNNFIERPNEFHNKPAYQHNSSSWPAFHFESQKVQQCQMSASDCQFYSL  111

Query  425  SVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             V++RF Y PF      Y  + + Q+FQYFVVIDFEAT
Sbjct  112  PVENRFQYFPFKMFEHNY-CDVRLQEFQYFVVIDFEAT  148



>gb|KDO44621.1| hypothetical protein CISIN_1g0150172mg, partial [Citrus sinensis]
Length=371

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 83/140 (59%), Gaps = 4/140 (3%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFS-SDQPIDS  298
            MQ  CEA ++ LQ+ G   ++ YN     N  E  + T   P GD  +     S + ++ 
Sbjct  2    MQRMCEASLKGLQSRGIRCNLQYNNG---NSVELKDDTIVHPGGDAGESIHQLSSEFVEY  58

Query  299  SKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTIPQRY  478
            S E    P  QH  GSWS FYP S  +  C +++FE+QFYP+ V++RF + P+N +   +
Sbjct  59   SNEFYNNPTYQHDFGSWSTFYPDSQKVHHCQMNSFESQFYPFPVENRFQFAPYNMLTPAH  118

Query  479  PYEFQFQDFQYFVVIDFEAT  538
            PY+FQ Q+FQYFVVIDFEAT
Sbjct  119  PYDFQPQEFQYFVVIDFEAT  138



>gb|KDO44620.1| hypothetical protein CISIN_1g0150172mg, partial [Citrus sinensis]
Length=405

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 83/140 (59%), Gaps = 4/140 (3%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFS-SDQPIDS  298
            MQ  CEA ++ LQ+ G   ++ YN     N  E  + T   P GD  +     S + ++ 
Sbjct  1    MQRMCEASLKGLQSRGIRCNLQYNNG---NSVELKDDTIVHPGGDAGESIHQLSSEFVEY  57

Query  299  SKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTIPQRY  478
            S E    P  QH  GSWS FYP S  +  C +++FE+QFYP+ V++RF + P+N +   +
Sbjct  58   SNEFYNNPTYQHDFGSWSTFYPDSQKVHHCQMNSFESQFYPFPVENRFQFAPYNMLTPAH  117

Query  479  PYEFQFQDFQYFVVIDFEAT  538
            PY+FQ Q+FQYFVVIDFEAT
Sbjct  118  PYDFQPQEFQYFVVIDFEAT  137



>gb|KDO44618.1| hypothetical protein CISIN_1g0150172mg, partial [Citrus sinensis]
Length=406

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 83/140 (59%), Gaps = 4/140 (3%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFS-SDQPIDS  298
            MQ  CEA ++ LQ+ G   ++ YN     N  E  + T   P GD  +     S + ++ 
Sbjct  2    MQRMCEASLKGLQSRGIRCNLQYNNG---NSVELKDDTIVHPGGDAGESIHQLSSEFVEY  58

Query  299  SKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTIPQRY  478
            S E    P  QH  GSWS FYP S  +  C +++FE+QFYP+ V++RF + P+N +   +
Sbjct  59   SNEFYNNPTYQHDFGSWSTFYPDSQKVHHCQMNSFESQFYPFPVENRFQFAPYNMLTPAH  118

Query  479  PYEFQFQDFQYFVVIDFEAT  538
            PY+FQ Q+FQYFVVIDFEAT
Sbjct  119  PYDFQPQEFQYFVVIDFEAT  138



>gb|KDP40557.1| hypothetical protein JCGZ_24556 [Jatropha curcas]
Length=408

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 93/148 (63%), Gaps = 6/148 (4%)
 Frame = +2

Query  98   IALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFS  277
            +ALE+K+T+Q +CEA ++CLQ  G+P     +G +I  F E  E     P G  +    S
Sbjct  1    MALENKETIQRSCEASLKCLQTKGFP-----HGNSIDGFSELEEEVNVHPGGHVVAPVHS  55

Query  278  -SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGP  454
             S + ++   E   KP   H  GSWS FYP S  ++ C ++ FE+QFYP+ +++RFHY P
Sbjct  56   LSREYLELPSEFNTKPTYHHDFGSWSNFYPDSQKVQQCQMNCFESQFYPFPMETRFHYAP  115

Query  455  FNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            FN   Q YP++FQFQDFQYFVVIDFE T
Sbjct  116  FNMHSQGYPHQFQFQDFQYFVVIDFEVT  143



>ref|XP_004146778.1| PREDICTED: 3'-5' exoribonuclease 1-like [Cucumis sativus]
 ref|XP_004163993.1| PREDICTED: 3'-5' exoribonuclease 1-like [Cucumis sativus]
 gb|KGN47753.1| hypothetical protein Csa_6G399780 [Cucumis sativus]
Length=414

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 86/158 (54%), Gaps = 20/158 (13%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALE K++MQ NCEA I+CLQN G P  + ++G +   F         Q + D I C  
Sbjct  1    MMALERKESMQRNCEASIKCLQNNGMPFSLQHSGNSADGF---------QELTDEISCHA  51

Query  275  SSDQP----------IDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPY  424
            ++D P          I+   E   KP  QH S SW AF+  S  ++ C +SA + QFY  
Sbjct  52   NNDIPETNHPLVNNFIERPNEFHNKPAYQHNSRSWPAFHFESQKVQQCQMSASDCQFYSL  111

Query  425  SVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             V++RF Y PF      Y  + + Q+FQYFVVIDFEAT
Sbjct  112  PVENRFQYFPFKMFEPNY-CDVRLQEFQYFVVIDFEAT  148



>gb|EYU42919.1| hypothetical protein MIMGU_mgv1a007402mg [Erythranthe guttata]
 gb|EYU42920.1| hypothetical protein MIMGU_mgv1a007402mg [Erythranthe guttata]
Length=409

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 87/154 (56%), Gaps = 11/154 (7%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTY-SQPVGDNIDCS  271
            MI+LE K TMQ N EA I  LQ    P    +N    K FP+F + ++ SQ VG+ ++  
Sbjct  2    MISLEQKVTMQRNHEASIISLQTKARPFTPQHNITYSKCFPDFQDTSHASQSVGNVLE--  59

Query  272  FSSDQPIDS-----SKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDS  436
               ++P++S     S ESP++PV    SG+WS  Y  SN   +C  + F   F PY+V  
Sbjct  60   --PERPLNSELLECSGESPQRPVYHLNSGTWS-LYSDSNQTPLCQANPFHGLFKPYAVKH  116

Query  437  RFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            R    P + + Q YPY++QF DFQY  VIDFEAT
Sbjct  117  RIQCAPVHMVAQAYPYDYQFHDFQYLGVIDFEAT  150



>gb|EYU38300.1| hypothetical protein MIMGU_mgv1a008162mg [Erythranthe guttata]
Length=383

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 79/149 (53%), Gaps = 36/149 (24%)
 Frame = +2

Query  95   MIA-LEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCS  271
            MIA LE KDT+Q N EA ++CL+N G+P  + YN    + FP+ + G+            
Sbjct  1    MIASLERKDTIQGNYEASLKCLENKGHPSTLQYNKTYTEGFPDNSSGS------------  48

Query  272  FSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
                +P+  S+E  ++PV QH  GS                 AF  QF+P +++ RF Y 
Sbjct  49   ----KPVQLSEECTQRPVYQHEHGS---------------SGAFRGQFHPVALNYRFQYA  89

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            P N  PQ +    QFQDFQYFVVIDFEAT
Sbjct  90   PVNMFPQNH----QFQDFQYFVVIDFEAT  114



>ref|XP_008788490.1| PREDICTED: ERI1 exoribonuclease 2-like [Phoenix dactylifera]
 ref|XP_008788491.1| PREDICTED: ERI1 exoribonuclease 2-like [Phoenix dactylifera]
Length=431

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 82/159 (52%), Gaps = 16/159 (10%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            MI  E K+TMQ N EA   CL+   +  + H +G+A + FPE        P G     +F
Sbjct  1    MINREDKETMQGNLEASSGCLRAKAFYYNSHESGSAFEGFPEHKNEMNINPGG-----TF  55

Query  275  SSDQPIDSSKESP-----KKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------  421
             S  P +    +P      +P  Q  S +W +F+P    +    V+  EAQFYP      
Sbjct  56   ESGNPSNRESSAPPSQGYNRPFYQQESYTWPSFHPDVQKLWHSPVNIVEAQFYPVNREYY  115

Query  422  YSVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            + V++RFH  PF      YP+ FQFQ+FQYFVVIDFEAT
Sbjct  116  FPVENRFHNLPFKMFAHGYPHGFQFQEFQYFVVIDFEAT  154



>ref|XP_007133698.1| hypothetical protein PHAVU_011G2015001g, partial [Phaseolus vulgaris]
 gb|ESW05692.1| hypothetical protein PHAVU_011G2015001g, partial [Phaseolus vulgaris]
Length=141

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 81/142 (57%), Gaps = 4/142 (3%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNID--C  268
            M+ALE+ + MQ+NCEA ++CL    +P +   NG++++ F E      + P GD  +  C
Sbjct  1    MMALENSENMQINCEASLKCLPGKVFPCNFQSNGSSMEGFTELKNEPGTHPAGDVTEPNC  60

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHY  448
               S+  ++ S E   KP       +W+  +  ++ ++ C ++ FE+ FYPY V+++  Y
Sbjct  61   HLGSEF-LEPSNEFHSKPSYHQNYSTWTPCHFNAHKVQQCQMNGFESHFYPYPVENQLQY  119

Query  449  GPFNTIPQRYPYEFQFQDFQYF  514
             P N + Q YP E Q+Q+FQYF
Sbjct  120  VPINMVAQGYPRE-QYQEFQYF  140



>ref|XP_010922083.1| PREDICTED: ERI1 exoribonuclease 2-like [Elaeis guineensis]
Length=431

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 80/159 (50%), Gaps = 16/159 (10%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            MI  E K+TMQ N EA   CL+   +    H +G A + FPE +      P G     + 
Sbjct  1    MINREDKETMQGNLEASSGCLRTKAFYYSSHESGNAFEGFPEHDNEMNINPSG-----TV  55

Query  275  SSDQPIDSSKESP-----KKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------  421
             S  P +    +P      +P  Q  S +W +F+P         V+  EAQFYP      
Sbjct  56   ESGNPSNRESSAPPNQAYNRPFYQQESYTWPSFHPDFQKFWHSPVNIVEAQFYPVNREYY  115

Query  422  YSVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            + V++RFH+ PF      +P+ FQFQ+FQYFVVIDFEAT
Sbjct  116  FPVENRFHHLPFKMFAHGFPHGFQFQEFQYFVVIDFEAT  154



>ref|XP_010557919.1| PREDICTED: 3'-5' exoribonuclease 1-like [Tarenaya hassleriana]
Length=414

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 82/149 (55%), Gaps = 2/149 (1%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M ALE+K T+Q + EA  +C Q  G+ Q++  N           +   S P G+ +D + 
Sbjct  1    MAALENKVTLQRSSEASFKCFQTHGFHQNVQSNMNVATVASGLKDEFCSHP-GEVVDRAQ  59

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
              S+  ++ + +   KP   H SGSWS+FYP    M    + A+  Q +P +++ +  Y 
Sbjct  60   QISNGFLEHANKFYSKPTLVHDSGSWSSFYPEPPKMPQYQMDAYGNQCFPVTIEPQLQYV  119

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            P+N   Q +PY  Q+QDFQYFVVIDFEAT
Sbjct  120  PYNVCAQGHPYNIQYQDFQYFVVIDFEAT  148



>ref|XP_008786828.1| PREDICTED: uncharacterized protein LOC103705029 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 81/166 (49%), Gaps = 23/166 (14%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIR-------CLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVG  253
            MI  E+K+TMQ + EA          CL+   +  H+H +G + K FPE  +   + P G
Sbjct  1    MINRENKETMQGSLEAASGSLEASSGCLRTKAFYYHLHESGNSFKRFPEPKKEMNTNPGG  60

Query  254  DNIDCSFSSDQPIDSSKESP-----KKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFY  418
                 +  S  P  S   +P      +P  Q    +W   +P         V+  E  FY
Sbjct  61   -----TVESGNPSKSESSAPPNQAYSRPFYQQDLYTWPNLHPDVQKFWQSPVNTVETHFY  115

Query  419  P------YSVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            P      + V++RFHY PF    Q YP+EFQFQ+FQYFVVIDFEAT
Sbjct  116  PMNREYAFPVENRFHYLPFRMFAQGYPHEFQFQEFQYFVVIDFEAT  161



>ref|XP_010904685.1| PREDICTED: cell death-related nuclease 4-like [Elaeis guineensis]
Length=427

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 79/158 (50%), Gaps = 17/158 (11%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            MI  E+K+TMQ   EA   CL+   +  + H  G A + FPE  +     P G     + 
Sbjct  1    MIKRENKETMQGRIEASSGCLRTKAFCLNSHECGNAFERFPEPKKEMNIDPGG-----TM  55

Query  275  SSDQPIDSSKESPKKPVQQHAS----GSWSAFYPGSNNMRMCAVSAFEAQFYP------Y  424
             S  P  S +ES   P Q ++       W  F+P   N     V+  E  FYP      +
Sbjct  56   ESGNP--SKRESSAPPNQAYSRPCYQQDWPNFHPDVQNFWQSPVNIVETHFYPMNREYAF  113

Query  425  SVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             V+++FHY PF      YP+EFQFQ+FQYFVVIDFEAT
Sbjct  114  PVENKFHYPPFRMFAHGYPHEFQFQEFQYFVVIDFEAT  151



>ref|XP_008786829.1| PREDICTED: uncharacterized protein LOC103705029 isoform X2 [Phoenix 
dactylifera]
Length=429

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 71/145 (49%), Gaps = 16/145 (11%)
 Frame = +2

Query  137  EAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQPIDSSKESP-  313
            EA   CL+   +  H+H +G + K FPE  +   + P G     +  S  P  S   +P 
Sbjct  13   EASSGCLRTKAFYYHLHESGNSFKRFPEPKKEMNTNPGG-----TVESGNPSKSESSAPP  67

Query  314  ----KKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDSRFHYGPFNT  463
                 +P  Q    +W   +P         V+  E  FYP      + V++RFHY PF  
Sbjct  68   NQAYSRPFYQQDLYTWPNLHPDVQKFWQSPVNTVETHFYPMNREYAFPVENRFHYLPFRM  127

Query  464  IPQRYPYEFQFQDFQYFVVIDFEAT  538
              Q YP+EFQFQ+FQYFVVIDFEAT
Sbjct  128  FAQGYPHEFQFQEFQYFVVIDFEAT  152



>gb|KCW51075.1| hypothetical protein EUGRSUZ_J00681 [Eucalyptus grandis]
Length=273

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 76/155 (49%), Gaps = 8/155 (5%)
 Frame = +2

Query  98   IALEH-KDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            +ALE+ K  MQ  CEA   CLQN  +P ++HY G  I  F +  +G  +     N+D   
Sbjct  1    MALENNKGNMQKYCEASTGCLQNNVFPGNLHYQGNRIHGFFQRIDGITTHSGSGNMDPKD  60

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVD  433
              S        E  + P+      +W AF+P  +      + A EAQ YP      +  D
Sbjct  61   KFSQTSFTLPVEGYRSPMHHQDFETWPAFHPEFHKAHQNQLYALEAQHYPLNYEYGFPTD  120

Query  434  SRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            +RF Y PF    Q Y  + + Q+FQYFVVIDFEAT
Sbjct  121  NRFQYVPFRMSSQSYLPDARSQEFQYFVVIDFEAT  155



>ref|XP_004511053.1| PREDICTED: 3'-5' exoribonuclease 1-like [Cicer arietinum]
Length=422

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 85/155 (55%), Gaps = 7/155 (5%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQ-HMHYNGAAIKNFPEFNEGTY----SQPVGDN  259
            M+A E+    +++CEA + CLQ  G P      +G++++   EFN+  +    + P G+ 
Sbjct  1    MMAHENSGNRKISCEASLTCLQGKGPPPFSFQCDGSSMEGLMEFNKELHNDPGTHPAGNV  60

Query  260  IDCSFS-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDS  436
             +       + ++ S E   KP   H   +W+A +   + ++ C ++AFE  FYPY V++
Sbjct  61   AEPKHRLGGEFLEPSNEFHSKPTYHHDYSAWTACHFNPHKLQQCQMNAFENHFYPYPVEN  120

Query  437  RFHYGPFNTIPQRYPYEFQF-QDFQYFVVIDFEAT  538
            +  Y P + + Q +  E +  Q+FQYFVVIDFEAT
Sbjct  121  QLQYVPISMVSQGHSREREHNQEFQYFVVIDFEAT  155



>ref|XP_010031708.1| PREDICTED: 3'-5' exoribonuclease 1-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW51074.1| hypothetical protein EUGRSUZ_J00681 [Eucalyptus grandis]
Length=432

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 76/155 (49%), Gaps = 8/155 (5%)
 Frame = +2

Query  98   IALEH-KDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            +ALE+ K  MQ  CEA   CLQN  +P ++HY G  I  F +  +G  +     N+D   
Sbjct  1    MALENNKGNMQKYCEASTGCLQNNVFPGNLHYQGNRIHGFFQRIDGITTHSGSGNMDPKD  60

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVD  433
              S        E  + P+      +W AF+P  +      + A EAQ YP      +  D
Sbjct  61   KFSQTSFTLPVEGYRSPMHHQDFETWPAFHPEFHKAHQNQLYALEAQHYPLNYEYGFPTD  120

Query  434  SRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            +RF Y PF    Q Y  + + Q+FQYFVVIDFEAT
Sbjct  121  NRFQYVPFRMSSQSYLPDARSQEFQYFVVIDFEAT  155



>ref|XP_010031707.1| PREDICTED: 3'-5' exoribonuclease 1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW51073.1| hypothetical protein EUGRSUZ_J00681 [Eucalyptus grandis]
Length=433

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 75/156 (48%), Gaps = 9/156 (6%)
 Frame = +2

Query  98   IALEHKDT--MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCS  271
            +ALE+     MQ  CEA   CLQN  +P ++HY G  I  F +  +G  +     N+D  
Sbjct  1    MALENNKAGNMQKYCEASTGCLQNNVFPGNLHYQGNRIHGFFQRIDGITTHSGSGNMDPK  60

Query  272  FS-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSV  430
               S        E  + P+      +W AF+P  +      + A EAQ YP      +  
Sbjct  61   DKFSQTSFTLPVEGYRSPMHHQDFETWPAFHPEFHKAHQNQLYALEAQHYPLNYEYGFPT  120

Query  431  DSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            D+RF Y PF    Q Y  + + Q+FQYFVVIDFEAT
Sbjct  121  DNRFQYVPFRMSSQSYLPDARSQEFQYFVVIDFEAT  156



>ref|XP_010520080.1| PREDICTED: ERI1 exoribonuclease 3-like [Tarenaya hassleriana]
Length=383

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 70/148 (47%), Gaps = 35/148 (24%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M ALE+K T+Q + E+  +C    G+ Q++  N          N  T +  + D + CS 
Sbjct  1    MAALENKVTLQRSSESSYKCFPPHGFHQNIQSN---------INVATVASELKDEL-CSH  50

Query  275  SSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGP  454
                                      AFYP    M+   + A+  Q++P +V+ R  Y P
Sbjct  51   P-------------------------AFYPEPPTMQHYQLDAYGNQYFPVTVEPRLQYAP  85

Query  455  FNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            +N   Q YPY FQ+QDFQYFVVIDFEAT
Sbjct  86   YNVCTQVYPYNFQYQDFQYFVVIDFEAT  113



>ref|XP_010651532.1| PREDICTED: uncharacterized protein LOC100263388 isoform X2 [Vitis 
vinifera]
 ref|XP_010651533.1| PREDICTED: uncharacterized protein LOC100263388 isoform X2 [Vitis 
vinifera]
Length=434

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 79/159 (50%), Gaps = 12/159 (8%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNI--DC  268
            M+ LEHK+ MQ   EA +RCLQ+  +P +  +N + ++  P   +  ++   G  I  DC
Sbjct  1    MMPLEHKEKMQKAWEASMRCLQSKAFPYNPQFNVSFVEGLPGVKDEVHTDCRGGIIEGDC  60

Query  269  SFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSV  430
            S SS + I    E    P+        S  +P             E+ FYP      + +
Sbjct  61   S-SSIESIAPPNEGYYGPMHLQDYYQRSTSHPYIQKAHHNQFHMVESHFYPMNHKSCFPM  119

Query  431  DSRFHYGPF---NTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            D++ HY PF     + Q +P +F FQ+FQYFVVIDFEAT
Sbjct  120  DNQPHYVPFLPLKMLSQSHPQDFHFQEFQYFVVIDFEAT  158



>gb|KHN32001.1| ERI1 exoribonuclease 2 [Glycine soja]
Length=378

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 64/114 (56%), Gaps = 4/114 (4%)
 Frame = +2

Query  203  IKNFPEFNEGTYSQPVGDNID--CSFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNN  376
            ++ F E      + P GD  D  C   S+  ++ S E   KP       +W+  +  S+ 
Sbjct  1    MEGFTELKNEPGTHPAGDVADPNCHLGSEF-LEPSNEFHTKPTYHQNYSTWTPCHFNSHK  59

Query  377  MRMCAVSAFEAQFYPYSVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            ++ C ++AFE+ +YPY V++   Y P N + Q YP E Q+Q+FQYFVVIDFEAT
Sbjct  60   VQQCQMNAFESHYYPYPVENPLQYVPINMVAQGYPRE-QYQEFQYFVVIDFEAT  112



>ref|XP_008672776.1| PREDICTED: uncharacterized protein LOC100280343 isoform X6 [Zea 
mays]
 tpg|DAA54203.1| TPA: histone mRNA exonuclease 1 [Zea mays]
Length=436

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 74/158 (47%), Gaps = 22/158 (14%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNI  262
            MI  E  + MQVN EAP+ CL+    P    YN       ++ FPE NE        + I
Sbjct  1    MIDRERAEEMQVNNEAPLGCLK----PNISQYNSPEQIGGVEGFPENNEKRNDIVAAEKI  56

Query  263  DCSFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------Y  424
              +        +  +   +P+ +    +W   Y     +R      F+ QFY       +
Sbjct  57   WEA--------TPNQGLSRPIYRQEFYAWPYIYSDYQIVRQPLPYGFDNQFYQINRDHGF  108

Query  425  SVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             +++R  Y PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  109  PIENRVQYLPFKMLPQGHPHDAQLQEFQYFVVIDFEAT  146



>ref|NP_001266573.1| histone mRNA exonuclease 1 [Zea mays]
 gb|ACG36494.1| histone mRNA exonuclease 1 [Zea mays]
Length=437

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 74/158 (47%), Gaps = 22/158 (14%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNI  262
            MI  E  + MQVN EAP+ CL+    P    YN       ++ FPE NE        + I
Sbjct  1    MIDRERAEEMQVNNEAPLGCLK----PNISQYNSPEQIGGVEGFPENNEKRNDIVAAEKI  56

Query  263  DCSFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------Y  424
              +        +  +   +P+ +    +W   Y     +R      F+ QFY       +
Sbjct  57   WEA--------TPNQGLSRPIYRQEFYAWPYIYSDYQIVRQPLPYGFDNQFYQINRDHGF  108

Query  425  SVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             +++R  Y PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  109  PIENRVQYLPFKMLPQGHPHDAQLQEFQYFVVIDFEAT  146



>ref|XP_008672771.1| PREDICTED: uncharacterized protein LOC100280343 isoform X3 [Zea 
mays]
Length=446

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 74/158 (47%), Gaps = 22/158 (14%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNI  262
            MI  E  + MQVN EAP+ CL+    P    YN       ++ FPE NE        + I
Sbjct  1    MIDRERAEEMQVNNEAPLGCLK----PNISQYNSPEQIGGVEGFPENNEKRNDIVAAEKI  56

Query  263  DCSFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------Y  424
              +        +  +   +P+ +    +W   Y     +R      F+ QFY       +
Sbjct  57   WEA--------TPNQGLSRPIYRQEFYAWPYIYSDYQIVRQPLPYGFDNQFYQINRDHGF  108

Query  425  SVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             +++R  Y PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  109  PIENRVQYLPFKMLPQGHPHDAQLQEFQYFVVIDFEAT  146



>ref|XP_002457669.1| hypothetical protein SORBIDRAFT_03g011390 [Sorghum bicolor]
 gb|EES02789.1| hypothetical protein SORBIDRAFT_03g011390 [Sorghum bicolor]
Length=424

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 74/158 (47%), Gaps = 20/158 (13%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNI  262
            MI  E  + MQVN EAP+ CL+    P    YN       ++ FPE NE        + I
Sbjct  1    MIDRERAEEMQVNNEAPLVCLK----PNISQYNSPEQRGGVEGFPENNEKRNDIVAAEKI  56

Query  263  DCSFSSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------Y  424
                    PI +   S  +P  +    +W   +     +R      F+ QFY       +
Sbjct  57   ----WEASPIPNQGLS--RPFYRQEFYAWPYIHSDYQMVRQPLPYGFDNQFYQINRDHGF  110

Query  425  SVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             +++R  Y PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  111  PIENRVQYLPFKMLPQGHPHDAQLQEFQYFVVIDFEAT  148



>ref|XP_004967671.1| PREDICTED: uncharacterized protein LOC101770171 isoform X1 [Setaria 
italica]
 ref|XP_004967672.1| PREDICTED: uncharacterized protein LOC101770171 isoform X2 [Setaria 
italica]
Length=420

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 74/154 (48%), Gaps = 18/154 (12%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            MI  E  + MQVN EAP+ CL+    P      G  I+ FPE NE        + +    
Sbjct  1    MIDRERAEEMQVNNEAPLGCLK----PNIEQRGG--IEGFPENNEKRNDVVAVEKV----  50

Query  275  SSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDS  436
                PI +   S  +P  +    +W   Y     +R      F++QFY       + +++
Sbjct  51   WEASPIPTQVLS--RPFYRQEFYAWPYIYSDYQMVRQPLPYGFDSQFYQVNRDHGFPIEN  108

Query  437  RFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            R  Y PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  109  RVQYLPFKMLPQGHPHDAQLQEFQYFVVIDFEAT  142



>tpg|DAA54202.1| TPA: hypothetical protein ZEAMMB73_728544 [Zea mays]
Length=433

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 22/151 (15%)
 Frame = +2

Query  116  DTMQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNIDCSFSSD  283
            + MQVN EAP+ CL+    P    YN       ++ FPE NE        + I  +    
Sbjct  5    EEMQVNNEAPLGCLK----PNISQYNSPEQIGGVEGFPENNEKRNDIVAAEKIWEA----  56

Query  284  QPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDSRFH  445
                +  +   +P+ +    +W   Y     +R      F+ QFY       + +++R  
Sbjct  57   ----TPNQGLSRPIYRQEFYAWPYIYSDYQIVRQPLPYGFDNQFYQINRDHGFPIENRVQ  112

Query  446  YGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            Y PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  113  YLPFKMLPQGHPHDAQLQEFQYFVVIDFEAT  143



>ref|XP_008672769.1| PREDICTED: uncharacterized protein LOC100280343 isoform X1 [Zea 
mays]
Length=454

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 22/151 (15%)
 Frame = +2

Query  116  DTMQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNIDCSFSSD  283
            + MQVN EAP+ CL+    P    YN       ++ FPE NE        + I  +    
Sbjct  16   EEMQVNNEAPLGCLK----PNISQYNSPEQIGGVEGFPENNEKRNDIVAAEKIWEA----  67

Query  284  QPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDSRFH  445
                +  +   +P+ +    +W   Y     +R      F+ QFY       + +++R  
Sbjct  68   ----TPNQGLSRPIYRQEFYAWPYIYSDYQIVRQPLPYGFDNQFYQINRDHGFPIENRVQ  123

Query  446  YGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            Y PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  124  YLPFKMLPQGHPHDAQLQEFQYFVVIDFEAT  154



>ref|XP_008672772.1| PREDICTED: uncharacterized protein LOC100280343 isoform X4 [Zea 
mays]
Length=444

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 22/151 (15%)
 Frame = +2

Query  116  DTMQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNIDCSFSSD  283
            + MQVN EAP+ CL+    P    YN       ++ FPE NE        + I  +    
Sbjct  16   EEMQVNNEAPLGCLK----PNISQYNSPEQIGGVEGFPENNEKRNDIVAAEKIWEA----  67

Query  284  QPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDSRFH  445
                +  +   +P+ +    +W   Y     +R      F+ QFY       + +++R  
Sbjct  68   ----TPNQGLSRPIYRQEFYAWPYIYSDYQIVRQPLPYGFDNQFYQINRDHGFPIENRVQ  123

Query  446  YGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            Y PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  124  YLPFKMLPQGHPHDAQLQEFQYFVVIDFEAT  154



>ref|XP_008672770.1| PREDICTED: uncharacterized protein LOC100280343 isoform X2 [Zea 
mays]
Length=449

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 22/151 (15%)
 Frame = +2

Query  116  DTMQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNIDCSFSSD  283
            + MQVN EAP+ CL+    P    YN       ++ FPE NE        + I  +    
Sbjct  11   EEMQVNNEAPLGCLK----PNISQYNSPEQIGGVEGFPENNEKRNDIVAAEKIWEA----  62

Query  284  QPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDSRFH  445
                +  +   +P+ +    +W   Y     +R      F+ QFY       + +++R  
Sbjct  63   ----TPNQGLSRPIYRQEFYAWPYIYSDYQIVRQPLPYGFDNQFYQINRDHGFPIENRVQ  118

Query  446  YGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            Y PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  119  YLPFKMLPQGHPHDAQLQEFQYFVVIDFEAT  149



>ref|NP_001146741.1| uncharacterized protein LOC100280343 [Zea mays]
 gb|ACL54659.1| unknown [Zea mays]
Length=427

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 70/149 (47%), Gaps = 22/149 (15%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNIDCSFSSDQP  289
            MQVN EAP+ CL+    P    YN       ++ FPE NE        + I  +      
Sbjct  1    MQVNNEAPLGCLK----PNISQYNSPEQIGGVEGFPENNEKRNDIVAAEKIWEA------  50

Query  290  IDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDSRFHYG  451
              +  +   +P+ +    +W   Y     +R      F+ QFY       + +++R  Y 
Sbjct  51   --TPNQGLSRPIYRQEFYAWPYIYSDYQIVRQPLPYGFDNQFYQINRDHGFPIENRVQYL  108

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  109  PFKMLPQGHPHDAQLQEFQYFVVIDFEAT  137



>ref|XP_008672773.1| PREDICTED: uncharacterized protein LOC100280343 isoform X5 [Zea 
mays]
 ref|XP_008672774.1| PREDICTED: uncharacterized protein LOC100280343 isoform X5 [Zea 
mays]
 ref|XP_008672775.1| PREDICTED: uncharacterized protein LOC100280343 isoform X5 [Zea 
mays]
 ref|XP_008672777.1| PREDICTED: uncharacterized protein LOC100280343 isoform X5 [Zea 
mays]
Length=437

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 70/149 (47%), Gaps = 22/149 (15%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNG----AAIKNFPEFNEGTYSQPVGDNIDCSFSSDQP  289
            MQVN EAP+ CL+    P    YN       ++ FPE NE        + I  +      
Sbjct  1    MQVNNEAPLGCLK----PNISQYNSPEQIGGVEGFPENNEKRNDIVAAEKIWEA------  50

Query  290  IDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDSRFHYG  451
              +  +   +P+ +    +W   Y     +R      F+ QFY       + +++R  Y 
Sbjct  51   --TPNQGLSRPIYRQEFYAWPYIYSDYQIVRQPLPYGFDNQFYQINRDHGFPIENRVQYL  108

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            PF  +PQ +P++ Q Q+FQYFVVIDFEAT
Sbjct  109  PFKMLPQGHPHDAQLQEFQYFVVIDFEAT  137



>emb|CBI24268.3| unnamed protein product [Vitis vinifera]
Length=431

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 12/155 (8%)
 Frame = +2

Query  107  EHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNI--DCSFSS  280
            ++ + MQ   EA +RCLQ+  +P +  +N + ++  P   +  ++   G  I  DCS SS
Sbjct  23   DNSEKMQKAWEASMRCLQSKAFPYNPQFNVSFVEGLPGVKDEVHTDCRGGIIEGDCS-SS  81

Query  281  DQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDSRF  442
             + I    E    P+        S  +P             E+ FYP      + +D++ 
Sbjct  82   IESIAPPNEGYYGPMHLQDYYQRSTSHPYIQKAHHNQFHMVESHFYPMNHKSCFPMDNQP  141

Query  443  HYGPF---NTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            HY PF     + Q +P +F FQ+FQYFVVIDFEAT
Sbjct  142  HYVPFLPLKMLSQSHPQDFHFQEFQYFVVIDFEAT  176



>ref|XP_002262814.2| PREDICTED: uncharacterized protein LOC100263388 isoform X1 [Vitis 
vinifera]
 ref|XP_010651531.1| PREDICTED: uncharacterized protein LOC100263388 isoform X1 [Vitis 
vinifera]
Length=452

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 12/155 (8%)
 Frame = +2

Query  107  EHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNI--DCSFSS  280
            ++ + MQ   EA +RCLQ+  +P +  +N + ++  P   +  ++   G  I  DCS SS
Sbjct  23   DNSEKMQKAWEASMRCLQSKAFPYNPQFNVSFVEGLPGVKDEVHTDCRGGIIEGDCS-SS  81

Query  281  DQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP------YSVDSRF  442
             + I    E    P+        S  +P             E+ FYP      + +D++ 
Sbjct  82   IESIAPPNEGYYGPMHLQDYYQRSTSHPYIQKAHHNQFHMVESHFYPMNHKSCFPMDNQP  141

Query  443  HYGPF---NTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            HY PF     + Q +P +F FQ+FQYFVVIDFEAT
Sbjct  142  HYVPFLPLKMLSQSHPQDFHFQEFQYFVVIDFEAT  176



>ref|XP_006432414.1| hypothetical protein CICLE_v10001735mg [Citrus clementina]
 gb|ESR45654.1| hypothetical protein CICLE_v10001735mg [Citrus clementina]
Length=302

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 62/149 (42%), Gaps = 43/149 (29%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ALEH + MQ  CEA ++ LQ+ G   ++ YN     N  E  + T   P GD  +   
Sbjct  1    MMALEHNEAMQRMCEASLKGLQSRGIRCNLQYNNG---NSVELKDDTIVHPGGDAGESIH  57

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG  451
              S + ++ S E    P  QH  GSWS FYP S                           
Sbjct  58   QLSSEFVEYSNEFYNNPTYQHDFGSWSTFYPDSQ--------------------------  91

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
                         + Q+FQYFVVIDFEAT
Sbjct  92   -------------KPQEFQYFVVIDFEAT  107



>ref|XP_010099809.1| ERI1 exoribonuclease 2 [Morus notabilis]
 gb|EXB80477.1| ERI1 exoribonuclease 2 [Morus notabilis]
Length=429

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 70/155 (45%), Gaps = 7/155 (5%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            M+ L+ ++T Q   +  + CL     P ++  NG   +   +  + T S  VG   +   
Sbjct  1    MMTLDIQETKQKYHDTSVGCLHGEAIPPNLQDNGKLGEGSLKPIDETGSHFVGGITEGGS  60

Query  275  SSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP-----YSV--D  433
             +        E+  +P  Q     WSA++P +   +       E   YP     Y +  D
Sbjct  61   LNTTYTIPPNEAYHRPFYQQGYHVWSAYHPENQKAQQYQFYPLENHVYPVNHHEYCIPDD  120

Query  434  SRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            ++F Y P   + Q Y  +F FQ+FQYFVVIDFEAT
Sbjct  121  NKFQYLPLWKLSQMYQSQFNFQEFQYFVVIDFEAT  155



>ref|XP_003567334.1| PREDICTED: ERI1 exoribonuclease 2-like [Brachypodium distachyon]
Length=425

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 75/161 (47%), Gaps = 27/161 (17%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYN----GAAIKNFPEFNEGTYSQPVGDNI  262
            MI  E  + MQVN EA   CL+    P    YN       I+ FPE NE           
Sbjct  1    MIDHERAEEMQVNNEALPGCLK----PNISQYNPQEHRGVIEGFPENNEKK---------  47

Query  263  DCSFSSDQPIDSS---KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP----  421
            + S ++D+  ++S    +   +P+ +    +W   +      R      F+ QFY     
Sbjct  48   NNSIATDKVWEASPLPNQGFSRPLYRQEFYAWPHIHSEYQMPRQPQPYGFDNQFYQINRD  107

Query  422  --YSVDSRFHYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
              +SV+ R  + P   +PQ YP++ Q Q+FQYFVVIDFEAT
Sbjct  108  HNFSVEKRVQF-PLKMLPQGYPHDAQLQEFQYFVVIDFEAT  147



>emb|CDM82920.1| unnamed protein product [Triticum aestivum]
Length=415

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 69/147 (47%), Gaps = 17/147 (12%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQPIDSS  301
            MQVN EAP  CL+      +   +   I+ FPE NE           + SF++D+   +S
Sbjct  1    MQVNNEAPPGCLKPNISQYNPQEHRGGIEGFPENNEKK---------NDSFAADKVWGAS  51

Query  302  ---KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG-----PF  457
                +   +P  +    +W   Y     +R      F+ QFY  + D+ F        P 
Sbjct  52   PLPNQGFNRPFYRQEFYAWPHVYSDYQILRQPQPYGFDNQFYQINRDTCFPIERRVQFPL  111

Query  458  NTIPQRYPYEFQFQDFQYFVVIDFEAT  538
              +PQ YP++ Q Q+FQYFVVIDFEAT
Sbjct  112  KMLPQGYPHDAQLQEFQYFVVIDFEAT  138



>ref|XP_009412196.1| PREDICTED: ERI1 exoribonuclease 2-like [Musa acuminata subsp. 
malaccensis]
Length=432

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 75/156 (48%), Gaps = 9/156 (6%)
 Frame = +2

Query  95   MIALEHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            MI    +D MQ N EA   C ++     +   +G  ++ FPE  +G    PV D    + 
Sbjct  1    MIDPAAQDKMQGNREASPGCPKDNASHSNSQESGNVVQRFPELKDGK-DLPVCDFTKANN  59

Query  275  S-SDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFE------AQFYPYSVD  433
            S S +P     +    P  +  + +    +P    +R   ++AFE       + YP+ V+
Sbjct  60   SMSWEPYAILNQGYSGPFYRQETLALPFPHPDFLMLRQVQLNAFENNVYPVTRDYPFPVE  119

Query  434  SRFHYGP-FNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            + F Y P      Q +P++FQ Q+FQYFVVIDFEAT
Sbjct  120  NGFSYMPPVKMFSQVHPHKFQIQEFQYFVVIDFEAT  155



>gb|EMT10995.1| Exonuclease domain-containing protein 1 [Aegilops tauschii]
Length=415

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 64/144 (44%), Gaps = 11/144 (8%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQPIDSS  301
            MQVN EAP  CL+      +   +   I+ FPE NE        D +        P+ + 
Sbjct  1    MQVNNEAPPGCLKPNISQYNPQEHRGGIEGFPENNEKKNDSIAADKV----WGASPLPNQ  56

Query  302  KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYG-----PFNTI  466
              S  +P  +    +W   Y     +R       + QFY  + D+ F        P   +
Sbjct  57   GFS--RPFYRQEFYAWPHVYSDYQILRQPQPYGLDNQFYQINRDTCFPIERRVQFPLKML  114

Query  467  PQRYPYEFQFQDFQYFVVIDFEAT  538
            PQ YP++ Q Q+FQYFVVIDFEAT
Sbjct  115  PQGYPHDAQLQEFQYFVVIDFEAT  138



>ref|XP_010102112.1| ERI1 exoribonuclease 2 [Morus notabilis]
 gb|EXB92331.1| ERI1 exoribonuclease 2 [Morus notabilis]
Length=446

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 66/149 (44%), Gaps = 7/149 (5%)
 Frame = +2

Query  113  KDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQPI  292
            ++T Q   +  + CL     P ++  NG   +   +  + T S  VG   +    +    
Sbjct  24   EETKQKYHDTSVGCLHGEAIPPNLQDNGKLGEGSLKPIDETGSHFVGGITEGGSLNTTYT  83

Query  293  DSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP-----YSV--DSRFHYG  451
                E+  +P  Q     WSA++P +   +       E   YP     Y +  D++F Y 
Sbjct  84   IPPNEAYHRPFYQQGYHVWSAYHPENQKAQQYQFYPLENHVYPVNHHEYCIPDDNKFQYL  143

Query  452  PFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            P   + Q Y  +F FQ+FQYFVVIDFEAT
Sbjct  144  PLWKLSQMYQSQFNFQEFQYFVVIDFEAT  172



>ref|XP_010673774.1| PREDICTED: uncharacterized protein LOC104890103 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 66/153 (43%), Gaps = 12/153 (8%)
 Frame = +2

Query  107  EHKDTMQVNCEAPIRCLQNT----GYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSF  274
            E+++TMQ   EA   C Q      G P    ++G  ++   ++  G     V    D + 
Sbjct  4    ENRETMQKGLEASYGCFQAKSLLYGPPCPRSFSGQTLEL--KYTNGAKQANVNSESDGAV  61

Query  275  SSDQPIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP--YSVDSRFHY  448
            S D+ +    E   +P  Q     WS   P S           +  FYP  +    R H+
Sbjct  62   SRDK-LSVPSEYCGRPALQENYYVWSTLLPNSMKDVHSQCYPLDGSFYPPNHGHYLRTHW  120

Query  449  ---GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
                P   +PQ Y  ++ FQDFQYFVVIDFEAT
Sbjct  121  LPQVPLQMVPQSYSPDYVFQDFQYFVVIDFEAT  153



>ref|XP_010067708.1| PREDICTED: 3'-5' exoribonuclease 1-like [Eucalyptus grandis]
 ref|XP_010067709.1| PREDICTED: 3'-5' exoribonuclease 1-like [Eucalyptus grandis]
 gb|KCW65879.1| hypothetical protein EUGRSUZ_G03212 [Eucalyptus grandis]
 gb|KCW65880.1| hypothetical protein EUGRSUZ_G03212 [Eucalyptus grandis]
Length=399

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 66/144 (46%), Gaps = 8/144 (6%)
 Frame = +2

Query  107  EHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQ  286
            + ++  + N  A  R   + G   ++     A+    +  +GT  Q  GD      S   
Sbjct  4    DRREDTRRNFAALSRSYSSNGILYNLQDKSNALSGLSKLKDGTSGQSDGDVAKKVLSI--  61

Query  287  PIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTI  466
               S  E P  P      G W   YP S+ M+   +++FE QF+ +   + FH    + +
Sbjct  62   ---SRGEHPNGPNYPLYYG-WR--YPYSHQMQPYQMNSFEGQFFSFHGGNGFHGYRPDML  115

Query  467  PQRYPYEFQFQDFQYFVVIDFEAT  538
             Q Y  E QFQDFQYFVVIDFEAT
Sbjct  116  SQGYLPECQFQDFQYFVVIDFEAT  139



>gb|KCW65878.1| hypothetical protein EUGRSUZ_G03212 [Eucalyptus grandis]
Length=404

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 66/144 (46%), Gaps = 8/144 (6%)
 Frame = +2

Query  107  EHKDTMQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQ  286
            + ++  + N  A  R   + G   ++     A+    +  +GT  Q  GD      S   
Sbjct  4    DRREDTRRNFAALSRSYSSNGILYNLQDKSNALSGLSKLKDGTSGQSDGDVAKKVLSI--  61

Query  287  PIDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTI  466
               S  E P  P      G W   YP S+ M+   +++FE QF+ +   + FH    + +
Sbjct  62   ---SRGEHPNGPNYPLYYG-WR--YPYSHQMQPYQMNSFEGQFFSFHGGNGFHGYRPDML  115

Query  467  PQRYPYEFQFQDFQYFVVIDFEAT  538
             Q Y  E QFQDFQYFVVIDFEAT
Sbjct  116  SQGYLPECQFQDFQYFVVIDFEAT  139



>gb|EEC70411.1| hypothetical protein OsI_01406 [Oryza sativa Indica Group]
Length=544

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 25/152 (16%)
 Frame = +2

Query  116  DTMQVNCEAPIRCLQNTGY--PQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQP  289
            + MQVN EAP+ CL+      PQ    NG     FPE +E           + S ++++ 
Sbjct  132  EEMQVNKEAPLGCLKPISQYNPQEQRSNG-----FPENSEKK---------NDSIATERV  177

Query  290  IDSS---KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFY------PYSVDSRF  442
            +++S    +   +PVQ+    ++   Y              + QFY       + ++SR 
Sbjct  178  LEASPLPNQGVFRPVQRTEYYAYPFIYADYQMPGQPQPYNLDNQFYQINRDHSFPIESRV  237

Query  443  HYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             Y PF   PQ YP + Q Q+FQYFVVIDFEAT
Sbjct  238  QYLPFKMPPQGYPPDAQLQEFQYFVVIDFEAT  269



>ref|XP_006832854.1| hypothetical protein AMTR_s00095p00056830 [Amborella trichopoda]
 gb|ERM98132.1| hypothetical protein AMTR_s00095p00056830 [Amborella trichopoda]
Length=441

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 65/151 (43%), Gaps = 17/151 (11%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQPIDSS  301
            MQ N E     L +  Y   +  +G  ++  P   +      +  N +     D  + + 
Sbjct  1    MQRNHEESFIFLHSRPYDYKLQVSGNGVEGCPGLKD-----EINVNSNRVLEFDHSLYTG  55

Query  302  KESP-----KKPVQQHASGSWSAFYPGSNNMRMCAVSAFE-------AQFYPYSVDSRFH  445
              SP      +P+ Q    +W+A       ++     A +        + Y Y V+SRFH
Sbjct  56   TYSPYSEGYHRPMYQQDFSTWTALNYDFQKVQQNQWRAIQEGHYYQMGREYSYPVESRFH  115

Query  446  YGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            Y P+    Q +  E QFQ+FQYFVVIDFEAT
Sbjct  116  YLPYKMHSQCFRPEVQFQEFQYFVVIDFEAT  146



>ref|XP_006644066.1| PREDICTED: ERI1 exoribonuclease 2-like [Oryza brachyantha]
Length=422

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 70/155 (45%), Gaps = 25/155 (16%)
 Frame = +2

Query  107  EHKDTMQVNCEAPIRCLQNTGY--PQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSS  280
            E  + MQVN EAP  CL+      PQ    NG        F+E +      +  + S + 
Sbjct  6    ERAEEMQVNNEAPPGCLKPISQYNPQEQRING--------FSENS------EKKNDSIAR  51

Query  281  DQPIDSS---KESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRF---  442
            ++ +++S    +   +P  +    +    Y      R      F+ QFY  + D  F   
Sbjct  52   EKVLEASPLPNQGFIRPFHRPDYYAGPFIYADYQIQRQPQPYNFDNQFYQINRDRIFPFE  111

Query  443  ---HYGPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
                Y PFN +PQ YP + Q Q+FQYFVVIDFEAT
Sbjct  112  NKVQYLPFNMLPQGYPPDAQLQEFQYFVVIDFEAT  146



>ref|NP_001042752.1| Os01g0280000 [Oryza sativa Japonica Group]
 dbj|BAD81090.1| putative 3' exoribonuclease [Oryza sativa Japonica Group]
 dbj|BAD81586.1| putative 3' exoribonuclease [Oryza sativa Japonica Group]
 dbj|BAF04666.1| Os01g0280000 [Oryza sativa Japonica Group]
 dbj|BAG96033.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54338.1| hypothetical protein OsJ_01314 [Oryza sativa Japonica Group]
Length=411

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (47%), Gaps = 25/150 (17%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGY--PQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQPID  295
            MQVN EAP+ CL+       Q    NG     FPE +E           + S ++++ ++
Sbjct  1    MQVNKEAPLGCLKPISQYNLQEQRSNG-----FPENSEKK---------NDSIATERVLE  46

Query  296  SSKESPK---KPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFY------PYSVDSRFHY  448
            +S    +   +PVQ+    ++   Y              + QFY       + ++SR  Y
Sbjct  47   ASPLPNQGFFRPVQRTEYYAYPFIYADYQMPGQPQPYNLDNQFYQINRDHSFPIESRVQY  106

Query  449  GPFNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
             PF   PQ YP + Q Q+FQYFVVIDFEAT
Sbjct  107  LPFKMPPQGYPPDAQLQEFQYFVVIDFEAT  136



>ref|XP_010673775.1| PREDICTED: uncharacterized protein LOC104890103 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010673776.1| PREDICTED: uncharacterized protein LOC104890103 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=437

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 61/148 (41%), Gaps = 12/148 (8%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNT----GYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFSSDQP  289
            MQ   EA   C Q      G P    ++G  ++   ++  G     V    D + S D+ 
Sbjct  1    MQKGLEASYGCFQAKSLLYGPPCPRSFSGQTLE--LKYTNGAKQANVNSESDGAVSRDK-  57

Query  290  IDSSKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYP--YSVDSRFHY---GP  454
            +    E   +P  Q     WS   P S           +  FYP  +    R H+    P
Sbjct  58   LSVPSEYCGRPALQENYYVWSTLLPNSMKDVHSQCYPLDGSFYPPNHGHYLRTHWLPQVP  117

Query  455  FNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
               +PQ Y  ++ FQDFQYFVVIDFEAT
Sbjct  118  LQMVPQSYSPDYVFQDFQYFVVIDFEAT  145



>gb|KDO44617.1| hypothetical protein CISIN_1g0150172mg, partial [Citrus sinensis]
Length=367

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 55/140 (39%), Gaps = 43/140 (31%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFS-SDQPIDS  298
            MQ  CEA ++ LQ+ G   ++ YN     N  E  + T   P GD  +     S + ++ 
Sbjct  2    MQRMCEASLKGLQSRGIRCNLQYNNG---NSVELKDDTIVHPGGDAGESIHQLSSEFVEY  58

Query  299  SKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTIPQRY  478
            S E    P  QH  GSWS FYP S                                    
Sbjct  59   SNEFYNNPTYQHDFGSWSTFYPDSQ-----------------------------------  83

Query  479  PYEFQFQDFQYFVVIDFEAT  538
                + Q+FQYFVVIDFEAT
Sbjct  84   ----KPQEFQYFVVIDFEAT  99



>gb|KDO44619.1| hypothetical protein CISIN_1g0150172mg, partial [Citrus sinensis]
Length=366

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 55/140 (39%), Gaps = 43/140 (31%)
 Frame = +2

Query  122  MQVNCEAPIRCLQNTGYPQHMHYNGAAIKNFPEFNEGTYSQPVGDNIDCSFS-SDQPIDS  298
            MQ  CEA ++ LQ+ G   ++ YN     N  E  + T   P GD  +     S + ++ 
Sbjct  1    MQRMCEASLKGLQSRGIRCNLQYNNG---NSVELKDDTIVHPGGDAGESIHQLSSEFVEY  57

Query  299  SKESPKKPVQQHASGSWSAFYPGSNNMRMCAVSAFEAQFYPYSVDSRFHYGPFNTIPQRY  478
            S E    P  QH  GSWS FYP S                                    
Sbjct  58   SNEFYNNPTYQHDFGSWSTFYPDSQ-----------------------------------  82

Query  479  PYEFQFQDFQYFVVIDFEAT  538
                + Q+FQYFVVIDFEAT
Sbjct  83   ----KPQEFQYFVVIDFEAT  98



>ref|XP_009419681.1| PREDICTED: uncharacterized protein LOC103999613 [Musa acuminata 
subsp. malaccensis]
Length=427

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +2

Query  392  VSAFEAQFYP-----YSVDSRFHYGP-FNTIPQRYPYEFQFQDFQYFVVIDFEAT  538
            ++AF++  YP     + V +RF Y P  N   Q +P ++Q Q+FQYFVVIDFEAT
Sbjct  96   LNAFDSNLYPINYYSFPVGNRFSYMPPVNMFSQSHPQKYQIQEFQYFVVIDFEAT  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645