BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001H02

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788755.1|  PREDICTED: cytochrome P450 76A2-like               124   2e-30   Nicotiana sylvestris
ref|XP_009589554.1|  PREDICTED: cytochrome P450 76A2-like               119   1e-28   Nicotiana tomentosiformis
ref|XP_006341182.1|  PREDICTED: cytochrome P450 76A2-like               119   2e-28   Solanum tuberosum [potatoes]
ref|XP_008241319.1|  PREDICTED: cytochrome P450 76A2-like               119   3e-28   Prunus mume [ume]
ref|XP_004246901.1|  PREDICTED: cytochrome P450 76A2-like               115   6e-27   Solanum lycopersicum
ref|XP_009757934.1|  PREDICTED: cytochrome P450 76A2-like               113   2e-26   Nicotiana sylvestris
ref|XP_009602679.1|  PREDICTED: cytochrome P450 76A2-like               112   5e-26   Nicotiana tomentosiformis
dbj|BAC53892.1|  cytochrome P450                                        112   8e-26   Petunia x hybrida [garden petunia]
ref|XP_011094547.1|  PREDICTED: cytochrome P450 76A2-like               106   8e-24   Sesamum indicum [beniseed]
emb|CDP15344.1|  unnamed protein product                                103   1e-23   Coffea canephora [robusta coffee]
ref|XP_009785657.1|  PREDICTED: cytochrome P450 76A1-like isoform X2    105   2e-23   Nicotiana sylvestris
ref|XP_009785656.1|  PREDICTED: cytochrome P450 76A1-like isoform X1    105   2e-23   Nicotiana sylvestris
ref|XP_006339107.1|  PREDICTED: cytochrome P450 76A2-like               105   2e-23   Solanum tuberosum [potatoes]
ref|XP_011100232.1|  PREDICTED: cytochrome P450 76A2-like               105   3e-23   Sesamum indicum [beniseed]
sp|P37122.1|C76A2_SOLME  RecName: Full=Cytochrome P450 76A2; AltN...    104   5e-23   Solanum melongena [aubergine]
ref|XP_006339109.1|  PREDICTED: cytochrome P450 76A2-like               101   7e-22   Solanum tuberosum [potatoes]
emb|CBI30226.3|  unnamed protein product                                102   9e-22   Vitis vinifera
gb|AGT03776.1|  CYP76 hydroxylase                                       100   1e-21   Withania somnifera [ashwagandha]
ref|XP_004249463.1|  PREDICTED: cytochrome P450 76A2-like               100   1e-21   Solanum lycopersicum
ref|XP_006339110.1|  PREDICTED: cytochrome P450 76A2-like               100   2e-21   
ref|XP_002277725.1|  PREDICTED: cytochrome P450 76A1                    100   2e-21   Vitis vinifera
emb|CAN77399.1|  hypothetical protein VITISV_015277                   99.8    3e-21   Vitis vinifera
ref|XP_004305369.1|  PREDICTED: cytochrome P450 76A2-like             98.2    9e-21   Fragaria vesca subsp. vesca
ref|XP_006339108.1|  PREDICTED: cytochrome P450 76A2-like             98.2    9e-21   Solanum tuberosum [potatoes]
ref|XP_007203742.1|  hypothetical protein PRUPE_ppa018268mg           98.2    9e-21   
gb|EYU29599.1|  hypothetical protein MIMGU_mgv1a026574mg              98.2    9e-21   Erythranthe guttata [common monkey flower]
ref|XP_004303043.1|  PREDICTED: cytochrome P450 76A2-like             97.8    1e-20   Fragaria vesca subsp. vesca
ref|XP_006430324.1|  hypothetical protein CICLE_v10013315mg           97.8    2e-20   Citrus clementina [clementine]
gb|AHX24365.1|  CYP76A26-like protein                                 96.3    4e-20   Cinchona calisaya [quinine]
ref|XP_009603940.1|  PREDICTED: cytochrome P450 76A2-like             96.3    5e-20   Nicotiana tomentosiformis
ref|XP_002309107.1|  hypothetical protein POPTR_0006s09580g           95.5    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010057042.1|  PREDICTED: cytochrome P450 76A2-like             95.1    1e-19   Eucalyptus grandis [rose gum]
ref|XP_007027589.1|  Cytochrome P450 76A2                             95.9    1e-19   
ref|XP_009774708.1|  PREDICTED: cytochrome P450 76A2-like             94.7    2e-19   Nicotiana sylvestris
ref|XP_006482364.1|  PREDICTED: cytochrome P450 76A2-like             94.7    2e-19   
ref|XP_008392600.1|  PREDICTED: cytochrome P450 76A2-like             94.0    3e-19   
gb|AJD25180.1|  cytochrome P450 CYP76A36                              93.6    4e-19   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011019179.1|  PREDICTED: cytochrome P450 76A2-like             93.6    4e-19   Populus euphratica
gb|KDO61008.1|  hypothetical protein CISIN_1g036305mg                 93.6    4e-19   Citrus sinensis [apfelsine]
ref|XP_006339111.1|  PREDICTED: cytochrome P450 76A2-like             93.2    5e-19   Solanum tuberosum [potatoes]
ref|XP_010112510.1|  Cytochrome P450 76A2                             93.2    7e-19   
gb|AIW00679.1|  flavonoid 3',5'-hydroxylase                           92.8    9e-19   Paeonia lactiflora [common garden peony]
ref|XP_010683910.1|  PREDICTED: cytochrome P450 76A2-like             92.0    1e-18   
ref|XP_008241318.1|  PREDICTED: cytochrome P450 76A2-like             92.0    2e-18   Prunus mume [ume]
ref|XP_009616474.1|  PREDICTED: cytochrome P450 76A1-like             92.0    2e-18   Nicotiana tomentosiformis
ref|XP_004249632.1|  PREDICTED: cytochrome P450 76A2-like             91.7    2e-18   Solanum lycopersicum
ref|XP_009350795.1|  PREDICTED: cytochrome P450 76A2-like             91.3    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_009334561.1|  PREDICTED: cytochrome P450 76A2-like             91.3    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_010056841.1|  PREDICTED: cytochrome P450 76A1-like             91.3    3e-18   Eucalyptus grandis [rose gum]
ref|XP_010037101.1|  PREDICTED: cytochrome P450 76A1-like             90.1    7e-18   Eucalyptus grandis [rose gum]
ref|XP_010037099.1|  PREDICTED: cytochrome P450 76A1-like             90.1    7e-18   Eucalyptus grandis [rose gum]
ref|XP_004249462.1|  PREDICTED: cytochrome P450 76A2-like             90.1    7e-18   Solanum lycopersicum
ref|XP_002277661.2|  PREDICTED: cytochrome P450 76A1-like             90.1    8e-18   Vitis vinifera
gb|KJB62266.1|  hypothetical protein B456_009G409000                  89.7    9e-18   Gossypium raimondii
ref|XP_007204461.1|  hypothetical protein PRUPE_ppa023213mg           89.4    1e-17   
gb|AHX24370.1|  CYP76A26                                              89.4    2e-17   Catharanthus roseus [chatas]
gb|AHK60833.1|  iridoid oxidase                                       89.4    2e-17   Catharanthus roseus [chatas]
emb|CBI30225.3|  unnamed protein product                              90.1    2e-17   Vitis vinifera
ref|XP_002277746.1|  PREDICTED: cytochrome P450 76A1                  89.0    2e-17   Vitis vinifera
gb|AHX24367.1|  CYP76A26-like protein                                 89.0    2e-17   Rauvolfia serpentina [devilpepper]
ref|XP_002528647.1|  cytochrome P450, putative                        88.6    2e-17   Ricinus communis
gb|KEH24104.1|  cytochrome P450 family protein                        89.0    2e-17   Medicago truncatula
emb|CDP15345.1|  unnamed protein product                              88.2    3e-17   Coffea canephora [robusta coffee]
gb|KDP20523.1|  hypothetical protein JCGZ_05069                       88.2    3e-17   Jatropha curcas
gb|AHX24369.1|  CYP76A26-like protein                                 88.2    3e-17   Vinca minor [common periwinkle]
gb|AHX24366.1|  CYP76A26-like protein                                 88.2    4e-17   Amsonia hubrichtii
emb|CBI30232.3|  unnamed protein product                              87.4    4e-17   Vitis vinifera
ref|XP_010057043.1|  PREDICTED: cytochrome P450 76A1-like             87.8    4e-17   Eucalyptus grandis [rose gum]
ref|XP_002283772.1|  PREDICTED: cytochrome P450 76A1                  87.4    6e-17   Vitis vinifera
emb|CAN76784.1|  hypothetical protein VITISV_028823                   87.4    6e-17   Vitis vinifera
ref|XP_002267565.2|  PREDICTED: cytochrome P450 76A2-like             87.4    7e-17   Vitis vinifera
ref|XP_006381328.1|  hypothetical protein POPTR_0006s11830g           85.5    8e-17   
gb|AHX24368.1|  CYP76A26-like protein                                 87.0    8e-17   Tabernaemontana elegans
ref|XP_004494132.1|  PREDICTED: cytochrome P450 76A2-like             87.0    9e-17   Cicer arietinum [garbanzo]
ref|XP_006341183.1|  PREDICTED: cytochrome P450 76A1-like             86.7    1e-16   Solanum tuberosum [potatoes]
gb|KDP27487.1|  hypothetical protein JCGZ_20022                       86.7    1e-16   Jatropha curcas
ref|XP_010036736.1|  PREDICTED: cytochrome P450 76A1-like             86.3    2e-16   Eucalyptus grandis [rose gum]
ref|XP_003520677.1|  PREDICTED: cytochrome P450 76A2-like             85.9    2e-16   Glycine max [soybeans]
ref|XP_002528645.1|  cytochrome P450, putative                        85.9    2e-16   Ricinus communis
ref|XP_002283777.2|  PREDICTED: cytochrome P450 76A1                  85.5    3e-16   Vitis vinifera
emb|CBI30229.3|  unnamed protein product                              85.5    3e-16   Vitis vinifera
ref|XP_002528653.1|  cytochrome P450, putative                        85.5    3e-16   Ricinus communis
gb|KCW84346.1|  hypothetical protein EUGRSUZ_B011962                  81.6    4e-16   Eucalyptus grandis [rose gum]
gb|KDP43097.1|  hypothetical protein JCGZ_27046                       84.7    5e-16   Jatropha curcas
gb|KCW84357.1|  hypothetical protein EUGRSUZ_B012102                  81.3    5e-16   Eucalyptus grandis [rose gum]
gb|KHN18720.1|  Cytochrome P450 76A2                                  84.7    6e-16   Glycine soja [wild soybean]
gb|KCW74002.1|  hypothetical protein EUGRSUZ_E02619                   84.3    8e-16   Eucalyptus grandis [rose gum]
ref|XP_010036151.1|  PREDICTED: cytochrome P450 76A1-like             84.0    1e-15   Eucalyptus grandis [rose gum]
gb|KCW48743.1|  hypothetical protein EUGRSUZ_K02382                   83.6    1e-15   Eucalyptus grandis [rose gum]
ref|XP_002528650.1|  cytochrome P450, putative                        83.6    1e-15   
gb|AHX24364.1|  CYP76A26-like protein                                 83.6    1e-15   Lonicera japonica [Japanese honeysuckle]
dbj|BAC53891.1|  cytochrome P450                                      82.8    3e-15   Petunia x hybrida [garden petunia]
ref|XP_010045880.1|  PREDICTED: cytochrome P450 76A1-like             82.4    3e-15   Eucalyptus grandis [rose gum]
ref|XP_002528654.1|  cytochrome P450, putative                        82.8    3e-15   
ref|XP_010036177.1|  PREDICTED: cytochrome P450 76A1-like             82.4    4e-15   Eucalyptus grandis [rose gum]
gb|KCW84356.1|  hypothetical protein EUGRSUZ_B01208                   81.6    5e-15   Eucalyptus grandis [rose gum]
gb|KDP24879.1|  hypothetical protein JCGZ_25132                       78.2    7e-15   Jatropha curcas
ref|XP_004246574.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  81.6    8e-15   Solanum lycopersicum
ref|XP_010036187.1|  PREDICTED: cytochrome P450 76A1-like             81.3    9e-15   Eucalyptus grandis [rose gum]
ref|XP_010036221.1|  PREDICTED: cytochrome P450 76A1-like             81.3    1e-14   
gb|AJD20226.1|  putative N-methylcoclaurine 3-hydroxylase             80.5    1e-14   Podophyllum peltatum
gb|KCW84354.1|  hypothetical protein EUGRSUZ_B01206                   80.5    2e-14   Eucalyptus grandis [rose gum]
ref|XP_010045881.1|  PREDICTED: cytochrome P450 76A1-like             79.7    3e-14   Eucalyptus grandis [rose gum]
ref|XP_002528649.1|  cytochrome P450, putative                        79.7    4e-14   
ref|XP_010036165.1|  PREDICTED: cytochrome P450 76A1-like             79.3    5e-14   Eucalyptus grandis [rose gum]
gb|KDP24880.1|  hypothetical protein JCGZ_25133                       78.6    7e-14   Jatropha curcas
gb|KCW74001.1|  hypothetical protein EUGRSUZ_E02618                   78.2    9e-14   Eucalyptus grandis [rose gum]
ref|XP_007162842.1|  hypothetical protein PHAVU_001G185500g           78.2    1e-13   Phaseolus vulgaris [French bean]
ref|XP_011094434.1|  PREDICTED: cytochrome P450 76A1-like             78.2    1e-13   Sesamum indicum [beniseed]
gb|KDP43102.1|  hypothetical protein JCGZ_27051                       77.8    1e-13   Jatropha curcas
ref|XP_009786696.1|  PREDICTED: cytochrome P450 76A1-like             77.4    2e-13   Nicotiana sylvestris
gb|KDP26153.1|  hypothetical protein JCGZ_22834                       77.0    2e-13   Jatropha curcas
gb|KDP26150.1|  hypothetical protein JCGZ_22831                       73.6    3e-13   Jatropha curcas
gb|KDO61009.1|  hypothetical protein CISIN_1g010359mg                 76.6    3e-13   Citrus sinensis [apfelsine]
ref|XP_006481913.1|  PREDICTED: cytochrome P450 76A2-like             76.6    3e-13   Citrus sinensis [apfelsine]
ref|XP_006430323.1|  hypothetical protein CICLE_v10011511mg           76.6    3e-13   Citrus clementina [clementine]
gb|KCW48764.1|  hypothetical protein EUGRSUZ_K02408                   75.9    5e-13   Eucalyptus grandis [rose gum]
sp|P37121.1|C76A1_SOLME  RecName: Full=Cytochrome P450 76A1; AltN...  75.9    6e-13   Solanum melongena [aubergine]
ref|XP_011094433.1|  PREDICTED: cytochrome P450 76A1-like             75.9    7e-13   Sesamum indicum [beniseed]
gb|KDP39088.1|  hypothetical protein JCGZ_00845                       72.8    7e-12   Jatropha curcas
gb|KDP27489.1|  hypothetical protein JCGZ_20024                       72.0    1e-11   Jatropha curcas
gb|KDP26151.1|  hypothetical protein JCGZ_22832                       66.2    2e-11   Jatropha curcas
ref|XP_003630839.1|  Cytochrome P450                                  68.9    3e-11   
emb|CAN77400.1|  hypothetical protein VITISV_015278                   69.7    6e-11   Vitis vinifera
gb|ADD91442.1|  cytochrome P450                                       67.8    7e-11   Nicotiana tabacum [American tobacco]
ref|XP_010910705.1|  PREDICTED: cytochrome P450 71B9-like             66.6    7e-11   Elaeis guineensis
ref|XP_008439074.1|  PREDICTED: cytochrome P450 71A1-like             68.6    2e-10   Cucumis melo [Oriental melon]
ref|XP_010053381.1|  PREDICTED: geraniol 8-hydroxylase-like           68.2    2e-10   Eucalyptus grandis [rose gum]
gb|AJD25179.1|  cytochrome P450 CYP76A35                              68.2    2e-10   Salvia miltiorrhiza [Chinese salvia]
dbj|BAH84782.1|  cytochrome P450                                      68.2    3e-10   Nicotiana tabacum [American tobacco]
gb|KEH28162.1|  cytochrome P450 family 71 protein                     64.3    3e-10   Medicago truncatula
ref|XP_010502542.1|  PREDICTED: cytochrome P450 71B35-like isofor...  63.5    5e-10   
gb|KCW80419.1|  hypothetical protein EUGRSUZ_C01775                   66.6    6e-10   Eucalyptus grandis [rose gum]
ref|XP_006841384.1|  hypothetical protein AMTR_s00181p00056510        67.0    6e-10   Amborella trichopoda
dbj|BAK04621.1|  predicted protein                                    67.0    6e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009620580.1|  PREDICTED: cytochrome P450 71A9-like             67.0    7e-10   Nicotiana tomentosiformis
ref|XP_003631427.1|  PREDICTED: geraniol 8-hydroxylase-like           66.6    7e-10   Vitis vinifera
ref|XP_004248583.1|  PREDICTED: premnaspirodiene oxygenase-like i...  66.6    8e-10   Solanum lycopersicum
gb|KCW80420.1|  hypothetical protein EUGRSUZ_C01775                   66.2    8e-10   Eucalyptus grandis [rose gum]
gb|KCW83246.1|  hypothetical protein EUGRSUZ_B00186                   66.6    8e-10   Eucalyptus grandis [rose gum]
ref|XP_010502540.1|  PREDICTED: cytochrome P450 71B35-like isofor...  63.2    9e-10   
gb|KCW80422.1|  hypothetical protein EUGRSUZ_C01775                   66.2    9e-10   Eucalyptus grandis [rose gum]
ref|XP_006350771.1|  PREDICTED: cytochrome P450 71A9-like             66.6    9e-10   
ref|XP_010502541.1|  PREDICTED: cytochrome P450 71B35-like isofor...  63.2    1e-09   
ref|XP_003615665.1|  Cytochrome P450                                  66.2    1e-09   Medicago truncatula
ref|XP_010910057.1|  PREDICTED: cytochrome P450 71A9-like             63.9    1e-09   Elaeis guineensis
emb|CBI14915.3|  unnamed protein product                              65.9    1e-09   Vitis vinifera
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...  66.2    1e-09   Solanum lycopersicum
ref|XP_010048230.1|  PREDICTED: cytochrome P450 71A9-like             65.9    1e-09   Eucalyptus grandis [rose gum]
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like       65.9    1e-09   Solanum tuberosum [potatoes]
ref|XP_006477330.1|  PREDICTED: geraniol 8-hydroxylase-like           65.9    1e-09   Citrus sinensis [apfelsine]
ref|XP_006477329.1|  PREDICTED: geraniol 8-hydroxylase-like           65.9    1e-09   Citrus sinensis [apfelsine]
ref|XP_006419188.1|  hypothetical protein CICLE_v10030448mg           65.9    1e-09   Citrus clementina [clementine]
ref|XP_006440463.1|  hypothetical protein CICLE_v10019651mg           65.9    2e-09   
ref|XP_007034575.1|  Cytochrome P450, putative                        65.9    2e-09   
ref|XP_004236286.1|  PREDICTED: cytochrome P450 71A22-like            65.9    2e-09   
ref|XP_010027022.1|  PREDICTED: cytochrome P450 71A9-like             65.5    2e-09   Eucalyptus grandis [rose gum]
gb|EYU22208.1|  hypothetical protein MIMGU_mgv1a024264mg              65.5    2e-09   Erythranthe guttata [common monkey flower]
gb|EYU24235.1|  hypothetical protein MIMGU_mgv1a005267mg              65.1    3e-09   Erythranthe guttata [common monkey flower]
ref|NP_001239692.1|  cytochrome P450 71A9 precursor                   65.1    3e-09   Glycine max [soybeans]
gb|ACU20174.1|  unknown                                               65.1    3e-09   Glycine max [soybeans]
gb|KCW80424.1|  hypothetical protein EUGRSUZ_C01776                   64.7    3e-09   Eucalyptus grandis [rose gum]
ref|XP_010663828.1|  PREDICTED: cytochrome P450 71A9-like             64.7    3e-09   Vitis vinifera
gb|KDO36667.1|  hypothetical protein CISIN_1g011040mg                 64.7    4e-09   Citrus sinensis [apfelsine]
ref|XP_006423653.1|  hypothetical protein CICLE_v10028270mg           64.7    4e-09   Citrus clementina [clementine]
ref|XP_010040683.1|  PREDICTED: geraniol 8-hydroxylase-like           64.7    4e-09   Eucalyptus grandis [rose gum]
ref|XP_006351420.1|  PREDICTED: cytochrome P450 71A22-like            64.7    4e-09   Solanum tuberosum [potatoes]
ref|XP_006487694.1|  PREDICTED: geraniol 8-hydroxylase-like           64.7    4e-09   Citrus sinensis [apfelsine]
gb|KCW45005.1|  hypothetical protein EUGRSUZ_L01405                   64.7    4e-09   Eucalyptus grandis [rose gum]
ref|XP_002323081.2|  hypothetical protein POPTR_0016s14440g           64.7    4e-09   
ref|XP_002323082.2|  hypothetical protein POPTR_0016s14440g           63.9    4e-09   
ref|XP_010102944.1|  Psoralen synthase                                62.4    4e-09   
ref|XP_003600328.1|  Cytochrome P450                                  64.3    5e-09   Medicago truncatula
gb|EYU32021.1|  hypothetical protein MIMGU_mgv1a005095mg              64.3    5e-09   Erythranthe guttata [common monkey flower]
ref|XP_010026997.1|  PREDICTED: cytochrome P450 71A9-like             64.3    5e-09   Eucalyptus grandis [rose gum]
gb|KCW83245.1|  hypothetical protein EUGRSUZ_B00184                   64.3    5e-09   Eucalyptus grandis [rose gum]
gb|KDP39024.1|  hypothetical protein JCGZ_00781                       64.3    5e-09   Jatropha curcas
ref|XP_010027006.1|  PREDICTED: cytochrome P450 71A9-like             64.3    5e-09   Eucalyptus grandis [rose gum]
gb|EMT31346.1|  Cytochrome P450 71D7                                  63.9    7e-09   
sp|O04164.1|C71A6_NEPRA  RecName: Full=Cytochrome P450 71A6           63.9    7e-09   Nepeta racemosa
ref|XP_011072187.1|  PREDICTED: cytochrome P450 71A9-like             63.9    7e-09   
ref|XP_010057715.1|  PREDICTED: geraniol 8-hydroxylase-like           63.5    8e-09   Eucalyptus grandis [rose gum]
gb|ADE80941.1|  flavonoid 3'-hydroxylase                              63.5    8e-09   Epimedium sagittatum
ref|XP_006854378.1|  hypothetical protein AMTR_s00039p00170480        63.5    8e-09   Amborella trichopoda
ref|XP_006487449.1|  PREDICTED: geraniol 8-hydroxylase-like           63.5    8e-09   Citrus sinensis [apfelsine]
gb|AES98640.2|  cytochrome P450 family 71 protein                     61.6    9e-09   Medicago truncatula
ref|XP_010544668.1|  PREDICTED: cytochrome P450 76C1-like             63.5    1e-08   Tarenaya hassleriana [spider flower]
gb|KCW80423.1|  hypothetical protein EUGRSUZ_C01776                   63.2    1e-08   Eucalyptus grandis [rose gum]
ref|XP_010048231.1|  PREDICTED: cytochrome P450 71A9-like             63.2    1e-08   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12             63.2    1e-08   Vitis vinifera
gb|AFK47133.1|  unknown                                               62.4    1e-08   Lotus japonicus
gb|KCW80425.1|  hypothetical protein EUGRSUZ_C01776                   63.2    1e-08   Eucalyptus grandis [rose gum]
ref|XP_008382575.1|  PREDICTED: cytochrome P450 71A3-like             63.2    1e-08   
gb|AJD25151.1|  cytochrome P450 CYP71AH15                             63.2    1e-08   Salvia miltiorrhiza [Chinese salvia]
gb|EPS57376.1|  hypothetical protein M569_17442                       63.2    1e-08   Genlisea aurea
ref|XP_002276561.1|  PREDICTED: geraniol 8-hydroxylase                63.2    1e-08   Vitis vinifera
ref|XP_003558352.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...  63.2    1e-08   Brachypodium distachyon [annual false brome]
gb|AFP95893.1|  F3'H                                                  63.2    1e-08   Narcissus tazetta
gb|KCW74943.1|  hypothetical protein EUGRSUZ_E03687                   62.8    1e-08   Eucalyptus grandis [rose gum]
ref|XP_004241226.1|  PREDICTED: cytochrome P450 71A9-like             63.2    1e-08   Solanum lycopersicum
gb|KHG11226.1|  Cytochrome P450                                       62.8    1e-08   Gossypium arboreum [tree cotton]
emb|CBI33813.3|  unnamed protein product                              63.2    1e-08   Vitis vinifera
gb|AFK79030.1|  cytochrome P450 CYP736A53                             62.8    1e-08   Bupleurum chinense
ref|XP_010053375.1|  PREDICTED: geraniol 8-hydroxylase-like           62.8    2e-08   Eucalyptus grandis [rose gum]
gb|KDO36937.1|  hypothetical protein CISIN_1g044449mg                 60.5    2e-08   Citrus sinensis [apfelsine]
sp|H2DH20.1|C7D13_PANGI  RecName: Full=Cytochrome P450 CYP71D313      62.8    2e-08   Panax ginseng [Asiatic ginseng]
gb|KEH34024.1|  cytochrome P450 family 71 protein                     62.8    2e-08   Medicago truncatula
ref|XP_002303546.2|  hypothetical protein POPTR_0003s11810g           62.8    2e-08   
ref|XP_007137994.1|  hypothetical protein PHAVU_009G172100g           62.8    2e-08   Phaseolus vulgaris [French bean]
ref|XP_003600319.1|  Cytochrome P450                                  62.4    2e-08   Medicago truncatula
ref|XP_007048087.1|  Cytochrome P450                                  62.8    2e-08   
ref|XP_006841385.1|  hypothetical protein AMTR_s00181p00057690        62.4    2e-08   Amborella trichopoda
ref|XP_007159748.1|  hypothetical protein PHAVU_002G263800g           62.0    2e-08   Phaseolus vulgaris [French bean]
ref|XP_001782843.1|  predicted protein                                62.4    2e-08   
ref|XP_011012702.1|  PREDICTED: cytochrome P450 71D11-like            62.4    2e-08   Populus euphratica
ref|XP_007020023.1|  Cytochrome P450 71A9, putative                   62.4    2e-08   
ref|XP_011029123.1|  PREDICTED: geraniol 8-hydroxylase-like           62.4    2e-08   Populus euphratica
ref|XP_010100353.1|  Cytochrome P450                                  62.0    2e-08   
ref|XP_002310636.2|  hypothetical protein POPTR_0007s07310g           62.4    2e-08   
ref|XP_002299579.2|  hypothetical protein POPTR_0001s08320g           62.4    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_007142620.1|  hypothetical protein PHAVU_007G003100g           62.4    2e-08   Phaseolus vulgaris [French bean]
ref|XP_011091088.1|  PREDICTED: ferruginol synthase-like              62.4    2e-08   Sesamum indicum [beniseed]
ref|XP_007159749.1|  hypothetical protein PHAVU_002G263800g           62.4    2e-08   Phaseolus vulgaris [French bean]
gb|KEH31760.1|  cytochrome P450 family 71 protein                     62.4    2e-08   Medicago truncatula
gb|KEH28165.1|  cytochrome P450 family 71 protein                     62.0    2e-08   Medicago truncatula
gb|ABC69415.1|  CYP71AH2                                              62.0    3e-08   Nicotiana tabacum [American tobacco]
ref|XP_006854377.1|  hypothetical protein AMTR_s00039p00170160        62.0    3e-08   
gb|EYU30852.1|  hypothetical protein MIMGU_mgv1a020394mg              61.2    3e-08   Erythranthe guttata [common monkey flower]
gb|AFK73717.1|  cytochrome P450                                       62.0    3e-08   Papaver somniferum
ref|XP_010102940.1|  Cytochrome P450 71A1                             62.0    3e-08   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like            62.0    3e-08   Fragaria vesca subsp. vesca
gb|KJB51557.1|  hypothetical protein B456_008G222600                  62.0    3e-08   Gossypium raimondii
gb|KEH31755.1|  cytochrome P450 family 71 protein                     62.0    3e-08   Medicago truncatula
ref|XP_010093536.1|  Cytochrome P450 76C4                             62.0    3e-08   Morus notabilis
ref|XP_011047544.1|  PREDICTED: cytochrome P450 71D11-like isofor...  62.0    3e-08   Populus euphratica
gb|AFK73716.1|  cytochrome P450                                       62.0    3e-08   Papaver somniferum
ref|XP_002312659.2|  hypothetical protein POPTR_0008s18790g           62.0    3e-08   
gb|AIU56747.1|  cytochrome P450 CYP71B41v2                            62.0    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011014080.1|  PREDICTED: cytochrome P450 71D11-like            62.0    3e-08   Populus euphratica
ref|XP_008659837.1|  PREDICTED: cytochrome P450 93A3-like             62.0    3e-08   Zea mays [maize]
emb|CBI34790.3|  unnamed protein product                              61.2    3e-08   Vitis vinifera
gb|EYU22202.1|  hypothetical protein MIMGU_mgv1a005074mg              61.6    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_002523238.1|  cytochrome P450, putative                        61.6    4e-08   
ref|XP_010911520.1|  PREDICTED: cytochrome P450 71A9-like             61.2    4e-08   
ref|XP_006417158.1|  hypothetical protein EUTSA_v10009445mg           61.6    4e-08   
ref|XP_006584398.1|  PREDICTED: cytochrome P450 71A6-like             59.3    4e-08   
gb|KJB78919.1|  hypothetical protein B456_013G025300                  60.8    4e-08   Gossypium raimondii
gb|KHG17729.1|  Cytochrome P450                                       61.6    4e-08   Gossypium arboreum [tree cotton]
ref|XP_006854384.1|  hypothetical protein AMTR_s00039p00175330        61.6    4e-08   
ref|XP_008239593.1|  PREDICTED: cytochrome P450 71A25-like            61.2    4e-08   
ref|XP_009334095.1|  PREDICTED: cytochrome P450 71A3-like             61.6    4e-08   
gb|KHG18333.1|  Cytochrome P450                                       61.6    4e-08   Gossypium arboreum [tree cotton]
gb|AES98625.2|  cytochrome P450 family 71 protein                     61.6    4e-08   Medicago truncatula
gb|EYU21984.1|  hypothetical protein MIMGU_mgv1a019764mg              59.7    4e-08   Erythranthe guttata [common monkey flower]
ref|XP_011005615.1|  PREDICTED: cytochrome P450 71A1-like             61.2    5e-08   Populus euphratica
ref|XP_010251006.1|  PREDICTED: cytochrome P450 71A1                  61.2    5e-08   Nelumbo nucifera [Indian lotus]
ref|XP_003636948.1|  Cytochrome P450                                  60.8    5e-08   
gb|KJB51118.1|  hypothetical protein B456_008G202400                  61.6    5e-08   Gossypium raimondii
gb|AJD25185.1|  cytochrome P450 CYP76S7                               61.2    5e-08   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008653482.1|  PREDICTED: geraniol 8-hydroxylase-like           61.2    5e-08   Zea mays [maize]
ref|XP_003615682.1|  Cytochrome P450                                  61.2    5e-08   
gb|ACU20890.1|  unknown                                               61.2    5e-08   Glycine max [soybeans]
ref|XP_003615667.1|  Cytochrome P450                                  61.6    5e-08   
ref|XP_003600316.1|  Cytochrome P450                                  59.7    5e-08   
ref|XP_010102947.1|  Cytochrome P450 71A1                             61.2    5e-08   
gb|EMT07380.1|  Cytochrome P450 71D10                                 61.2    6e-08   
ref|XP_009362819.1|  PREDICTED: geraniol 8-hydroxylase-like           60.8    6e-08   Pyrus x bretschneideri [bai li]
gb|KFK27280.1|  hypothetical protein AALP_AA8G361500                  60.8    6e-08   Arabis alpina [alpine rockcress]
ref|XP_003610580.1|  Cytochrome P450                                  60.8    6e-08   Medicago truncatula
gb|AGG40645.1|  flavanone 3'-hydroxylase                              61.2    6e-08   Narcissus tazetta
ref|XP_003600322.1|  Cytochrome P450                                  60.8    6e-08   Medicago truncatula
ref|XP_011033850.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  60.8    6e-08   Populus euphratica
emb|CAA70575.1|  cytochrome P450                                      60.8    6e-08   Nepeta racemosa
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like             60.8    6e-08   Eucalyptus grandis [rose gum]
ref|XP_010696005.1|  PREDICTED: cytochrome P450 71A25-like            60.8    7e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010557182.1|  PREDICTED: cytochrome P450 71A1-like             60.8    7e-08   Tarenaya hassleriana [spider flower]
gb|KCW74933.1|  hypothetical protein EUGRSUZ_E03678                   60.8    7e-08   Eucalyptus grandis [rose gum]
gb|KDO35818.1|  hypothetical protein CISIN_1g038027mg                 58.2    7e-08   Citrus sinensis [apfelsine]
gb|KJB27712.1|  hypothetical protein B456_005G005900                  60.8    7e-08   Gossypium raimondii
ref|XP_004515856.1|  PREDICTED: cytochrome P450 71A26-like            60.8    7e-08   
gb|KEH31752.1|  cytochrome P450 family 71 protein                     60.8    7e-08   
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like            60.8    7e-08   
ref|XP_011457549.1|  PREDICTED: geraniol 8-hydroxylase-like           61.2    7e-08   
emb|CDP14652.1|  unnamed protein product                              60.8    7e-08   
ref|XP_011034037.1|  PREDICTED: cytochrome P450 71B10-like            60.8    7e-08   
ref|XP_002312660.2|  hypothetical protein POPTR_0008s18810g           60.8    7e-08   
gb|EYU30850.1|  hypothetical protein MIMGU_mgv1a005599mg              60.8    7e-08   
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                 60.8    7e-08   
gb|AIU56749.1|  cytochrome P450 CYP71B63v2                            60.8    7e-08   
gb|AIU56748.1|  cytochrome P450 CYP71B40v3                            60.8    7e-08   
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                 60.8    8e-08   
gb|ABK94709.1|  unknown                                               60.8    8e-08   
ref|XP_010102942.1|  Cytochrome P450 71A1                             60.1    8e-08   
ref|XP_002312665.2|  hypothetical protein POPTR_0008s18870g           60.8    8e-08   
ref|XP_002983183.1|  hypothetical protein SELMODRAFT_422497           60.5    8e-08   
ref|XP_004299223.2|  PREDICTED: cytochrome P450 CYP736A12-like        60.8    8e-08   
ref|XP_007048751.1|  4-hydroxyphenylacetaldehyde oxime monooxygen...  60.8    8e-08   
ref|XP_002321645.1|  hypothetical protein POPTR_0015s09760g           60.5    8e-08   
ref|XP_002323083.2|  hypothetical protein POPTR_0016s14460g           60.5    8e-08   
ref|XP_009608153.1|  PREDICTED: cytochrome P450 71A22-like            60.8    8e-08   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like             60.5    8e-08   
ref|XP_006345633.1|  PREDICTED: premnaspirodiene oxygenase-like       60.5    8e-08   
ref|XP_006423711.1|  hypothetical protein CICLE_v10028239mg           60.5    8e-08   
ref|XP_009406657.1|  PREDICTED: premnaspirodiene oxygenase-like       60.5    9e-08   
ref|XP_004152574.1|  PREDICTED: cytochrome P450 71A1-like             60.5    9e-08   
gb|KDO63687.1|  hypothetical protein CISIN_1g040285mg                 59.7    9e-08   
ref|XP_010658029.1|  PREDICTED: ripening-related P-450 enzyme-lik...  60.5    9e-08   
ref|NP_001268152.1|  ripening-related P-450 enzyme-like               60.5    9e-08   
ref|XP_011071980.1|  PREDICTED: cytochrome P450 71A6-like             60.5    9e-08   
ref|XP_006423661.1|  hypothetical protein CICLE_v10028273mg           60.5    9e-08   
ref|XP_002509652.1|  cytochrome P450, putative                        60.1    9e-08   
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                            60.5    9e-08   
gb|EAY89257.1|  hypothetical protein OsI_10754                        60.5    1e-07   
ref|XP_011033851.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  60.5    1e-07   
gb|ABF94963.1|  Cytochrome P450 family protein, expressed             60.5    1e-07   
ref|XP_002310007.2|  cytochrome P450 family protein                   60.5    1e-07   
ref|XP_008777462.1|  PREDICTED: cytochrome P450 71A1-like             60.5    1e-07   
ref|XP_003615666.1|  Cytochrome P450                                  60.5    1e-07   
ref|XP_010667687.1|  PREDICTED: cytochrome P450 71A3-like             60.5    1e-07   
ref|XP_007209932.1|  hypothetical protein PRUPE_ppa004606mg           60.5    1e-07   
emb|CDP14649.1|  unnamed protein product                              60.5    1e-07   
emb|CDP14646.1|  unnamed protein product                              60.5    1e-07   
dbj|BAP15887.1|  cytochrome P450 736A117                              60.5    1e-07   
emb|CDP14647.1|  unnamed protein product                              60.5    1e-07   
ref|XP_006423657.1|  hypothetical protein CICLE_v10030181mg           60.1    1e-07   
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                 60.1    1e-07   
ref|XP_010057717.1|  PREDICTED: geraniol 8-hydroxylase-like           60.1    1e-07   
ref|XP_003521519.1|  PREDICTED: geraniol 8-hydroxylase-like           60.1    1e-07   
gb|KCW74936.1|  hypothetical protein EUGRSUZ_E03682                   60.1    1e-07   
ref|XP_003559997.1|  PREDICTED: 4-hydroxyphenylacetaldehyde oxime...  60.5    1e-07   
gb|EMS54445.1|  4-hydroxyphenylacetaldehyde oxime monooxygenase       57.8    1e-07   
ref|XP_007037775.1|  Cytochrome P450 71A1                             60.1    1e-07   
gb|KCW75045.1|  hypothetical protein EUGRSUZ_E03822                   60.1    1e-07   
ref|XP_010057714.1|  PREDICTED: geraniol 8-hydroxylase-like           60.1    1e-07   
gb|EYU21980.1|  hypothetical protein MIMGU_mgv1a004765mg              60.1    1e-07   
ref|XP_002987707.1|  hypothetical protein SELMODRAFT_158927           60.1    1e-07   
ref|XP_010057762.1|  PREDICTED: geraniol 8-hydroxylase-like           60.1    1e-07   
ref|XP_003630098.1|  Cytochrome P450                                  60.1    1e-07   
gb|KHG20290.1|  Cytochrome P450 protein                               60.1    1e-07   
ref|XP_010057761.1|  PREDICTED: geraniol 8-hydroxylase-like           60.1    1e-07   
ref|XP_002983187.1|  hypothetical protein SELMODRAFT_445434           60.1    1e-07   
ref|XP_002994541.1|  hypothetical protein SELMODRAFT_449382           60.1    1e-07   
ref|XP_010102946.1|  Serine/threonine-protein kinase AFC2             60.5    1e-07   
gb|KCW74940.1|  hypothetical protein EUGRSUZ_E03685                   60.1    1e-07   
ref|XP_007210076.1|  hypothetical protein PRUPE_ppa019549mg           59.3    1e-07   
ref|XP_007210185.1|  hypothetical protein PRUPE_ppa020002mg           60.1    1e-07   
ref|XP_010050611.1|  PREDICTED: geraniol 8-hydroxylase-like           60.1    1e-07   
ref|XP_006387000.1|  hypothetical protein POPTR_2285s00200g           58.2    1e-07   
gb|EMT03552.1|  Cytochrome P450 76C4                                  60.1    1e-07   
ref|XP_008446128.1|  PREDICTED: cytochrome P450 71A1-like             59.3    1e-07   
gb|KDO62850.1|  hypothetical protein CISIN_1g010346mg                 60.1    1e-07   
ref|XP_006854383.1|  hypothetical protein AMTR_s00039p00174690        60.1    1e-07   
ref|XP_006490728.1|  PREDICTED: cytochrome P450 71A22-like            60.1    1e-07   
ref|XP_006451679.1|  hypothetical protein CICLE_v10007998mg           60.1    1e-07   
ref|XP_002310060.1|  hypothetical protein POPTR_0007s07420g           60.1    1e-07   
gb|EYU23970.1|  hypothetical protein MIMGU_mgv1a020286mg              60.1    1e-07   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1  59.7    1e-07   
ref|XP_009333927.1|  PREDICTED: cytochrome P450 71A1-like             60.1    1e-07   
ref|XP_010692297.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  59.7    1e-07   
ref|XP_010544666.1|  PREDICTED: cytochrome P450 76C4-like             59.7    1e-07   
ref|XP_002540268.1|  cytochrome P450, putative                        58.5    2e-07   
ref|XP_002530058.1|  cytochrome P450, putative                        59.7    2e-07   
ref|XP_004152572.1|  PREDICTED: cytochrome P450 71A1-like             59.7    2e-07   
ref|XP_010911404.1|  PREDICTED: cytochrome P450 71A1-like             59.7    2e-07   
ref|XP_010057720.1|  PREDICTED: geraniol 8-hydroxylase-like           59.7    2e-07   
ref|XP_006439958.1|  hypothetical protein CICLE_v10023549mg           59.7    2e-07   
ref|XP_007146615.1|  hypothetical protein PHAVU_006G0551000g          57.0    2e-07   
ref|XP_003615678.1|  Cytochrome P450                                  59.7    2e-07   
ref|XP_004304108.2|  PREDICTED: cytochrome P450 71D9-like             60.1    2e-07   
ref|XP_010692295.1|  PREDICTED: geraniol 8-hydroxylase-like           59.7    2e-07   
ref|XP_002531865.1|  cytochrome P450, putative                        59.7    2e-07   
ref|XP_011047545.1|  PREDICTED: cytochrome P450 71D11-like isofor...  59.7    2e-07   
ref|XP_011097561.1|  PREDICTED: 4-hydroxyphenylacetaldehyde oxime...  59.7    2e-07   
ref|XP_006487469.1|  PREDICTED: geraniol 8-hydroxylase-like           59.7    2e-07   
ref|XP_004301061.2|  PREDICTED: cytochrome P450 CYP736A12-like        59.7    2e-07   
ref|XP_004173362.1|  PREDICTED: cytochrome P450 71A2-like             57.8    2e-07   
ref|XP_003636932.1|  Cytochrome P450                                  59.3    2e-07   
ref|XP_010692296.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  59.7    2e-07   
ref|XP_007212458.1|  hypothetical protein PRUPE_ppa017406mg           58.9    2e-07   
gb|AJD25184.1|  cytochrome P450 CYP76G16                              59.7    2e-07   
ref|XP_010694340.1|  PREDICTED: cytochrome P450 71A1-like             59.7    2e-07   
ref|XP_010537441.1|  PREDICTED: cytochrome P450 CYP736A12-like        59.7    2e-07   
gb|KDO43348.1|  hypothetical protein CISIN_1g039787mg                 58.5    2e-07   
gb|AJD25161.1|  cytochrome P450 CYP71BE37                             59.7    2e-07   
ref|XP_010053380.1|  PREDICTED: geraniol 8-hydroxylase-like           59.7    2e-07   
ref|XP_006477331.1|  PREDICTED: geraniol 8-hydroxylase-like           59.7    2e-07   
ref|XP_002310634.2|  hypothetical protein POPTR_0007s07300g           59.7    2e-07   
ref|XP_003601148.1|  Cytochrome P450                                  58.5    2e-07   
ref|XP_006423715.1|  hypothetical protein CICLE_v10028276mg           59.3    2e-07   
sp|Q6QNI4.1|C71AJ_AMMMJ  RecName: Full=Psoralen synthase; AltName...  59.3    2e-07   
ref|XP_007027586.1|  Cytochrome P450                                  60.1    2e-07   
gb|AHI15942.1|  flavonoid 3',5'-hydroxylase                           59.7    2e-07   
ref|XP_010654031.1|  PREDICTED: cytochrome P450 76A1                  59.3    2e-07   
ref|XP_009346479.1|  PREDICTED: cytochrome P450 71A25-like            59.3    2e-07   
ref|XP_003600323.1|  Cytochrome P450                                  59.3    2e-07   
gb|KHN29102.1|  Cytochrome P450 71A1                                  59.3    2e-07   
ref|XP_006487474.1|  PREDICTED: geraniol 8-hydroxylase-like           59.3    2e-07   
ref|XP_011465681.1|  PREDICTED: cytochrome P450 CYP736A12-like        59.3    2e-07   
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                          59.3    2e-07   
ref|XP_008353443.1|  PREDICTED: premnaspirodiene oxygenase-like       58.9    2e-07   
ref|XP_008239349.1|  PREDICTED: cytochrome P450 71A1-like             59.3    2e-07   
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like             59.3    2e-07   
ref|XP_006440464.1|  hypothetical protein CICLE_v10019826mg           59.3    2e-07   
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like             59.3    2e-07   
ref|XP_009334051.1|  PREDICTED: cytochrome P450 71A25-like            59.3    2e-07   
ref|XP_006423716.1|  hypothetical protein CICLE_v10028276mg           58.9    2e-07   
ref|XP_008365825.1|  PREDICTED: cytochrome P450 71A25-like            59.3    2e-07   
ref|XP_008783087.1|  PREDICTED: cytochrome P450 93A3                  59.3    2e-07   
ref|XP_008239355.1|  PREDICTED: cytochrome P450 71A24-like            59.3    2e-07   
ref|XP_010931871.1|  PREDICTED: cytochrome P450 71A9-like             59.3    2e-07   
ref|XP_010050589.1|  PREDICTED: geraniol 8-hydroxylase-like           59.3    2e-07   
ref|XP_004295868.2|  PREDICTED: cytochrome P450 71D11-like            59.3    2e-07   
ref|XP_004504031.1|  PREDICTED: cytochrome P450 750A1-like            59.3    2e-07   
ref|XP_011040452.1|  PREDICTED: cytochrome P450 71A1-like             59.3    2e-07   
ref|XP_003600327.1|  Cytochrome P450                                  59.3    2e-07   
gb|EYU30849.1|  hypothetical protein MIMGU_mgv1a006027mg              58.9    2e-07   
ref|XP_010257377.1|  PREDICTED: cytochrome P450 93A2-like             59.3    2e-07   
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                    59.3    2e-07   
ref|XP_007020549.1|  Cytochrome P450                                  59.3    2e-07   
gb|KHG16719.1|  Cytochrome P450                                       58.9    3e-07   
gb|AGC29948.1|  CYP75B65                                              59.3    3e-07   
gb|EMS49735.1|  Cytochrome P450 76C4                                  58.9    3e-07   
ref|XP_008229630.1|  PREDICTED: cytochrome P450 71A1-like             58.9    3e-07   
ref|XP_002530922.1|  cytochrome P450, putative                        58.9    3e-07   
gb|AAL15268.1|  AT4g13770/F18A5_160                                   58.5    3e-07   
ref|XP_004173265.1|  PREDICTED: cytochrome P450 71A21-like            57.8    3e-07   
emb|CCO62222.1|  putative cytochrome P450 monooxygenase               58.9    3e-07   
gb|KDP31013.1|  hypothetical protein JCGZ_11389                       58.9    3e-07   
ref|XP_004157822.1|  PREDICTED: cytochrome P450 71A1-like             58.9    3e-07   
ref|XP_011457440.1|  PREDICTED: geraniol 8-hydroxylase-like           58.9    3e-07   
ref|XP_010663583.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X2  58.9    3e-07   
gb|KDP34567.1|  hypothetical protein JCGZ_11117                       58.5    3e-07   
ref|XP_002466096.1|  hypothetical protein SORBIDRAFT_01g001160        58.9    3e-07   
gb|ABR16325.1|  unknown                                               58.9    3e-07   
ref|XP_007037782.1|  Cytochrome P450 71A1                             58.9    3e-07   
ref|XP_010668023.1|  PREDICTED: cytochrome P450 71A26-like            58.9    3e-07   
ref|XP_009372320.1|  PREDICTED: geraniol 8-hydroxylase-like           58.9    3e-07   
ref|XP_003615672.1|  Cytochrome P450                                  58.9    3e-07   
ref|XP_008391365.1|  PREDICTED: cytochrome P450 71A25-like            58.9    3e-07   
ref|XP_002467130.1|  hypothetical protein SORBIDRAFT_01g020110        58.2    3e-07   
emb|CAN69565.1|  hypothetical protein VITISV_033534                   58.9    3e-07   
ref|XP_010272814.1|  PREDICTED: cytochrome P450 71A1-like             58.9    3e-07   
gb|KJB61454.1|  hypothetical protein B456_009G3588002                 55.5    3e-07   
ref|XP_003615674.1|  Cytochrome P450                                  58.9    3e-07   
ref|XP_004304846.1|  PREDICTED: cytochrome P450 CYP736A12-like        58.9    3e-07   
ref|XP_002876962.1|  CYP71B34                                         58.9    3e-07   
ref|XP_002275691.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X1  58.9    3e-07   
ref|XP_002987708.1|  hypothetical protein SELMODRAFT_426456           58.9    3e-07   
gb|KEH34017.1|  cytochrome P450 family 71 protein                     58.9    3e-07   
ref|XP_010931872.1|  PREDICTED: cytochrome P450 71A9-like             58.9    3e-07   
gb|KDO69448.1|  hypothetical protein CISIN_1g010315mg                 58.9    3e-07   
ref|XP_006476912.1|  PREDICTED: cytochrome P450 71A1-like             58.9    3e-07   
ref|XP_004512033.1|  PREDICTED: cytochrome P450 71D8-like             58.9    3e-07   
gb|KDO47864.1|  hypothetical protein CISIN_1g043423mg                 58.9    3e-07   
ref|XP_004166926.1|  PREDICTED: geraniol 8-hydroxylase-like           58.9    3e-07   
ref|XP_002514610.1|  flavonoid 3-hydroxylase, putative                58.9    3e-07   
dbj|BAD16679.1|  cytochrome P450                                      58.5    3e-07   
ref|XP_009121553.1|  PREDICTED: cytochrome P450 71B9-like             55.8    3e-07   
ref|XP_002463548.1|  hypothetical protein SORBIDRAFT_01g001780        58.5    3e-07   
gb|AJD25160.1|  cytochrome P450 CYP71AU53                             58.5    4e-07   
ref|XP_002523242.1|  cytochrome P450, putative                        58.5    4e-07   
gb|KGN50170.1|  hypothetical protein Csa_5G157290                     58.5    4e-07   
emb|CDP20259.1|  unnamed protein product                              58.5    4e-07   
ref|XP_002523235.1|  cytochrome P450, putative                        58.5    4e-07   
ref|XP_002983181.1|  hypothetical protein SELMODRAFT_118026           58.5    4e-07   
ref|XP_010667793.1|  PREDICTED: geraniol 8-hydroxylase-like           58.5    4e-07   
ref|XP_002523241.1|  cytochrome P450, putative                        58.5    4e-07   
ref|XP_002522214.1|  cytochrome P450, putative                        57.8    4e-07   
gb|AES98632.2|  cytochrome P450 family 71 protein                     58.5    4e-07   
ref|XP_004505028.1|  PREDICTED: cytochrome P450 71A24-like            58.5    4e-07   
gb|KDP25563.1|  hypothetical protein JCGZ_20719                       58.9    4e-07   
ref|XP_002522903.1|  cytochrome P450, putative                        58.5    4e-07   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg           58.5    4e-07   
gb|ABR17055.1|  unknown                                               58.5    4e-07   
ref|XP_008392880.1|  PREDICTED: cytochrome P450 71A1-like             58.5    4e-07   
gb|AHA84267.1|  cytochrome P450 71A1                                  58.5    4e-07   
ref|XP_008351758.1|  PREDICTED: cytochrome P450 71A1-like             58.5    4e-07   
ref|XP_002876964.1|  CYP71B37                                         58.5    4e-07   
gb|KHN43883.1|  Cytochrome P450 71D10                                 58.5    4e-07   
ref|XP_010912890.1|  PREDICTED: cytochrome P450 71A9-like             58.5    4e-07   
ref|XP_004152578.1|  PREDICTED: cytochrome P450 71A22-like            57.8    4e-07   
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg              58.5    4e-07   
ref|XP_006293048.1|  hypothetical protein CARUB_v10019335mg           58.5    4e-07   
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like        58.5    4e-07   
gb|KHG02344.1|  Cytochrome P450                                       58.5    4e-07   
gb|KJB19523.1|  hypothetical protein B456_003G107400                  58.5    5e-07   
ref|XP_002318091.2|  hypothetical protein POPTR_0012s09180g           58.2    5e-07   
ref|XP_004506712.1|  PREDICTED: cytochrome P450 71D10-like            58.2    5e-07   
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like             58.2    5e-07   
dbj|BAM68817.1|  putative cytochrome P450 monooxygenase CYP71AV1      58.2    5e-07   
gb|KHG11933.1|  Cytochrome P450                                       58.2    5e-07   
ref|XP_004241763.1|  PREDICTED: geraniol 8-hydroxylase-like           58.2    5e-07   
gb|ABK25581.1|  unknown                                               58.2    5e-07   
gb|KJB73410.1|  hypothetical protein B456_011G232300                  58.2    5e-07   
ref|XP_011097779.1|  PREDICTED: cytochrome P450 71D11-like            58.2    5e-07   
ref|XP_008437176.1|  PREDICTED: geraniol 8-hydroxylase-like           58.2    5e-07   
ref|XP_011040453.1|  PREDICTED: cytochrome P450 71A1-like             58.2    5e-07   
ref|XP_003536316.1|  PREDICTED: geraniol 8-hydroxylase-like           58.2    5e-07   
ref|XP_007148631.1|  hypothetical protein PHAVU_005G002400g           58.2    5e-07   
ref|XP_008227171.1|  PREDICTED: cytochrome P450 71D9-like             58.2    5e-07   



>ref|XP_009788755.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=505

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWEW Y+VWS I L+P L+ + +RK+SSS Y LPPGPPGLP+ GNM DLG  P+QTIA 
Sbjct  1    MEWEWSYVVWSVIILVPTLIIVFSRKRSSS-YNLPPGPPGLPIFGNMFDLGTLPYQTIAS  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
             K+KYG ++W  IGSV TM+ILSAK AA+ FKNHD +FA+R  I
Sbjct  60   FKHKYGPIVWFNIGSVKTMSILSAKTAADFFKNHDFAFAERKII  103



>ref|XP_009589554.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=506

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWEW Y+VWS I L+P L+ + ++++S S Y LPPGPPGLP+ GNM +LG  P+QTIA 
Sbjct  1    MEWEWSYVVWSTIILVPTLIIVFSKRRSCS-YNLPPGPPGLPIFGNMFNLGTLPYQTIAS  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             K+KYG ++W  IGSV TM+ILSAK AAE FKNHD +FA+R
Sbjct  60   FKHKYGPIVWFNIGSVKTMSILSAKTAAEFFKNHDFAFAER  100



>ref|XP_006341182.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=507

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWEW Y+VWS I ++P  + ++  K +SSSY+LPPGPPG P+ GNM DLG  P+QTIAE
Sbjct  1    MEWEWNYVVWSIIIIVPTTLIIVFSKTNSSSYKLPPGPPGFPIFGNMFDLGTLPYQTIAE  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
             K KYG V+W +IGSV TM+ILSA  A E FKNHD +FA+R  I
Sbjct  61   FKQKYGPVVWFKIGSVKTMSILSANTATEFFKNHDFAFAERKII  104



>ref|XP_008241319.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   119 bits (297),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSS-YRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEW W +LV+   FL+P L+FL+ R+ S+SS +RLPPGPPGLPV GNM DLG  PHQT+ 
Sbjct  2    MEWPWNFLVYFITFLLPALLFLIRRRSSNSSLHRLPPGPPGLPVFGNMFDLGTMPHQTLT  61

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            E+ +K+G VIWLR+G+ +TM I SAKAAA+LFK+HD+SFA RT
Sbjct  62   ELTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRT  104



>ref|XP_004246901.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W+W Y+VWS I ++   + ++  K++SS Y+LPPGPPG+P+ GNM DLGA P+QTIA+
Sbjct  1    MDWDWNYVVWSIIIIVSTTLIIVFSKRNSSCYKLPPGPPGIPIFGNMFDLGALPYQTIAQ  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             K KYG ++W +IGSV TM+ILSAK A E FKNHD  FA+R
Sbjct  61   YKQKYGPIVWFKIGSVKTMSILSAKTATEFFKNHDFVFAER  101



>ref|XP_009757934.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=506

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+WEW YL +S I  +P L+ +  +KK++SSY+LPPGPPGLP+ GNM +LG+ P++ +A 
Sbjct  1    MQWEWSYLFFSTIIFLPVLLLIFPKKKANSSYKLPPGPPGLPIFGNMFELGSLPYKKVAV  60

Query  349  MKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            +K KYG ++WL+IG S+++M + +A+AAA+LFKNHD+SFADR  + V
Sbjct  61   LKQKYGPILWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCTVDV  107



>ref|XP_009602679.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=507

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKS-SSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S I  +P L+ +  +KK+ SSSYRLPPGPPGLP+ GNM +LG  P++ +A
Sbjct  1    MEWEWSYLFFSTIIFLPVLLLIFPKKKAISSSYRLPPGPPGLPIFGNMFELGTLPYKKVA  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
             +K KYG V+WL+IG S+++M + +A+AAA+LFKNHD+SFADR  + V
Sbjct  61   VLKQKYGPVLWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCPVDV  108



>dbj|BAC53892.1| cytochrome P450 [Petunia x hybrida]
Length=510

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M  +W Y  W +IFL+P    +L+RKKS S +RLPPGPPG P+ GN+ DLG  PHQTIA 
Sbjct  1    MVLDWCYFAWFSIFLVPFFFLVLSRKKSCS-HRLPPGPPGWPIFGNLFDLGTLPHQTIAG  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            MK +YG V+ LRIGSV T+AILSAK A E FKNHD  FADR  I
Sbjct  60   MKLRYGPVVLLRIGSVKTIAILSAKVATEFFKNHDACFADRKII  103



>ref|XP_011094547.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=504

 Score =   106 bits (265),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 56/101 (55%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKN  357
            E  + V+ AI L+P L+F +   K S S RLPPGP G PV G+M +LG  PH+ IAE++ 
Sbjct  2    ELHFFVYPAIILLPPLIFAIIHSKRSGSERLPPGPLGWPVFGHMFNLGGTPHRAIAELEQ  61

Query  358  KYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            KYG V+WL++GS++TMA+L AK A+E FKNHD+SFADRT +
Sbjct  62   KYGPVVWLKLGSINTMALLKAKPASEFFKNHDLSFADRTIV  102



>emb|CDP15344.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ME      VW    LIP L+ LL R K SS  RLPPGPPG P+ GNM DLG+ PH+T+A 
Sbjct  1    MELHVNQFVWGVAILIPSLL-LLLRHKKSSHNRLPPGPPGWPIFGNMFDLGSMPHRTLAG  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +KNKYG V+WLRIG+++TMA+ S+KAAAELF+NHD+SF +RT
Sbjct  60   LKNKYGPVVWLRIGAMNTMAVQSSKAAAELFRNHDISFVERT  101



>ref|XP_009785657.1| PREDICTED: cytochrome P450 76A1-like isoform X2 [Nicotiana sylvestris]
Length=508

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 85/109 (78%), Gaps = 3/109 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW Y+ WS+I ++P  + L+ + KSS S+ +LPPGPPGLP++GNM DL G+ P++ +
Sbjct  1    MELEWSYIFWSSIIILPAFILLITKNKSSFSNVKLPPGPPGLPIVGNMFDLAGSEPYKKV  60

Query  343  AEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            A +K KYG ++WL+IGS ++T+ + +A+AAAELFKNHDV+FADR  + V
Sbjct  61   ANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDV  109



>ref|XP_009785656.1| PREDICTED: cytochrome P450 76A1-like isoform X1 [Nicotiana sylvestris]
Length=517

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 85/109 (78%), Gaps = 3/109 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW Y+ WS+I ++P  + L+ + KSS S+ +LPPGPPGLP++GNM DL G+ P++ +
Sbjct  1    MELEWSYIFWSSIIILPAFILLITKNKSSFSNVKLPPGPPGLPIVGNMFDLAGSEPYKKV  60

Query  343  AEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            A +K KYG ++WL+IGS ++T+ + +A+AAAELFKNHDV+FADR  + V
Sbjct  61   ANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDV  109



>ref|XP_006339107.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 78/103 (76%), Gaps = 2/103 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S+I L+P  +   +RKKS+  SY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSSIILLPAFILFFSRKKSTKCSYKLPPGPPGLPIFGNMFELGTEPYKRMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADR  471
             +K KYG V+WL++G S   M + +A+AA ELFKNHD+SFADR
Sbjct  61   VLKQKYGPVLWLKLGTSTKIMVVQTAQAAEELFKNHDISFADR  103



>ref|XP_011100232.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=547

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+  W +LVW    L P ++FL  R++ S+S  LPPGPPG PV+GNM DLG+ PH+T+A 
Sbjct  35   MDSMWIFLVWCIGILGP-VLFLFCRQRCSTSGGLPPGPPGWPVVGNMFDLGSMPHKTVAG  93

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            +K  YG V+WLRIGS++T+A+L+AKAAAELFKNHD +FA+RT   V
Sbjct  94   LKKDYGPVVWLRIGSINTVALLTAKAAAELFKNHDANFAERTITEV  139



>sp|P37122.1|C76A2_SOLME RecName: Full=Cytochrome P450 76A2; AltName: Full=CYPLXXVIA2; 
AltName: Full=Cytochrome P-450EG7 [Solanum melongena]
 emb|CAA50648.1| P450 hydroxylase [Solanum melongena]
Length=505

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW Y+ +SAI ++P  +   ++K ++ SSY+ PPGPPGLP+ GNM +LG  P++ +A
Sbjct  1    MEWEWSYVFFSAIIILPAFILFFSQKNTTKSSYKFPPGPPGLPIFGNMFELGTEPYKKMA  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             ++ KYG V+WL++GS  TM + +A+A+ ELFKNHD+SFA+R
Sbjct  61   VLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANR  102



>ref|XP_006339109.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=505

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +SAI L+P L+   ++KKS+  SY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSAIILLPVLILFFSQKKSTKCSYKLPPGPPGLPIFGNMFELGKEPYKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
             ++ KYG V+ L++G S + M + +A AAAELFKNHD SFADR  + V
Sbjct  61   VLQQKYGPVLGLKLGPSTNIMVVQTAHAAAELFKNHDTSFADRPMVDV  108



>emb|CBI30226.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   102 bits (253),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ++W    L+W  I +IP ++FLL  ++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIP-VLFLLLHRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRT  102



>gb|AGT03776.1| CYP76 hydroxylase [Withania somnifera]
Length=515

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSY--RlppgppglpVIGNMLDLGAFPHQTI  342
            MEWEW YL +S I L+P  + L +RKK++  Y   LPPGPPGLP+ GN+  LG  P + +
Sbjct  1    MEWEWSYLFFSTIILLPAFILLFSRKKATKCYYNLLPPGPPGLPIFGNVFQLGTEPFKAM  60

Query  343  AEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADR  471
            A ++ KYG V+WL++G S + M + +A+AAAELFKNHD+SFADR
Sbjct  61   ACLEQKYGPVLWLKLGTSTNIMVVQTARAAAELFKNHDISFADR  104



>ref|XP_004249463.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=518

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +SAI  +P L+   ++KKSS   Y LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSAIIFLPILILFFSQKKSSKCCYNLPPGPPGLPIFGNMFELGKEPYKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
             +K KYG V+ L++G S + M + +A+AAAELFKNHD SFADR  + V
Sbjct  61   ALKQKYGPVLGLKLGPSTNIMVVQTAEAAAELFKNHDTSFADRPIVDV  108



>ref|XP_006339110.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=541

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 2/103 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S+I L+P L+   ++KK++  SY+LPPGPPGLP  GNM +LG  P++ +A
Sbjct  1    MEWEWSYLCFSSIILLPVLILFFSQKKTTKCSYKLPPGPPGLPFFGNMFELGTEPYKRMA  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADR  471
             +K KYG V+WL++G S + M + +A AAAELFKNHD SFADR
Sbjct  61   ALKQKYGPVLWLKLGTSTNIMVVQTAPAAAELFKNHDTSFADR  103



>ref|XP_002277725.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=508

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ++W    L+W  I +IP ++FLL  ++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIP-VLFLLLHRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRT  102



>emb|CAN77399.1| hypothetical protein VITISV_015277 [Vitis vinifera]
Length=508

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ++W    L+W  I +IP ++FLL  ++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIP-VLFLLLHRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNXDLCFSDRT  102



>ref|XP_004305369.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=517

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 58/100 (58%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +1

Query  184  KYLVWSAI-FLIPGLVFLLARKKSSSS--YRlppgppglpVIGNMLDLGAFPHQTIAEMK  354
            ++L+W+ +  +IP L+FL  R++S+SS    LPPGPPG P+IGNMLDLG  PH+T  +++
Sbjct  2    EHLLWNFLSLIIPALLFLFIRRRSNSSKELELPPGPPGWPIIGNMLDLGQMPHKTQTKLR  61

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + +G VIWLRIG+ +TMAILSAKAA E FKNHD+SFA+R+
Sbjct  62   HTFGPVIWLRIGARNTMAILSAKAATEFFKNHDISFAERS  101



>ref|XP_006339108.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 77/103 (75%), Gaps = 2/103 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S+I L+   +   ++KKS+   Y+LPPGPPGLP+ GNM +LG  P + ++
Sbjct  1    MEWEWSYLFFSSIILLSVFILFFSQKKSTKCCYKLPPGPPGLPIFGNMFELGTEPFKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADR  471
             +K KYG V+WL++G S + M + +A+AAAELFKNHD+SFADR
Sbjct  61   VLKQKYGPVLWLKLGTSTNIMVVQTAQAAAELFKNHDISFADR  103



>ref|XP_007203742.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
 gb|EMJ04941.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
Length=509

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSY-RlppgppglpVIGNMLDLGAFPHQTIA  345
            MEW W +LV+   FL+P L+FL+ R+ S+SS+ RLPPGPPGLPV GNM DLG  PH+T+ 
Sbjct  2    MEWPWNFLVYFIPFLLPALLFLIRRRSSNSSHHRLPPGPPGLPVFGNMFDLGTMPHKTLT  61

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++ +K+G VIWLR+G+ +TM I SAKAAA+LFK+HD+SFA RT
Sbjct  62   DLTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRT  104



>gb|EYU29599.1| hypothetical protein MIMGU_mgv1a026574mg [Erythranthe guttata]
Length=500

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 73/106 (69%), Gaps = 3/106 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W W   +   I L+     L  R+ S++   LPPGP G PV GNM  LG+ PH+TIA 
Sbjct  1    MDWLWSTFLVCCISLV---AVLYHRRYSTTRANLPPGPRGWPVFGNMFQLGSMPHKTIAG  57

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            +K+ YG V+WLRIGS++TMA+L+A AAAELFKNHD SFA+RT   V
Sbjct  58   LKSHYGPVVWLRIGSINTMALLTAGAAAELFKNHDASFAERTITDV  103



>ref|XP_004303043.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=512

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 72/104 (69%), Gaps = 6/104 (6%)
 Frame = +1

Query  169  MEW-EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglp--VIGNMLDLGAFPHQT  339
            ME+  W +LV+    +IP L+FLL R +S+S       P      ++GNMLDLGA PH+T
Sbjct  1    MEYLPWNFLVY---VVIPSLLFLLIRWRSNSGGEQAFPPGPPGWPILGNMLDLGAMPHKT  57

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            + E+++++GSV+WLR+G  +TM I SAKAA E FKNHD++F +R
Sbjct  58   LTELRHRFGSVLWLRLGVRNTMVIQSAKAATEFFKNHDLTFVER  101



>ref|XP_006430324.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
 gb|ESR43564.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
Length=515

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +1

Query  154  KNF*EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPH  333
            +N  +M+W    LV   IF   G V LL R+KSS   + PPGPPG P+IGNM DLG  PH
Sbjct  11   ENSDQMDW-LGLLVCIIIFSASGAVLLLHRRKSSRPKQHPPGPPGWPIIGNMFDLGTVPH  69

Query  334  QTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +T+ E++ KYG V+WL+ G+++TMAILSAKAA + FKNHD +FA+R
Sbjct  70   RTLTELRQKYGDVLWLKFGAINTMAILSAKAATDFFKNHDSTFAER  115



>gb|AHX24365.1| CYP76A26-like protein [Cinchona calisaya]
Length=516

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 58/106 (55%), Positives = 72/106 (68%), Gaps = 5/106 (5%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLL-----ARKKSSSSYRlppgppglpVIGNMLDLGAFPH  333
            MEW  K L    I +  GLV LL      R ++ SS R PPGPPG P+ GNM DLG  PH
Sbjct  1    MEWTLKSLNPITIAISAGLVILLLISFIKRSRNGSSKRKPPGPPGWPIFGNMFDLGDLPH  60

Query  334  QTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            QT+  +++KYG VIWL++GS++TM + +A AAAELFK HDV FADR
Sbjct  61   QTLYRLRSKYGPVIWLQLGSINTMVVQNAVAAAELFKKHDVPFADR  106



>ref|XP_009603940.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=511

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 53/109 (49%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = +1

Query  169  MEWEWKYLVWS--AIFLIPGLVFLLARKKSSSSYRlppgppglp-VIGNMLDLGAFPHQT  339
            M+W W Y+ WS  +I +   L+    R++S+ + RL P  P    V GNM +LG  PH+T
Sbjct  1    MDWNWDYVFWSITSILIPLLLLLHFHRRRSNKNRRLLPPGPQGWPVFGNMFELGNEPHKT  60

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            +  +K KYGSV+WL++GS++TM ILSA+AAAE FKNHDV+FA+R+   V
Sbjct  61   LMSLKQKYGSVVWLKLGSINTMVILSAEAAAEFFKNHDVAFAERSVTEV  109



>ref|XP_002309107.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
 gb|EEE92630.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
Length=508

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+ DLG+ PH+T+ +M+ KYG+VIWLR+G+++TM ILSAKAA E FKNHD+SFADRT
Sbjct  44   IFGNLFDLGSMPHRTLTDMRQKYGNVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRT  103



>ref|XP_010057042.1| PREDICTED: cytochrome P450 76A2-like [Eucalyptus grandis]
Length=511

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 54/100 (54%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++ S +FL   L F L RKKS S + LPPGP G P+ GN+  LG  PH+T+A ++ KYG
Sbjct  9    FILISIVFLSTALFFSLRRKKSGS-WVLPPGPSGWPIFGNIFSLGTMPHRTVAGLREKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
              IWLR+GS+ TM ILS++ AAE FKN D++FADRT I V
Sbjct  68   PTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDV  107



>ref|XP_007027589.1| Cytochrome P450 76A2 [Theobroma cacao]
 gb|EOY08091.1| Cytochrome P450 76A2 [Theobroma cacao]
Length=598

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 56/101 (55%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W   +LV   IF    ++FL  R+++S+  +LPPGPPG P+IGNM DLG  PH+T+  
Sbjct  90   MDWPTSFLVCLVIF-SSSVLFLFFRRRNSNPGKLPPGPPGWPIIGNMFDLGTMPHRTLTC  148

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +++KYG VIWLR+G+V+TM +LS KAA ELFKNHD+SFA+R
Sbjct  149  LRDKYGPVIWLRLGTVNTMVLLSTKAATELFKNHDLSFAER  189



>ref|XP_009774708.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=508

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/107 (46%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglp-VIGNMLDLGAFPHQTIA  345
            M+W W Y+ WS   ++  L+    R++S+ + RL P       V GNM +LG  PH+T+ 
Sbjct  1    MDWNWDYVFWSITSILILLLLHFHRRRSNKNGRLLPPGSRGWPVFGNMFELGNEPHKTLM  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
             +K KYG V+WL++GS++TM ILSA AA E FKNHDV+FA+R+   V
Sbjct  61   GLKQKYGPVVWLKLGSINTMVILSADAATEFFKNHDVAFAERSVTEV  107



>ref|XP_006482364.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=500

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 58/101 (57%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W    LV   IF   G V LL R KSS   + PPGPPG P+IGNM DLG  PH+T+ E
Sbjct  1    MDW-LGLLVCIIIFSASGAVLLLLRIKSSRPKQHPPGPPGWPIIGNMFDLGTVPHRTLTE  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++ KYG VIWL+ G+++TMAILSAKAA + FKNHD +FA+R
Sbjct  60   LRQKYGDVIWLKFGAINTMAILSAKAATDFFKNHDSTFAER  100



>ref|XP_008392600.1| PREDICTED: cytochrome P450 76A2-like [Malus domestica]
Length=513

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            EW +LV   IF +P LVFL+ R  SSS +R  P  P   PVIGNM DLG  PH+T+ ++ 
Sbjct  9    EWNFLVCLIIFFLPVLVFLIRRSSSSSGHRRLPPGPKGWPVIGNMFDLGTMPHRTLTDLG  68

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +K+G VIWL +G  +TM++ SAKAAAE FKNHD+SF +RT
Sbjct  69   HKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERT  108



>gb|AJD25180.1| cytochrome P450 CYP76A36 [Salvia miltiorrhiza]
Length=513

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 56/108 (52%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKK--SSSSYRlppgppglpVIGNMLDLGAFPHQTI  342
            M+W W   V    FL+P +V L  R++   SS+ RLPPGP G PV GNM +LG  PH+TI
Sbjct  1    MDWIWTLCVG---FLVPFVVLLHYRRQRAGSSASRLPPGPRGWPVFGNMFELGPMPHKTI  57

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            A +  ++G V+WLRIGS+ TM + +A AAA+LFKNHD SF +RT   V
Sbjct  58   AGLSREHGPVVWLRIGSIDTMVVQTAAAAADLFKNHDASFVERTITEV  105



>ref|XP_011019179.1| PREDICTED: cytochrome P450 76A2-like [Populus euphratica]
Length=508

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+ DLG+ PH+T+  M+ KYG VIWLR+G+++TM ILSAKAA E FKNHD+SFADRT
Sbjct  44   VLGNLFDLGSMPHRTLTGMRQKYGDVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRT  103



>gb|KDO61008.1| hypothetical protein CISIN_1g036305mg [Citrus sinensis]
Length=515

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +1

Query  166  EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            +M+W    LV   IF   G V LL R KSS   + PPGPPG P+IGNM DLG  PH+T+ 
Sbjct  15   QMDW-LGLLVCIIIFSASGAVLLLLRIKSSRPKQHPPGPPGWPIIGNMFDLGTVPHRTLT  73

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            E++ KYG VIWL+ G+++TM ILSAKAA + FKNHD +FA+R
Sbjct  74   ELRQKYGDVIWLKFGAINTMVILSAKAATDFFKNHDSTFAER  115



>ref|XP_006339111.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            ME+EW YL +S+  L+   +   ++KK++  SY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEYEWSYLFFSSTILLSIFILFFSKKKTTKCSYKLPPGPPGLPIFGNMFELGTEPYKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
             +K KYG V+ L++G S + M + +A+AAAELFKNHD SFADR  + V
Sbjct  61   ALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPLVDV  108



>ref|XP_010112510.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis]
Length=509

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 54/106 (51%), Positives = 76/106 (72%), Gaps = 9/106 (8%)
 Frame = +1

Query  169  MEWEW----KYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQ  336
            ME  W     ++V S + ++P L     RK +S   RLPPGPPG PV GN  DLG  PH+
Sbjct  1    MECSWVIFLAFIVMSFLLIMPHL-----RKGTSGHRRLPPGPPGWPVFGNTFDLGPMPHR  55

Query  337  TIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++A++++KYG V+WL++G+++TM ILS+KAAAE FKNHD+SF +RT
Sbjct  56   SLAQLRHKYGDVLWLKLGAINTMVILSSKAAAEFFKNHDLSFVERT  101



>gb|AIW00679.1| flavonoid 3',5'-hydroxylase, partial [Paeonia lactiflora]
Length=503

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 74/98 (76%), Gaps = 4/98 (4%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKN  357
            +W  LVW   FL+  LV +++++++    + PPGPPG PVIGN+ DLG  PHQ++  +++
Sbjct  5    DWTSLVWGG-FLLAALVVMVSKRENK---QRPPGPPGWPVIGNLFDLGTMPHQSLYHLRS  60

Query  358  KYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            KYG V+WL+ GS++TM I S KAAA+LFKNHD++F+DR
Sbjct  61   KYGPVLWLKFGSMNTMVIQSPKAAAQLFKNHDLNFSDR  98



>ref|XP_010683910.1| PREDICTED: cytochrome P450 76A2-like [Beta vulgaris subsp. vulgaris]
Length=511

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEW +   +W AIFLI   +F + +++  ++ RLPPGP GLP+IGNM DLG  PH+ +A+
Sbjct  1    MEWPFSIPLW-AIFLIFLPIFTIIQQRIRTTRRLPPGPRGLPIIGNMFDLGTMPHRALAK  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +  K+G VIWLR+GS   M IL+A+ AAE FK+HD+SF DR
Sbjct  60   LGTKHGPVIWLRLGSQRIMVILTAEIAAEFFKHHDLSFVDR  100



>ref|XP_008241318.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +1

Query  169  MEW-EWKYLVWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDLGAFPHQTI  342
            MEW  W +LV+  IFL+P L+FLL R++S S ++ LPPGPPG P+ GNM DLG  PH+T+
Sbjct  1    MEWCSWNFLVYFLIFLLPALLFLLIRRRSKSGNHLLPPGPPGWPIFGNMFDLGTMPHRTL  60

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
             E+  K+G VIWLR+G+ +TM++ SAKAA+E FKNHD+SFA+RT
Sbjct  61   TELTPKFGPVIWLRLGARATMSVQSAKAASEFFKNHDLSFANRT  104



>ref|XP_009616474.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana tomentosiformis]
Length=508

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 85/109 (78%), Gaps = 3/109 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSY-RlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW+Y+ WS I L+P L+ L+A+ KSSSS  +LPPGPPGLP+ GNM DL G+ PH+ +
Sbjct  1    MELEWRYIFWSIIILLPALILLIAKNKSSSSNIKLPPGPPGLPIFGNMFDLAGSEPHKKV  60

Query  343  AEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            A  K KYG ++WL+IG S++T+ + +A+AAAELFKNHDV+FADR  + V
Sbjct  61   ANWKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDV  109



>ref|XP_004249632.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAI-FLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEW W Y+ +S I  L P L F       +   +LPPGP G PV G+ML+LG  PH+T+ 
Sbjct  1    MEWIWGYIFFSIITVLFPFLHFRWRTLLYNVRQQLPPGPRGWPVFGSMLELGNEPHKTLM  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            ++K KYG V+WL++GS++TM ILSAKAA E F+NHD++FA+R+   V
Sbjct  61   DLKQKYGPVVWLKLGSINTMVILSAKAAGEFFRNHDMAFAERSVTEV  107



>ref|XP_009350795.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009350796.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 54/100 (54%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            EW  LV   IF +P L+FL+ R  S+SS+R  P  P   PVIGNM DLG  PH+T+ ++ 
Sbjct  9    EWNLLVCLIIFFLPVLLFLIRRSSSNSSHRRLPPGPKGWPVIGNMFDLGTMPHRTLTDLG  68

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +K+G VIWL +G  +TM++ SAKAAAE FKNHD+SF +RT
Sbjct  69   HKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERT  108



>ref|XP_009334561.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009342774.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 54/100 (54%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            EW  LV   IF +P L+FL+ R  S+SS+R  P  P   PVIGNM DLG  PH+T+ ++ 
Sbjct  9    EWNLLVCLIIFFLPVLLFLIRRSSSNSSHRRLPPGPKGWPVIGNMFDLGTMPHRTLTDLG  68

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +K+G VIWL +G  +TM++ SAKAAAE FKNHD+SF +RT
Sbjct  69   HKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERT  108



>ref|XP_010056841.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW73724.1| hypothetical protein EUGRSUZ_E02332 [Eucalyptus grandis]
Length=511

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++ S +F+   L   L RKKS S   LP GP G P+ GN+  LG  PH+T+A ++ KYG
Sbjct  9    FVLISIVFVSTALFVSLCRKKSGSRV-LPRGPSGWPIFGNIFSLGTMPHRTLAGLREKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
             +IWLR+GS+ TM ILS++ AAE FKN D++FADRT I V
Sbjct  68   PMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDV  107



>ref|XP_010037101.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            LV   I  +   +F+    K S S+RLPPGP   P+ GN+ +LG  PH+T+A ++ KYG 
Sbjct  9    LVLICILFVSTTLFVSFCHKRSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGP  68

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIWLR+GS+ TM ILS++ AAE FKNHD++F +RT
Sbjct  69   VIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERT  103



>ref|XP_010037099.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            LV   I  +   +F+    K S S+RLPPGP   P+ GN+ +LG  PH+T+A ++ KYG 
Sbjct  9    LVLICILFVSTTLFVSFCHKRSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGP  68

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIWLR+GS+ TM ILS++ AAE FKNHD++F +RT
Sbjct  69   VIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERT  103



>ref|XP_004249462.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=499

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWE  YL +S+I L+   +F+L   K +S+Y LPPGPPGLPV GNM +LG   ++ +A 
Sbjct  1    MEWELSYLFFSSIILLS--IFILFFSKKNSTYNLPPGPPGLPVFGNMFELGTESYKKMAA  58

Query  349  MKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            +K KYG V+ L++G S + M + +A+AAAELFKNHD SFADR  + V
Sbjct  59   LKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPQVDV  105



>ref|XP_002277661.2| PREDICTED: cytochrome P450 76A1-like [Vitis vinifera]
Length=518

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 56/101 (55%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = +1

Query  172  EWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEM  351
            +W    L+W  I +IP ++FLL R++ S S RLPPGPPG PV GNM DLGA PH+T+A +
Sbjct  13   DWASNILLWCIILVIP-VLFLLLRRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAGL  71

Query  352  KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT
Sbjct  72   RHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNKDLCFSDRT  112



>gb|KJB62266.1| hypothetical protein B456_009G409000 [Gossypium raimondii]
Length=512

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 49/101 (49%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+    +L+   +F    L   + R+ +S + +LPPGPPG P+ GNM DLG  PH+T+  
Sbjct  1    MDLSPSFLLCFIVFASSALFLFIQRRNNSVTGKLPPGPPGWPIFGNMFDLGTMPHRTLTR  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +++KYG VIWLR+G+V+TM ILS KAA E FKN+D++FA+R
Sbjct  61   LRDKYGQVIWLRLGAVNTMVILSTKAATEFFKNYDLTFAER  101



>ref|XP_007204461.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
 gb|EMJ05660.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
Length=462

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +1

Query  235  LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
            + R+  S ++ LPPGPPG P+ GNM DLG  PH+T+ E+  K+G VIWLR+G+ +TM++ 
Sbjct  23   IRRRSKSGNHLLPPGPPGWPIFGNMFDLGTMPHRTLTELTPKFGPVIWLRLGARATMSVQ  82

Query  415  SAKAAAELFKNHDVSFADRTXIXV  486
            SAKAA+E FKNHD+SFA+RT   V
Sbjct  83   SAKAASEFFKNHDLSFANRTTNEV  106



>gb|AHX24370.1| CYP76A26 [Catharanthus roseus]
Length=515

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 48/91 (53%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +1

Query  199  SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            SA FL+  L+ +  + ++ SS R PPGPPG P+ GNM DLG  PHQT+ ++K+KYG ++W
Sbjct  17   SAGFLL--LLIIFVKSRTGSSKRKPPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVW  74

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            L++GS++TM + +A +AAELFK HDV F DR
Sbjct  75   LQLGSINTMVVQNAVSAAELFKKHDVPFCDR  105



>gb|AHK60833.1| iridoid oxidase [Catharanthus roseus]
Length=515

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 48/91 (53%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +1

Query  199  SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            SA FL+  L+ +  + ++ SS R PPGPPG P+ GNM DLG  PHQT+ ++K+KYG ++W
Sbjct  17   SAGFLL--LLIIFVKSRTGSSKRKPPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVW  74

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            L++GS++TM + +A +AAELFK HDV F DR
Sbjct  75   LQLGSINTMVVQNAVSAAELFKKHDVPFCDR  105



>emb|CBI30225.3| unnamed protein product [Vitis vinifera]
Length=1065

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +1

Query  166  EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            +MEW   +LVW  I  +  L+ LL R KS  +  LPPGPPG P+ GN+ DLG  PHQ +A
Sbjct  530  QMEWTTNFLVWLIIPFLSALLLLLHRLKSGFNKHLPPGPPGWPIFGNIFDLGTLPHQKLA  589

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
             +++ YG V+WL +G + TM + S+KAAAELFKNHD+SF+DR+
Sbjct  590  GLRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRS  632


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V+GN+  LG  PH + A++  K+G ++ L +GS+ST+ I S + A E+FKNHDV  A R
Sbjct  62   VVGNIFQLGWAPHVSFAKLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGR  120



>ref|XP_002277746.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=509

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEW   +LVW  I  +  L+ LL R KS  +  LPPGPPG P+ GN+ DLG  PHQ +A 
Sbjct  1    MEWTTNFLVWLIIPFLSALLLLLHRLKSGFNKHLPPGPPGWPIFGNIFDLGTLPHQKLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +++ YG V+WL +G + TM + S+KAAAELFKNHD+SF+DR+
Sbjct  61   LRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRS  102



>gb|AHX24367.1| CYP76A26-like protein [Rauvolfia serpentina]
Length=514

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +1

Query  208  FLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI  387
            FL+  ++F+ AR++SS   R PPGPPG P+ GNM DLG  PHQT+ ++++KYG ++WL++
Sbjct  19   FLLLLVIFVKARRRSSK--RTPPGPPGWPIFGNMFDLGDLPHQTLYKLRSKYGPIVWLQL  76

Query  388  GSVSTMAILSAKAAAELFKNHDVSFADR  471
            GS++TM + +A +AAELFK HDV F DR
Sbjct  77   GSINTMVVQNAVSAAELFKKHDVPFCDR  104



>ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33750.1| cytochrome P450, putative [Ricinus communis]
Length=512

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+ DLG  PHQT+ +++ KYG V+WLR+GS +TM I SA AA ELFKNHD SF DR+
Sbjct  42   VIGNIFDLGTMPHQTLYKLRFKYGPVLWLRLGSKNTMVIQSAAAAEELFKNHDSSFCDRS  101

Query  475  XIXV  486
             + V
Sbjct  102  SLDV  105



>gb|KEH24104.1| cytochrome P450 family protein [Medicago truncatula]
Length=519

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +1

Query  217  PGLVFLLAR--KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG  390
            P  +FLL R  K S++  RLPPGPPG P+ GNM  LG  PH+T+  ++ KYG V+WL+IG
Sbjct  27   PVFLFLLIRRAKISATKRRLPPGPPGWPIFGNMFQLGEMPHRTLTNLRQKYGPVLWLKIG  86

Query  391  SVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            +V+TMAILSAK A   FKNHD +F+DRT I
Sbjct  87   AVNTMAILSAKEATIFFKNHDHNFSDRTVI  116



>emb|CDP15345.1| unnamed protein product [Coffea canephora]
Length=480

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  232  LLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAI  411
            L+ R+  S   R PPGP G P+ GNM +LG  PHQT+   KNKYG V+WL++GS++TM +
Sbjct  32   LIKRRFGSPDKRRPPGPLGWPIFGNMFELGELPHQTMYRWKNKYGPVMWLQLGSINTMVV  91

Query  412  LSAKAAAELFKNHDVSFADR  471
             +A AAAELFK HDV FADR
Sbjct  92   QNATAAAELFKKHDVPFADR  111



>gb|KDP20523.1| hypothetical protein JCGZ_05069 [Jatropha curcas]
Length=513

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +1

Query  169  MEWEWKYL-VWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVI-GNMLDLGAFPHQTI  342
            MEW +  L  W +   +  +  LL  +KS S  +L P  P   +I GN+ +LG  PHQ +
Sbjct  1    MEWRYSNLFTWFSFLFLATVFLLLKHRKSKSGAKLRPPGPKPWLIFGNIFNLGTTPHQNL  60

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             + + KYG ++WLR+GS++T+ I SAKAA ELFKNHD SF DR
Sbjct  61   YKYRFKYGPILWLRLGSINTLVIQSAKAAEELFKNHDFSFCDR  103



>gb|AHX24369.1| CYP76A26-like protein [Vinca minor]
Length=514

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 3/92 (3%)
 Frame = +1

Query  205  IFLIPGLVFLLA---RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            I +  G +FLLA   + ++ SS R PPGPPG PV GNM DLG  PHQT+ ++++KYG ++
Sbjct  13   ISVAAGFLFLLAIFLKSRTGSSKRRPPGPPGWPVFGNMFDLGDLPHQTLYKLRSKYGPIV  72

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            WL++GS++TM + +A AA ELFK HDV F DR
Sbjct  73   WLQLGSINTMVVQNAVAAGELFKKHDVPFCDR  104



>gb|AHX24366.1| CYP76A26-like protein [Amsonia hubrichtii]
Length=514

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 3/104 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLA---RKKSSSSYRlppgppglpVIGNMLDLGAFPHQT  339
            MEW +  +    I +  G + LL    + +S SS   PPGPPG P+ GNM DLG  PHQT
Sbjct  1    MEWTFDSVNPVTIAVSAGFLLLLVIFVKGRSGSSKSKPPGPPGWPIFGNMFDLGDLPHQT  60

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            + + ++KYG V+WLR+GS++TM + +A +AAELFK HDV F+DR
Sbjct  61   LYKFRSKYGPVVWLRLGSINTMVVQNAVSAAELFKKHDVPFSDR  104



>emb|CBI30232.3| unnamed protein product [Vitis vinifera]
Length=446

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 4/97 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR---KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            L+W + F    L+ LL R   +K S+  R P       ++GN+ DLG  PHQT+  ++++
Sbjct  10   LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWP-ILGNIFDLGTMPHQTLYRLRSQ  68

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            YG V+WL++G+++T+ I SAK AAELFKNHD+ F+DR
Sbjct  69   YGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDR  105



>ref|XP_010057043.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=511

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++ S +F+   L   L RKKS S   L PGP G P+ GN+  LG  PH+ +A +  KYG
Sbjct  9    FVLISIVFVSTALFVSLCRKKSGSRV-LRPGPSGWPIFGNIFSLGTMPHRMLAGLSEKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
             +IWLR+GS+ TM ILS++ AAE FKN D++FADRT I V
Sbjct  68   PMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDV  107



>ref|XP_002283772.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
 ref|XP_010654032.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=511

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 4/97 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR---KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            L+W + F    L+ LL R   +K S+  R P       ++GN+ DLG  PHQT+  ++++
Sbjct  4    LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWP-ILGNIFDLGTMPHQTLYRLRSQ  62

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            YG V+WL++G+++T+ I SAK AAELFKNHD+ F+DR
Sbjct  63   YGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDR  99



>emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera]
Length=511

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 4/97 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR---KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            L+W + F    L+ LL R   +K S+  R P       ++GN+ DLG  PHQT+  ++++
Sbjct  4    LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWP-ILGNIFDLGTMPHQTLYRLRSQ  62

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            YG V+WL++G+++T+ I SAK AAELFKNHD+ F+DR
Sbjct  63   YGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDR  99



>ref|XP_002267565.2| PREDICTED: cytochrome P450 76A2-like [Vitis vinifera]
Length=512

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = +1

Query  196  WSAIFLIPGLVFL-LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            WS  F    L+FL L +    S+   PPGP G P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  11   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLYRLRPQHGPV  70

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +WL++G+++TM + SAKAAAELFKNHD+SF+DR
Sbjct  71   LWLQLGAINTMVVQSAKAAAELFKNHDLSFSDR  103



>ref|XP_006381328.1| hypothetical protein POPTR_0006s11830g, partial [Populus trichocarpa]
 gb|ERP59125.1| hypothetical protein POPTR_0006s11830g, partial [Populus trichocarpa]
Length=343

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V GN+ DLGA PHQT+ ++K KYG VIWL++G  +T+ I SA+ AA LFKNHD++F+DR 
Sbjct  19   VFGNIFDLGAIPHQTLYKLKEKYGPVIWLKLGYTNTLVIQSAETAAGLFKNHDLAFSDRK  78

Query  475  XIXV  486
             + V
Sbjct  79   VLLV  82



>gb|AHX24368.1| CYP76A26-like protein [Tabernaemontana elegans]
Length=514

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLA---RKKSSSSYRlppgppglpVIGNMLDLGAFPHQT  339
            MEW +  +    I +  G + LL    + +S SS R PPGPPG P+ GNM DLG  PHQ+
Sbjct  1    MEWTFDSVNSVTIAVSAGFLLLLVSFVKARSGSSKRRPPGPPGWPIFGNMFDLGDLPHQS  60

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            + ++++KYG ++WL++GS++TM + +A +AAELFK HDV F DR
Sbjct  61   MYKLRSKYGPIVWLQLGSINTMVVQNAVSAAELFKKHDVPFCDR  104



>ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=511

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 49/91 (54%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +1

Query  217  PGLVFLLARKK---SSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI  387
            P  +FLL R++   ++ + RLPPGPPG P+ GNM  LG  PH+T+  ++ KYG ++WL+I
Sbjct  16   PVFLFLLNRRRKISATKNRRLPPGPPGWPIFGNMFQLGEMPHRTLTNLREKYGPILWLKI  75

Query  388  GSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            G+V+TMAILSAK A   FKNHD +F+DRT I
Sbjct  76   GAVNTMAILSAKEATIFFKNHDHAFSDRTVI  106



>ref|XP_006341183.1| PREDICTED: cytochrome P450 76A1-like [Solanum tuberosum]
Length=513

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  169  MEWE--WKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQ  336
            M+WE  + Y++ S I  +   +FL+ +KKSS S + LPPGP GLP+ GNM DL G+ P++
Sbjct  1    MDWELNYFYILCSTIIFLLAFIFLIYQKKSSFSKFNLPPGPNGLPIFGNMFDLAGSEPYK  60

Query  337  TIAEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
             IA +K+KYG ++WL+IG S++TM I +A ++ ELFKNHD  F+DR  I V
Sbjct  61   KIASLKDKYGPILWLKIGPSMNTMVIQTAYSSGELFKNHDAIFSDRNIIDV  111



>gb|KDP27487.1| hypothetical protein JCGZ_20022 [Jatropha curcas]
Length=505

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++GN+LDLG  PH+T+ +++ KYG VI LR+GSV+TM ILSAK A+ELFK HD+SFA+R
Sbjct  41   ILGNLLDLGTMPHRTLTKLREKYGGVIGLRLGSVNTMVILSAKPASELFKYHDLSFAER  99



>ref|XP_010036736.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48374.1| hypothetical protein EUGRSUZ_K02083 [Eucalyptus grandis]
Length=510

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++  A+F+   L+  L R K S S RLPPGPPG P+ GNM +LG  PH+T+A ++ KYG
Sbjct  9    FVLICALFVSATLLVSL-RWKKSRSCRLPPGPPGWPIFGNMFNLGMMPHRTLAGLRQKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
             VIWLR+GS+ TM ILS++ A E FKN D++FA+RT
Sbjct  68   PVIWLRLGSIDTMVILSSRVATEFFKNQDLNFAERT  103



>ref|XP_003520677.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=516

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAK  423
            K SSS++RLPPGPPG PV GNM  LG  PH+T+  +++K+G V+WL+IG+++TMAILSA+
Sbjct  32   KTSSSNHRLPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAILSAE  91

Query  424  AAAELFKNHDVSFADRT  474
            AA   FK+HD +FADRT
Sbjct  92   AATVFFKHHDHAFADRT  108



>ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33748.1| cytochrome P450, putative [Ricinus communis]
Length=502

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++GN+LDLG+ PH T+ +++ KYG ++ LR+G+++T+ ILSAKAA+ELFKNHD++FA+R
Sbjct  43   ILGNLLDLGSVPHSTLTDLRQKYGDILGLRLGAINTVVILSAKAASELFKNHDLTFAER  101



>ref|XP_002283777.2| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=512

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +1

Query  196  WSAIFLIPGLVFL-LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            WS  F    L+FL L +    S+   PPGP G P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  11   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLHRLRPQHGPV  70

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +WL++G+++TM + SAKAAAELFKNHD+ F+DR
Sbjct  71   LWLQLGAINTMVVQSAKAAAELFKNHDLPFSDR  103



>emb|CBI30229.3| unnamed protein product [Vitis vinifera]
Length=514

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 54/126 (43%), Positives = 79/126 (63%), Gaps = 2/126 (2%)
 Frame = +1

Query  100  KHRLTRI*VTWKLQNLKSKNF*EMEWEWKYLV-WSAIFLIPGLVFL-LARKKSSSSYRlp  273
            K  L  + V W     +++   +ME     +V WS  F    L+FL L +    S+   P
Sbjct  25   KKNLYGVHVVWGGPKRRTQAETKMELSTASIVFWSCFFSAALLLFLRLIKFTKGSTKSTP  84

Query  274  pgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHD  453
            PGP G P+ GN+ DLG  PHQT+  ++ ++G V+WL++G+++TM + SAKAAAELFKNHD
Sbjct  85   PGPQGWPIFGNIFDLGTLPHQTLYRLRPQHGPVLWLQLGAINTMVVQSAKAAAELFKNHD  144

Query  454  VSFADR  471
            +SF+DR
Sbjct  145  LSFSDR  150



>ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33756.1| cytochrome P450, putative [Ricinus communis]
Length=515

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +1

Query  190  LVW-SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            L W + +F +  +V L  R+    + + PPGPP  P+IGN+ DLGA PHQ + ++  KYG
Sbjct  10   LAWFTLLFSVTIVVLLKKRRPRHDAKQRPPGPPAWPIIGNIFDLGANPHQNLYKLGFKYG  69

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             V+WLR+G ++TM I SAKAA ELFK+HD+SF DR
Sbjct  70   PVLWLRLGYINTMVIQSAKAAEELFKHHDISFCDR  104



>gb|KCW84346.1| hypothetical protein EUGRSUZ_B011962, partial [Eucalyptus grandis]
Length=169

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+ DLG  PHQ +  ++ K+G V+WL++GSV+TM I SA+AA ELFK HD  FADR
Sbjct  40   VIGNIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADR  98



>gb|KDP43097.1| hypothetical protein JCGZ_27046 [Jatropha curcas]
Length=493

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +1

Query  223  LVFLLARK-KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            L+ L  RK +  ++ R PPGP   P+ GN+LDLG+ PH+T+ +++ KYG V+WLR+G  +
Sbjct  22   LLLLNQRKARHGANRRRPPGPKAWPIFGNILDLGSMPHRTLYKLRFKYGPVLWLRLGCAN  81

Query  400  TMAILSAKAAAELFKNHDVSFADR  471
            T+ I SAKAA ELFKNHD++F+DR
Sbjct  82   TLVIQSAKAAEELFKNHDITFSDR  105



>gb|KCW84357.1| hypothetical protein EUGRSUZ_B012102, partial [Eucalyptus grandis]
Length=166

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+LDLG  PHQ +   + ++G V WL++GSV+TM I SA+AAAE FK HD++FADR
Sbjct  40   VIGNILDLGIMPHQNLHSFRAEHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDLAFADR  98



>gb|KHN18720.1| Cytochrome P450 76A2 [Glycine soja]
Length=516

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAK  423
            K SSS++RLPPGPPG PV GNM  LG  PH+T+  +++K+G V+WL+IG+++TMAI SA+
Sbjct  32   KTSSSNHRLPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAIFSAE  91

Query  424  AAAELFKNHDVSFADRT  474
            AA   FK+HD +FADRT
Sbjct  92   AATVFFKHHDHAFADRT  108



>gb|KCW74002.1| hypothetical protein EUGRSUZ_E02619, partial [Eucalyptus grandis]
Length=482

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+  LG  PH+ +A +  KYG +IWLR+GS+ TM ILS++ AAE FKN D++FADRT
Sbjct  15   IFGNIFSLGTMPHRMLAGLSEKYGPMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRT  74

Query  475  XIXV  486
             I V
Sbjct  75   VIDV  78



>ref|XP_010036151.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW84344.1| hypothetical protein EUGRSUZ_B01192 [Eucalyptus grandis]
Length=507

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+LDLG  PHQ +  ++ K+G V+WL++GSV+TM I SA+AA ELFK HD  FADR
Sbjct  40   VIGNILDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADR  98



>gb|KCW48743.1| hypothetical protein EUGRSUZ_K02382 [Eucalyptus grandis]
Length=488

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  253  SSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAA  432
            S S+RLPPGP   P+ GN+ +LG  P +T+A ++ KYG VIWLR+GS+ TM  LS++ AA
Sbjct  31   SRSHRLPPGPSRWPIFGNLFNLGKMPRRTLAGLREKYGPVIWLRLGSIDTMVTLSSRVAA  90

Query  433  ELFKNHDVSFADRT  474
            E FKNHD++F +RT
Sbjct  91   EFFKNHDLNFVERT  104



>ref|XP_002528650.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33753.1| cytochrome P450, putative [Ricinus communis]
Length=504

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            ++ +F++  +V L  R+   ++ + PPGPP  P+IGN+ DLG  PHQ + +++ KYG V+
Sbjct  16   FTLLFVLTIVVLLKKRRPRHNAKQRPPGPPAWPIIGNIFDLGGNPHQNLYKLRFKYGPVL  75

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            WLR+G ++T+ I S KAA ELFK HD+SF+DR
Sbjct  76   WLRLGCINTLVIQSTKAAEELFKRHDISFSDR  107



>gb|AHX24364.1| CYP76A26-like protein [Lonicera japonica]
Length=510

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V GNM +LG  PHQT+ ++++KYG ++WLR+GS+ T+ + S  AAAELFK HDV+F+DR
Sbjct  46   VFGNMFELGDLPHQTMYKLRSKYGPLVWLRLGSIHTLVVQSPAAAAELFKKHDVAFSDR  104



>dbj|BAC53891.1| cytochrome P450 [Petunia x hybrida]
Length=507

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +1

Query  226  VFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTM  405
            VF    KK+S SY+LPPGP GLP++GNM DLG  PH  +  M+N+YG V+WL+IG+++T+
Sbjct  20   VFFFLLKKTSRSYKLPPGPSGLPIVGNMFDLGDLPHIKMEGMRNQYGPVMWLKIGAINTL  79

Query  406  AILSAKAAAELFKNHDVSF  462
             I SA+AA   FKNHD +F
Sbjct  80   VIQSAQAATAFFKNHDANF  98



>ref|XP_010045880.1| PREDICTED: cytochrome P450 76A1-like, partial [Eucalyptus grandis]
Length=475

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR
Sbjct  8    VIGNILDLGTMPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADR  66



>ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33757.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 67/103 (65%), Gaps = 1/103 (1%)
 Frame = +1

Query  166  EMEWEWKYLVW-SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTI  342
            E  +    L W + +F +   V L  R+    + + PP PPG P+IGN+ DLGA PHQ +
Sbjct  2    EFRYSTYSLAWFTLLFSVTIAVLLTKRRPIHDAKQTPPAPPGWPIIGNIFDLGANPHQNL  61

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             ++  KYG V+WLR+G ++TM I SAKAA ELF++HD+SF DR
Sbjct  62   YKLGIKYGPVLWLRLGYINTMVIQSAKAAEELFRHHDISFCDR  104



>ref|XP_010036177.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+ DLG  PHQ +  ++ K+G V+WL++GSV+TM I SA+AA ELFK HD  FADR
Sbjct  40   VIGNIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADR  98



>gb|KCW84356.1| hypothetical protein EUGRSUZ_B01208 [Eucalyptus grandis]
Length=441

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR
Sbjct  39   VIGNILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADR  97



>gb|KDP24879.1| hypothetical protein JCGZ_25132 [Jatropha curcas]
Length=160

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LR+GSV T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  XIXV  486
               V
Sbjct  104  VPCV  107



>ref|XP_004246574.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1-like [Solanum 
lycopersicum]
Length=512

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 78/110 (71%), Gaps = 4/110 (4%)
 Frame = +1

Query  169  MEWEWK-YLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQT  339
            M+WE+  Y++ S I  +   +FL+ +K SS S Y LPPGP GLP+ GN  DL G+ P++ 
Sbjct  1    MDWEFNFYILCSTIIFLLAFIFLIYQKNSSFSKYNLPPGPNGLPIFGNXFDLAGSEPYKK  60

Query  340  IAEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            IA +K+KYG ++WL+IG S++ M I ++ +++ELFK HDV+F+DR  + V
Sbjct  61   IASLKDKYGPILWLKIGPSMNIMVIQTSYSSSELFKYHDVTFSDRNIVDV  110



>ref|XP_010036187.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADR  97



>ref|XP_010036221.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR
Sbjct  39   VIGNILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADR  97



>gb|AJD20226.1| putative N-methylcoclaurine 3-hydroxylase [Podophyllum peltatum]
 gb|AJD20230.1| corytuberine synthase [Podophyllum peltatum]
Length=510

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLAR----KKSSSSYRlppgppglpVIGNMLDLGAFPHQ  336
            MEW+   LV+S + L    + L+      K ++ S +LPPGPPG P+ GNM DLG+ P++
Sbjct  1    MEWDLILLVFSTVCLATAFLLLIPSRIKPKPNAGSRKLPPGPPGWPLFGNMFDLGSTPNE  60

Query  337  TIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
             +A +  KYG V+WLR+G  +T+ I S +AA E+FKNHD++F +R 
Sbjct  61   ALANLSKKYGPVLWLRLGLQNTIVISSTEAAMEMFKNHDLTFVNRN  106



>gb|KCW84354.1| hypothetical protein EUGRSUZ_B01206 [Eucalyptus grandis]
Length=498

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADR  97



>ref|XP_010045881.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+LDLG   HQ +  ++ K+G V+WL++GSV+T+AI SA+AA ELFK HD  FADR
Sbjct  40   VIGNILDLGTMAHQNLHNLRAKHGPVLWLKLGSVNTVAIQSAQAAMELFKGHDFVFADR  98



>ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33752.1| cytochrome P450, putative [Ricinus communis]
Length=524

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            + GN+ DLG  PH+ + + + KYG V+WLR+G  +T+ I SA+AA ELFKNHD+SF DR
Sbjct  56   IFGNIFDLGTIPHRNLYKFRYKYGPVLWLRLGFTNTLVIQSARAAEELFKNHDISFCDR  114



>ref|XP_010036165.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AA E FK HD +FADR
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAATEFFKGHDFAFADR  97



>gb|KDP24880.1| hypothetical protein JCGZ_25133 [Jatropha curcas]
Length=510

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LR+GSV T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  103



>gb|KCW74001.1| hypothetical protein EUGRSUZ_E02618 [Eucalyptus grandis]
Length=458

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  328  PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            PH+T+A ++ KYG  IWLR+GS+ TM ILS++ AAE FKN D++FADRT I V
Sbjct  2    PHRTVAGLREKYGPTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDV  54



>ref|XP_007162842.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
 gb|ESW34836.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
Length=515

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +1

Query  241  RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            RK ++ + RLPPGPPG P+ GN+  LG  PH+T+A+++ K+G V+WL+IG++ TM ILSA
Sbjct  26   RKTAARNRRLPPGPPGWPIFGNLFQLGDMPHRTLADLRAKHGPVVWLQIGAMKTMVILSA  85

Query  421  KAAAELFKNHDVSFADRT  474
             AA+  FK+HD +FADRT
Sbjct  86   DAASVFFKHHDHAFADRT  103



>ref|XP_011094434.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 0/101 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEW    +   AI +  GL+ L+   +  +S + PPGP G+P+ GN+L LG  PH+T+ +
Sbjct  1    MEWALTSINPLAISIFAGLLLLVLFLRPKNSGKKPPGPKGVPIFGNLLQLGDLPHETMHK  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             K  YG VIWL++GSV TM +  A +A+ELFK HD+ FADR
Sbjct  61   WKQTYGPVIWLKLGSVYTMVVQDAASASELFKKHDLPFADR  101



>gb|KDP43102.1| hypothetical protein JCGZ_27051 [Jatropha curcas]
Length=512

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            + GN+L LG+ PH+T+  ++ KYG V+WL +G  +T+ I SAKAA ELFKNHD++F+DR
Sbjct  47   IFGNILHLGSMPHRTLYNLRFKYGPVLWLSLGCSNTLVIQSAKAAEELFKNHDITFSDR  105



>ref|XP_009786696.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana sylvestris]
Length=508

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 83/109 (76%), Gaps = 3/109 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLA-RKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW Y+ WS I L+P L+ L+  +K SSS+ +LPPGPPGLP+ GNM DL G+ P++  
Sbjct  1    MELEWSYIFWSIIILLPALILLITKKKSSSSNIKLPPGPPGLPIFGNMFDLAGSEPYKKA  60

Query  343  AEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            A +K KYG ++WL+IG S++T+ + +A+AAAELFKNHDV+FADR  + V
Sbjct  61   ANLKQKYGPIVWLKIGPSMNTIIVQTAQAAAELFKNHDVTFADRYIVDV  109



>gb|KDP26153.1| hypothetical protein JCGZ_22834 [Jatropha curcas]
Length=510

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LRIGSV T+ I SAKAA ELFKNHD SF  RT
Sbjct  44   LVGNIFDLGTLAHRILYELKFKYGPVLRLRIGSVDTVVIQSAKAAMELFKNHDASFCART  103



>gb|KDP26150.1| hypothetical protein JCGZ_22831 [Jatropha curcas]
Length=162

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+  LG   H+ + E K KYG V+ LRIGS+ T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFYLGTLAHRILYEHKFKYGPVLRLRIGSMDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  XIXV  486
               V
Sbjct  104  VPCV  107



>gb|KDO61009.1| hypothetical protein CISIN_1g010359mg [Citrus sinensis]
Length=512

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            + GN  DLG  PHQ++ +++ KYG V+WL++GSV+T+ I SAKAA E+FKN D  F DR
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDR  104



>ref|XP_006481913.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=512

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            + GN  DLG  PHQ++ +++ KYG V+WL++GSV+T+ I SAKAA E+FKN D  F DR
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDR  104



>ref|XP_006430323.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
 gb|ESR43563.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
Length=512

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            + GN  DLG  PHQ++ +++ KYG V+WL++GSV+T+ I SAKAA E+FKN D  F DR
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDR  104



>gb|KCW48764.1| hypothetical protein EUGRSUZ_K02408, partial [Eucalyptus grandis]
Length=443

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  328  PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            PH+T+A ++ KYG VIWLR+GS+ TM ILS++ AAE FKNHD++F +RT
Sbjct  2    PHRTLAGLREKYGPVIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERT  50



>sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; 
AltName: Full=Cytochrome P-450EG8, partial [Solanum melongena]
 emb|CAA50649.1| unnamed protein product [Solanum melongena]
Length=467

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +1

Query  301  GNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRT  474
            GNM DL G+ P++ IA +K KYG ++WL+IGS ++TM I +A +A+ELF+NHDVSF+DR 
Sbjct  2    GNMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRP  61

Query  475  XIXV  486
             + V
Sbjct  62   IVDV  65



>ref|XP_011094433.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +GN+ DLG  PHQT  +++ KYG VIWL++G+V+TM + SA+ A ELFK  D+ FADR
Sbjct  45   VGNIFDLGEIPHQTFYQLQAKYGPVIWLKLGAVNTMVVQSAETATELFKKCDLPFADR  102



>gb|KDP39088.1| hypothetical protein JCGZ_00845 [Jatropha curcas]
Length=460

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 65/102 (64%), Gaps = 1/102 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIA  345
            ME+  ++ ++SA+      +FLL RK  +SS +  PGP  LP+IGNM  L G+ PH  + 
Sbjct  1    MEYLQQFSIFSALVTFLLFIFLLQRKPKTSSRKSAPGPWKLPIIGNMHQLLGSLPHHRLK  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++ +KYGSV+ L++G VS + I S +AA ++ K HD+ F  R
Sbjct  61   DLSDKYGSVMNLQLGQVSNIVISSPEAAKQVMKTHDIIFVQR  102



>gb|KDP27489.1| hypothetical protein JCGZ_20024 [Jatropha curcas]
Length=510

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  304  NMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            N+ DLG   H+ + E+K KYG V+ LRIG V T+ I SAKA  ELFKNHD SF DRT
Sbjct  47   NIFDLGTMAHRILYELKFKYGPVLRLRIGLVDTVVIQSAKAVMELFKNHDASFCDRT  103



>gb|KDP26151.1| hypothetical protein JCGZ_22832 [Jatropha curcas]
Length=56

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  331  HQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            H  + E+K KYG V+ LRIGSV TM I SAKAA ELFKNHD SF D+T
Sbjct  3    HWFLYELKFKYGPVLRLRIGSVDTMVIQSAKAAVELFKNHDASFYDQT  50



>ref|XP_003630839.1| Cytochrome P450 [Medicago truncatula]
 gb|AET05315.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=283

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +L+++ IF++  +   L RK+     R PPGP G PVIGN+  LG  PH+ +  +  K+G
Sbjct  9    FLIFTLIFILSAITLFLRRKQPKYDRRQPPGPRGYPVIGNLHLLGTLPHRALQALSKKHG  68

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
             ++ LR+G V T+ + S+ AA +  K HDV F+ R  +
Sbjct  69   PIMLLRLGQVPTIIVSSSSAAEQFLKTHDVVFSSRPKL  106



>emb|CAN77400.1| hypothetical protein VITISV_015278 [Vitis vinifera]
Length=456

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  328  PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            PH+T+A +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT
Sbjct  2    PHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRT  50



>gb|ADD91442.1| cytochrome P450 [Nicotiana tabacum]
Length=252

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLL--ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKY  363
            LV +++FL    VFL+  A K+ S + +LPPGP  LPVIGN+L +G  PH+++ ++ N+Y
Sbjct  5    LVVASLFL---FVFLILSATKRKSKAKKLPPGPRKLPVIGNLLQIGKLPHRSLQKLSNEY  61

Query  364  GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            G  I+L++GSV T+ + SA  A E+F+  D+ F+ R  +
Sbjct  62   GDFIFLQLGSVPTVVVFSAGIAREIFRTQDLVFSGRPAL  100



>ref|XP_010910705.1| PREDICTED: cytochrome P450 71B9-like, partial [Elaeis guineensis]
Length=141

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ME+      +  IFLIP +  LL  K +  S RLPPGP   P IGN+  LG  PH+++  
Sbjct  1    MEFLLALFAYLCIFLIP-IAILLYVKATRLSLRLPPGPIRFPFIGNLHQLGELPHRSLRL  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            +  KYG ++ L++G + T+ I S++ A+E+ K HD+ F  R  +
Sbjct  60   LSEKYGPLMSLKLGCIPTIIISSSEMASEILKTHDLVFCTRPPL  103



>ref|XP_008439074.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=500

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  LG +PH+++ ++  KYGS+++L++GS  T+ + SA    E+FKNHD++F++R
Sbjct  40   IIGNLHQLGRYPHRSLQDLSKKYGSLMFLQLGSTPTLVVSSADMVREIFKNHDITFSNR  98



>ref|XP_010053381.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77659.1| hypothetical protein EUGRSUZ_D01958 [Eucalyptus grandis]
Length=499

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/95 (45%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            YL WS   L+  L F+  +K   S   LPPGPP LPVIGN+L+LG  PH+++A++ + YG
Sbjct  11   YLAWS---LVQALRFI-TKKTKPSPSNLPPGPPPLPVIGNLLELGNLPHKSLAKLAHTYG  66

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             +I L++G+++T+ I S   + E+ + HDVSFA+R
Sbjct  67   PIIKLQLGAITTVVISSPTLSREILQTHDVSFANR  101



>gb|AJD25179.1| cytochrome P450 CYP76A35 [Salvia miltiorrhiza]
Length=503

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            L W  I  +  L+F    K  SS  RLPPGPPG P+IGN+ DLG  PH+    ++++YG 
Sbjct  7    LTWFTISFLVALLFWFKLKNRSSKLRLPPGPPGWPIIGNIFDLGTQPHRDFHILQSRYGP  66

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V+WL++G+++T+ + SA AAAELFK +D++FADR
Sbjct  67   VLWLKLGNLNTVVVQSAAAAAELFKRNDLAFADR  100



>dbj|BAH84782.1| cytochrome P450 [Nicotiana tabacum]
 gb|ADD91443.1| cytochrome P450 [Nicotiana tabacum]
Length=500

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            LV +++FL   L+ L A K+ S + +LPPGP  LPVIGN+L +G  PH+++ ++ N+YG 
Sbjct  5    LVVASLFLFVFLI-LSATKRKSKAKKLPPGPRKLPVIGNLLQIGKLPHRSLQKLSNEYGD  63

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
             I+L++GSV T+ + SA  A E+F+  D+ F+ R  +
Sbjct  64   FIFLQLGSVPTVVVFSAGIAREIFRTQDLVFSGRPAL  100



>gb|KEH28162.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=116

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +1

Query  235  LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
            L  K+ + +++ PPGPP LP+IGN+  LG  PH+T+  +  KYG ++ L++G V T+ I 
Sbjct  27   LHPKQKNINHKKPPGPPTLPIIGNLHLLGKLPHRTLQSLSKKYGPIMSLQLGQVPTIIIS  86

Query  415  SAKAAAELFKNHDVSFADRTXI  480
            S+KAA    K HD+ FA R  I
Sbjct  87   SSKAAESFLKTHDIKFASRPKI  108



>ref|XP_010502542.1| PREDICTED: cytochrome P450 71B35-like isoform X3 [Camelina sativa]
Length=116

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 59/98 (60%), Gaps = 7/98 (7%)
 Frame = +1

Query  193  VW--SAIFLIPGLVFLLA--RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            +W  S +FLI    FLLA    K    YR  P PPGLPVIGN+  +G  PHQ++ ++  K
Sbjct  4    IWLLSLVFLI---CFLLAVYNHKKHRKYRQLPSPPGLPVIGNLHQIGELPHQSLWKLSKK  60

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            YG V+ L++G V T+ + SA+ A ++ K HD++   R 
Sbjct  61   YGPVMHLKLGRVPTVVVSSAETARQVLKVHDLNCCTRP  98



>gb|KCW80419.1| hypothetical protein EUGRSUZ_C01775 [Eucalyptus grandis]
Length=354

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +1

Query  208  FLIPGL-VFLLARKKSSSSYRlppg-ppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
             +IP L VF +  KK + ++R  P  P  LP+IGN+  LG+ PH+++A +  +YG ++ L
Sbjct  13   LVIPLLAVFFIDTKKKTRAFRNLPPGPRKLPIIGNLHQLGSLPHRSLARLSKQYGQIMLL  72

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             +GS+ T+ I S   A E+FK+HD +F+ R
Sbjct  73   HLGSIPTLVISSEDVAREVFKDHDTAFSGR  102



>ref|XP_006841384.1| hypothetical protein AMTR_s00181p00056510 [Amborella trichopoda]
 gb|ERN03059.1| hypothetical protein AMTR_s00181p00056510 [Amborella trichopoda]
Length=504

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            ++W+ +F +  L   L  K+S +  +LPPGP GLP+IGN+  LG+ PH+++A +   YG 
Sbjct  9    ILWTFLFSVLSLQLFLLWKRSGTRKKLPPGPIGLPIIGNLHQLGSMPHRSLAHLAEGYGP  68

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++ LRIG V T+ + S+K A ++ K HD++F  R
Sbjct  69   LMHLRIGQVPTLVVSSSKMAEQVMKAHDLAFCSR  102



>dbj|BAK04621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 69/99 (70%), Gaps = 7/99 (7%)
 Frame = +1

Query  196  WSAIFLIPGLVFL------LARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMK  354
            W ++  I G   L      L+R+K++ + +LPPGP  LP+IG++L + GAFPH+TIAE+ 
Sbjct  4    WLSLCFIAGSTLLSIWFLVLSRRKNNPNKKLPPGPWTLPIIGSLLHVVGAFPHRTIAELS  63

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             ++G ++ LR+G V+TM + SA+ AA + K +D++F+DR
Sbjct  64   RRHGPLMHLRLGEVATMVVSSAEVAALVMKTNDLTFSDR  102



>ref|XP_009620580.1| PREDICTED: cytochrome P450 71A9-like [Nicotiana tomentosiformis]
Length=500

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            LV +++FL   L+ L A K+ S + +LPPGP  LPVIGN+L +G  PH+++ ++ N+YG 
Sbjct  5    LVVASLFLFVFLI-LSATKRKSKAKKLPPGPRKLPVIGNLLQIGKLPHRSLQKLSNEYGD  63

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
             I+L++GSV T+ + SA  A E+F+  D+ F+ R  +
Sbjct  64   FIFLQLGSVPTVVVSSAGIAREIFRTQDLVFSGRPAL  100



>ref|XP_003631427.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661621.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661624.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661630.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661639.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=499

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            + W++I+++    F + R    ++Y+LPPGP  LP+IGN+L+LG  PH+++AE+   YG 
Sbjct  12   VAWTSIYIM----FSVRRGSQHTAYKLPPGPVPLPIIGNLLNLGNRPHESLAELAKTYGP  67

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++ L++G V+T+ I SA  A E+ +  D+SF +R
Sbjct  68   IMTLKLGYVTTIVISSAPMAKEVLQKQDLSFCNR  101



>ref|XP_004248583.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
lycopersicum]
Length=469

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PH T+ +M N+YG ++ LR G V T+ + SA+AA E+ K HD+ FADR
Sbjct  45   LIGNLHQLMGSLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADR  104

Query  472  TXIXV  486
              I V
Sbjct  105  PKILV  109



>gb|KCW80420.1| hypothetical protein EUGRSUZ_C01775 [Eucalyptus grandis]
 gb|KCW80421.1| hypothetical protein EUGRSUZ_C01775 [Eucalyptus grandis]
Length=408

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +1

Query  208  FLIPGL-VFLLARKKSSSSYRlppg-ppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
             +IP L VF +  KK + ++R  P  P  LP+IGN+  LG+ PH+++A +  +YG ++ L
Sbjct  13   LVIPLLAVFFIDTKKKTRAFRNLPPGPRKLPIIGNLHQLGSLPHRSLARLSKQYGQIMLL  72

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             +GS+ T+ I S   A E+FK+HD +F+ R
Sbjct  73   HLGSIPTLVISSEDVAREVFKDHDTAFSGR  102



>gb|KCW83246.1| hypothetical protein EUGRSUZ_B00186 [Eucalyptus grandis]
Length=469

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  223  LVFLL-ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LV L+  +KK  +S  LPPGP  LP+IGN+  LG+ PH+++A++  +YG +++L++GS+ 
Sbjct  20   LVLLIDTKKKRKASRNLPPGPRKLPIIGNLHQLGSLPHRSLAQLSKRYGQIMFLQLGSIP  79

Query  400  TMAILSAKAAAELFKNHDVSFADR  471
            T+ I S + A E+FK HD +F+ R
Sbjct  80   TLVISSEEVAREVFKAHDRAFSGR  103



>ref|XP_010502540.1| PREDICTED: cytochrome P450 71B35-like isoform X1 [Camelina sativa]
Length=135

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = +1

Query  199  SAIFLIPGLVFLLA--RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            S +FLI    FLLA    K    YR  P PPGLPVIGN+  +G  PHQ++ ++  KYG V
Sbjct  8    SLVFLI---CFLLAVYNHKKHRKYRQLPSPPGLPVIGNLHQIGELPHQSLWKLSKKYGPV  64

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            + L++G V T+ + SA+ A ++ K HD++   R  +
Sbjct  65   MHLKLGRVPTVVVSSAETARQVLKVHDLNCCTRPGL  100



>gb|KCW80422.1| hypothetical protein EUGRSUZ_C01775 [Eucalyptus grandis]
Length=409

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +1

Query  208  FLIPGL-VFLLARKKSSSSYRlppg-ppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
             +IP L VF +  KK + ++R  P  P  LP+IGN+  LG+ PH+++A +  +YG ++ L
Sbjct  13   LVIPLLAVFFIDTKKKTRAFRNLPPGPRKLPIIGNLHQLGSLPHRSLARLSKQYGQIMLL  72

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             +GS+ T+ I S   A E+FK+HD +F+ R
Sbjct  73   HLGSIPTLVISSEDVAREVFKDHDTAFSGR  102



>ref|XP_006350771.1| PREDICTED: cytochrome P450 71A9-like, partial [Solanum tuberosum]
Length=496

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  LG  PH+++ ++ N+YG +I+L++GS+ T+ + SA  A E+F+ HDV+FA R
Sbjct  35   IIGNLHQLGKLPHRSLQKLSNEYGDLIFLQLGSIPTLLVSSADVAKEIFRVHDVAFAGR  93



>ref|XP_010502541.1| PREDICTED: cytochrome P450 71B35-like isoform X2 [Camelina sativa]
Length=125

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 5/94 (5%)
 Frame = +1

Query  199  SAIFLIPGLVFLLA--RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            S +FLI    FLLA    K    YR  P PPGLPVIGN+  +G  PHQ++ ++  KYG V
Sbjct  8    SLVFLI---CFLLAVYNHKKHRKYRQLPSPPGLPVIGNLHQIGELPHQSLWKLSKKYGPV  64

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + L++G V T+ + SA+ A ++ K HD++   R 
Sbjct  65   MHLKLGRVPTVVVSSAETARQVLKVHDLNCCTRP  98



>ref|XP_003615665.1| Cytochrome P450 [Medicago truncatula]
 ref|XP_003615670.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98623.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AES98628.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=510

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  229  FLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMA  408
            F L  K+++ +++ PPGPP LP+IGN+  LG  PH+T+  +  KYGS++ L++G V T+ 
Sbjct  22   FYLREKQNTINHKKPPGPPTLPIIGNLHMLGKLPHRTLQSLSKKYGSIMSLQLGQVPTIV  81

Query  409  ILSAKAAAELFKNHDVSFADR  471
            I S+KAA    K HD++FA R
Sbjct  82   ISSSKAAESFLKTHDINFASR  102



>ref|XP_010910057.1| PREDICTED: cytochrome P450 71A9-like, partial [Elaeis guineensis]
Length=195

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ME      V+S + LI   VFL A K +  S RLPPGP  LP+IGN+  LG  P++ +  
Sbjct  1    MECSVALFVYSCLLLISIAVFLHA-KATGPSLRLPPGPERLPIIGNLQQLGELPYRPLRL  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            + +KYG ++ L++GS+ T+ I ++  A E+ K  D++F  R  +
Sbjct  60   LSDKYGPLMSLKLGSIPTLIISASDMAREILKTQDLNFCTRAPL  103



>emb|CBI14915.3| unnamed protein product [Vitis vinifera]
Length=416

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  241  RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            ++KS +S RLPPGP  LP+IGN+  LG+ PH  +  + N+YG +++L++GSV T+ + SA
Sbjct  71   KRKSVASRRLPPGPKKLPLIGNLHQLGSLPHVGLQRLSNEYGPLMYLKLGSVPTLVVSSA  130

Query  421  KAAAELFKNHDVSFADRT  474
              A E+F+ HD+ F+ R 
Sbjct  131  DMAREIFREHDLVFSSRP  148



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PH T+ +M N+YG ++ LR G V T+ + SA+AA E+ K HD+ FADR
Sbjct  45   LIGNLHQLMGSLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADR  104

Query  472  TXIXV  486
              I V
Sbjct  105  PKILV  109



>ref|XP_010048230.1| PREDICTED: cytochrome P450 71A9-like [Eucalyptus grandis]
 gb|KCW80418.1| hypothetical protein EUGRSUZ_C01775 [Eucalyptus grandis]
Length=500

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/90 (38%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query  208  FLIPGL-VFLLARKKSSSSYRlppgppglp-VIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
             +IP L VF +  KK + ++R  P  P    +IGN+  LG+ PH+++A +  +YG ++ L
Sbjct  13   LVIPLLAVFFIDTKKKTRAFRNLPPGPRKLPIIGNLHQLGSLPHRSLARLSKQYGQIMLL  72

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             +GS+ T+ I S   A E+FK+HD +F+ R
Sbjct  73   HLGSIPTLVISSEDVAREVFKDHDTAFSGR  102



>ref|XP_006341719.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PH T+ +M N+YG ++ LR G V T+ + SA+AA E+ K HD+ FADR
Sbjct  45   LIGNLHQLMGSLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADR  104

Query  472  TXIXV  486
              I V
Sbjct  105  PKILV  109



>ref|XP_006477330.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LGA PH+++A++   YG V+ L+ G V+T+ I SA  A E+ +N D SF +RT
Sbjct  43   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  102



>ref|XP_006477329.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LGA PH+++A++   YG V+ L+ G V+T+ I SA  A E+ +N D SF +RT
Sbjct  43   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  102



>ref|XP_006419188.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
 gb|ESR32428.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
Length=499

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LGA PH+++A++   YG V+ L+ G V+T+ I SA  A E+ +N D SF +RT
Sbjct  43   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  102



>ref|XP_006440463.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
 gb|ESR53703.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
Length=536

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LGA PH+++A++   YG V+ L+ G V+T+ I SA  A E+ +N D SF +RT
Sbjct  80   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  139



>ref|XP_007034575.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY05501.1| Cytochrome P450, putative [Theobroma cacao]
Length=551

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+LDLG  PH+++AE+   +G ++ L++GS++T+ + SA  A E+ +NHD++F++RT
Sbjct  98   ILGNLLDLGDKPHKSLAELAKTHGPLMSLKLGSLTTIVVSSAAMAKEVLQNHDLTFSNRT  157



>ref|XP_004236286.1| PREDICTED: cytochrome P450 71A22-like [Solanum lycopersicum]
Length=522

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +1

Query  208  FLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI  387
             LI  LV  L   KS +   LPP PP LP IG+M  LG +PH ++ ++  +YG +++L++
Sbjct  26   LLISFLVMSLLMSKSKTKKNLPPSPPKLPFIGHMHKLGVYPHHSLHKLAQQYGPLMFLKL  85

Query  388  GSVSTMAILSAKAAAELFKNHDVSFADR  471
            GSV+T+ + SA+AA+E+ K HD+ F DR
Sbjct  86   GSVNTLVVSSAEAASEIMKTHDLVFCDR  113



>ref|XP_010027022.1| PREDICTED: cytochrome P450 71A9-like [Eucalyptus grandis]
Length=527

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +1

Query  205  IFLIP-GLVFLL-ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            +  +P  LV L+  +KK  +S  LPPGP  LP+IGN+  LG+ PH+++A++  +YG +++
Sbjct  39   VLAVPLSLVLLIDTKKKRKASRNLPPGPRKLPIIGNLHQLGSLPHRSLAQLSKRYGQIMF  98

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            L++GS+ T+ I S + A E+FK HD +F+ R
Sbjct  99   LQLGSIPTLVISSEEVAREVFKAHDRTFSGR  129



>gb|EYU22208.1| hypothetical protein MIMGU_mgv1a024264mg [Erythranthe guttata]
Length=468

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = +1

Query  205  IFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR  384
            I LIP +  LL +KK++    LPPGP  LP+IGN+  LG  PH+T+  +  KYG++++L+
Sbjct  14   ITLIPFICVLLIKKKTN----LPPGPKKLPIIGNLHQLGKLPHRTLRNLSKKYGNLMFLQ  69

Query  385  IGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            +G V T+ I SA  A E+FK+HD+ F+ R  +
Sbjct  70   LGFVPTIVISSADVAREVFKSHDLVFSGRPSL  101



>gb|EYU24235.1| hypothetical protein MIMGU_mgv1a005267mg [Erythranthe guttata]
Length=491

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +1

Query  205  IFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR  384
            I LIP +  LL +KK++    LPPGP  LP+IGN+  LG  PH+T+  +  KYG +++L+
Sbjct  14   ITLIPFIFVLLIKKKTN----LPPGPKKLPIIGNLHQLGKLPHRTLRNLSEKYGDLMFLQ  69

Query  385  IGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            +G V T+ I SA  A E+FK+HD+ F+ R  +
Sbjct  70   LGFVPTIVISSADVAREIFKSHDLVFSGRPSL  101



>ref|NP_001239692.1| cytochrome P450 71A9 precursor [Glycine max]
 sp|O81970.1|C71A9_SOYBN RecName: Full=Cytochrome P450 71A9; AltName: Full=Cytochrome 
P450 CP1 [Glycine max]
 emb|CAA71513.1| putative cytochrome P450 [Glycine max]
Length=499

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTX  477
            IGN+  LG  PHQ++  + NK+G +++L++GS+ T+ + SA+ A E+FKNHD  F+ R  
Sbjct  43   IGNLHQLGTLPHQSLQYLSNKHGPLMFLQLGSIPTLVVSSAEMAREIFKNHDSVFSGRPS  102

Query  478  I  480
            +
Sbjct  103  L  103



>gb|ACU20174.1| unknown [Glycine max]
Length=499

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTX  477
            IGN+  LG  PHQ++  + NK+G +++L++GS+ T+ + SA+ A E+FKNHD  F+ R  
Sbjct  43   IGNLHQLGTLPHQSLQYLSNKHGPLMFLQLGSIPTLVVSSAEMAREIFKNHDSVFSGRPS  102

Query  478  I  480
            +
Sbjct  103  L  103



>gb|KCW80424.1| hypothetical protein EUGRSUZ_C01776 [Eucalyptus grandis]
Length=466

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = +1

Query  223  LVFLLARKKSSSSYRlppg-ppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LVFL+  KK++ + R  P  P  LP+IGN+  LG+ PHQ++  +  +YG ++ L++G V 
Sbjct  39   LVFLIDTKKNTRASRNLPPGPRKLPIIGNLHQLGSPPHQSLTRLSKQYGEIMLLQLGVVP  98

Query  400  TMAILSAKAAAELFKNHDVSFADRT  474
            T+ I S   A E+FK HD++F+ R 
Sbjct  99   TLVISSEDVAREVFKVHDIAFSGRP  123



>ref|XP_010663828.1| PREDICTED: cytochrome P450 71A9-like [Vitis vinifera]
Length=511

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  241  RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            ++KS +S RLPPGP  LP+IGN+  LG+ PH  +  + N+YG +++L++GSV T+ + SA
Sbjct  38   KRKSVASRRLPPGPKKLPLIGNLHQLGSLPHVGLQRLSNEYGPLMYLKLGSVPTLVVSSA  97

Query  421  KAAAELFKNHDVSFADR  471
              A E+F+ HD+ F+ R
Sbjct  98   DMAREIFREHDLVFSSR  114



>gb|KDO36667.1| hypothetical protein CISIN_1g011040mg [Citrus sinensis]
Length=495

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+L+LG  PH+++A++   YG ++ LR+G V+T+ + S   A  + +NHD+SF DR
Sbjct  41   VIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQNHDLSFCDR  99



>ref|XP_006423653.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
 gb|ESR36893.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
Length=495

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+L+LG  PH+++A++   YG ++ LR+G V+T+ + S   A  + +NHD+SF DR
Sbjct  41   VIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQNHDLSFCDR  99



>ref|XP_010040683.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=498

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LG  PH+++A++   YG +I L++G V+T+ I S   A E+ ++HD +FA+RT
Sbjct  43   VIGNLLELGNLPHKSLAKLARTYGPIIKLQLGFVTTVVISSPTIAKEILRSHDATFANRT  102



>ref|XP_006351420.1| PREDICTED: cytochrome P450 71A22-like [Solanum tuberosum]
Length=518

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +1

Query  208  FLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI  387
             LI  +V  L   KS +   LPP PP LP+IG+M  LG +PH ++ ++  +YG +++L++
Sbjct  22   LLISFVVMSLLMTKSKTKKNLPPSPPKLPLIGHMHKLGVYPHHSLHKLAQQYGPLMFLKL  81

Query  388  GSVSTMAILSAKAAAELFKNHDVSFADR  471
            GSV+T+ + SA+AA+E+ K HD+ F DR
Sbjct  82   GSVNTLVVSSAEAASEIMKTHDLVFCDR  109



>ref|XP_006487694.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+L+LG  PH+++A++   YG ++ LR+G V+T+ + S   A  + +NHD+SF DR
Sbjct  41   VIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQNHDLSFCDR  99



>gb|KCW45005.1| hypothetical protein EUGRSUZ_L01405, partial [Eucalyptus grandis]
Length=511

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LG  PH+++A++   YG +I L++G V+T+ I S   A E+ ++HD +FA+RT
Sbjct  43   VIGNLLELGNLPHKSLAKLARTYGPIIKLQLGFVTTVVISSPTIAKEILRSHDATFANRT  102



>ref|XP_002323081.2| hypothetical protein POPTR_0016s14440g [Populus trichocarpa]
 gb|EEF04842.2| hypothetical protein POPTR_0016s14440g [Populus trichocarpa]
Length=523

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            YLV+  IFL    +  L +   S    LPP PP LPVIGN+  LG  PH+++  +  KYG
Sbjct  30   YLVFFLIFL--SFILFLFKLTRSRKLNLPPSPPKLPVIGNIHHLGTLPHRSLQALSEKYG  87

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             ++ L +G V T+ + SA+AA+E+ K HD+ FA+R
Sbjct  88   PLMLLHMGHVPTLIVSSAEAASEIMKTHDIVFANR  122



>ref|XP_002323082.2| hypothetical protein POPTR_0016s14440g [Populus trichocarpa]
 gb|EEF04843.2| hypothetical protein POPTR_0016s14440g [Populus trichocarpa]
Length=373

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            YLV+  IFL    +  L +   S    LPP PP LPVIGN+  LG  PH+++  +  KYG
Sbjct  30   YLVFFLIFL--SFILFLFKLTRSRKLNLPPSPPKLPVIGNIHHLGTLPHRSLQALSEKYG  87

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             ++ L +G V T+ + SA+AA+E+ K HD+ FA+R
Sbjct  88   PLMLLHMGHVPTLIVSSAEAASEIMKTHDIVFANR  122



>ref|XP_010102944.1| Psoralen synthase [Morus notabilis]
 gb|EXB94462.1| Psoralen synthase [Morus notabilis]
Length=226

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 63/108 (58%), Gaps = 4/108 (4%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARK----KSSSSYRlppgppglpVIGNMLDLGAFPHQ  336
            +E++   L ++ IFL+  L F++ +     +   S+ LPP PP LP+IGN+  LG  PH 
Sbjct  8    LEFKPSSLFFALIFLVISLKFIIRKNPIIIERKKSFNLPPSPPKLPIIGNLHQLGKNPHI  67

Query  337  TIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            ++  +  KYG +  L +G + T+ I SA+ A E FK HD++ + R  I
Sbjct  68   SLRNLAQKYGPIFCLNLGQIPTVIISSARIAKEAFKTHDLALSGRPQI  115



>ref|XP_003600328.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70579.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 66/102 (65%), Gaps = 5/102 (5%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFL----LARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMK  354
            + +++IF +   VF+    L +K  SS+  LPPGP  LP+IGN+ +L G+ PH  + ++ 
Sbjct  6    ICFTSIFSLLMFVFIANKILTKKSESSAQNLPPGPLKLPIIGNIHNLIGSLPHHRLRDLS  65

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
             KYG ++ L++G VST+ + SA+ A E+ KNHD+ FA R  I
Sbjct  66   TKYGPLMHLKLGEVSTIVVSSAEYAKEVMKNHDLVFASRPPI  107



>gb|EYU32021.1| hypothetical protein MIMGU_mgv1a005095mg [Erythranthe guttata]
Length=497

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+L+LG  PH+++AE+  KYG VI L++G ++T+ I S + A  + + HD+ F+ RT
Sbjct  42   IIGNILELGRNPHRSLAELSRKYGPVISLKLGRITTIVIFSPETAKIVLQKHDLEFSSRT  101



>ref|XP_010026997.1| PREDICTED: cytochrome P450 71A9-like [Eucalyptus grandis]
 gb|KCW83243.1| hypothetical protein EUGRSUZ_B00182 [Eucalyptus grandis]
Length=500

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +1

Query  223  LVFLL-ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LVFL+  +KK+ +S  LPP P  LP+IGN+  LG+ PH+++  +  +YG ++ L++GS+ 
Sbjct  19   LVFLIDTKKKTRASRNLPPRPRKLPIIGNLHQLGSLPHRSLVRLSKQYGQIMLLQLGSIP  78

Query  400  TMAILSAKAAAELFKNHDVSFADR  471
            T+ I S   A E+FK HD +F+ R
Sbjct  79   TLVISSEDVAREVFKAHDRAFSGR  102



>gb|KCW83245.1| hypothetical protein EUGRSUZ_B00184 [Eucalyptus grandis]
Length=500

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +1

Query  223  LVFLL-ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LVFL+  +KK+ +S  LPPGP  LP+IGN+  LG+ PH+++  +  +YG ++ L++GSV 
Sbjct  19   LVFLIDTKKKTRASRNLPPGPRKLPIIGNLHQLGSLPHRSLTRISKQYGQIMLLQLGSVP  78

Query  400  TMAILSAKAAAELFKNHDVSFADR  471
            T+ I S   A E+FK HD +F+ R
Sbjct  79   TLVISSEDVAREVFKAHDRAFSGR  102



>gb|KDP39024.1| hypothetical protein JCGZ_00781 [Jatropha curcas]
Length=537

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIA  345
            ME+  +  ++ A+F     +F+L R  ++ S +L PGP  LP+IGNM  L G+ PH  + 
Sbjct  1    MEYLQQLPIFPALFTFLLFIFILQRISTNYSAKLAPGPWKLPIIGNMHQLLGSIPHHRLR  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             + N+YG V+ L++G +S + I S +AA ++ K HD+ F+ R
Sbjct  61   HLSNQYGPVMHLKLGQISNIVISSPEAAKKVMKTHDIIFSQR  102



>ref|XP_010027006.1| PREDICTED: cytochrome P450 71A9-like [Eucalyptus grandis]
Length=525

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +1

Query  223  LVFLL-ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LVFL+  +KK+ +S  LPPGP  LP+IGN+  LG+ PH+++  +  +YG ++ L++GSV 
Sbjct  44   LVFLIDTKKKTRASRNLPPGPRKLPIIGNLHQLGSLPHRSLTRISKQYGQIMLLQLGSVP  103

Query  400  TMAILSAKAAAELFKNHDVSFADR  471
            T+ I S   A E+FK HD +F+ R
Sbjct  104  TLVISSEDVAREVFKAHDRAFSGR  127



>gb|EMT31346.1| Cytochrome P450 71D7 [Aegilops tauschii]
Length=511

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++G++L + GAFPH+TIAE+  ++G ++ LR+G V+TM + SA+ AA + K +D++FADR
Sbjct  41   IVGSLLHVVGAFPHRTIAELSRRHGPLMHLRLGEVATMVVSSAEVAALVLKTNDLTFADR  100



>sp|O04164.1|C71A6_NEPRA RecName: Full=Cytochrome P450 71A6, partial [Nepeta racemosa]
 emb|CAA70576.1| cytochrome P450 [Nepeta racemosa]
Length=511

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  214  IPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGS  393
            +P L FL   ++S S    PP PP LPV+GN+  LG FPH+++  +  +YG V+ L  GS
Sbjct  9    LPFLFFLKKWRRSYSGKTPPPSPPKLPVLGNLHQLGTFPHRSLQSLSRRYGPVMQLHFGS  68

Query  394  VSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            V  +   S +AA E+ KN D++F++R  + +
Sbjct  69   VPVLVASSPEAAREIMKNQDLNFSNRPNLSI  99



>ref|XP_011072187.1| PREDICTED: cytochrome P450 71A9-like [Sesamum indicum]
Length=498

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = +1

Query  205  IFLIPGLVFLLARKKSSS---SYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            I L   L FLL  KK      S RLPPGP  LP+IGN+  LG  PH+++  M  +YG ++
Sbjct  8    IMLFITLFFLLMLKKKRQVMISRRLPPGPKKLPIIGNLHQLGKLPHRSLQNMSQRYGDLM  67

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +L++GSV  + + S   A ++FKNHD+ F+ R
Sbjct  68   FLQLGSVPALVVSSPDMARDIFKNHDLVFSGR  99



>ref|XP_010057715.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=499

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 38/96 (40%), Positives = 60/96 (63%), Gaps = 3/96 (3%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            YL+W    L   L F+  R + +    LPPGP  LP+IGN+L+LG  PH+++A++   YG
Sbjct  11   YLLWG---LFQALSFVANRGRRARPSNLPPGPRPLPIIGNLLELGDLPHKSLAKLARTYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
             +I L +G V+T+ + S+  A E+ + HD  F++RT
Sbjct  68   PIIKLELGFVTTVVVSSSMLAKEILQTHDAVFSNRT  103



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+L LG  PH ++A +  KYG ++ LR+GSV  +   S+  A ++FK HDV+F+ R
Sbjct  41   IIGNLLHLGRVPHHSLAALAKKYGPLMHLRLGSVHVIVAASSSVATQIFKTHDVNFSSR  99



>ref|XP_006854378.1| hypothetical protein AMTR_s00039p00170480 [Amborella trichopoda]
 gb|ERN15845.1| hypothetical protein AMTR_s00039p00170480 [Amborella trichopoda]
Length=492

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+  LG  PHQ++A +  +YG +++L++GSV T+ + SA+ A E+ K  D++FA+R
Sbjct  40   VIGNLHQLGELPHQSLARLSQQYGRLMFLKLGSVPTIVVSSAEIAKEVMKTQDLAFANR  98



>ref|XP_006487449.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+L+LGA PH+++A++   +G ++ LR+G V+T+ + S   A  + +NHD+SF DR
Sbjct  41   VIGNLLELGAKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILQNHDLSFCDR  99



>gb|AES98640.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=229

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  235  LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
            L  K+ + +++ PPGPP LP+IGN+  LG  PH+T+  +  KYG ++ L++G V T+ I 
Sbjct  26   LHPKQKTLNHKKPPGPPSLPIIGNLHILGKLPHRTLQSLSKKYGPIMSLQLGQVPTIIIS  85

Query  415  SAKAAAELFKNHDVSFADRT  474
            S+KAA    K HD+ FA R 
Sbjct  86   SSKAAESFLKTHDIVFASRP  105



>ref|XP_010544668.1| PREDICTED: cytochrome P450 76C1-like [Tarenaya hassleriana]
Length=517

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLA-----RKKSSSSYRlppgppglpVIGNMLDLGAFPH  333
            M+     L+  A FLIP L+   A     R++S  +  LPPGPP LP+IGN+L++G  PH
Sbjct  1    MDIAVSQLLLLACFLIPCLLLFAAAAVKSRRRSIGAAALPPGPPRLPIIGNILNVGKNPH  60

Query  334  QTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
             ++AE+   YG V+ L++G+++T+ + S +AA E+ + HD + + RT
Sbjct  61   HSLAELSKVYGPVMSLKLGTLTTVVVASPEAAKEVLQVHDQALSGRT  107



>gb|KCW80423.1| hypothetical protein EUGRSUZ_C01776 [Eucalyptus grandis]
Length=493

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  223  LVFLLARKKSSSSYRlppgppglp-VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LVFL+  KK++ + R  P  P    +IGN+  LG+ PHQ++  +  +YG ++ L++G V 
Sbjct  39   LVFLIDTKKNTRASRNLPPGPRKLPIIGNLHQLGSPPHQSLTRLSKQYGEIMLLQLGVVP  98

Query  400  TMAILSAKAAAELFKNHDVSFADR  471
            T+ I S   A E+FK HD++F+ R
Sbjct  99   TLVISSEDVAREVFKVHDIAFSGR  122



>ref|XP_010048231.1| PREDICTED: cytochrome P450 71A9-like [Eucalyptus grandis]
Length=500

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  223  LVFLLARKKSSSSYRlppgppglp-VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LVFL+  KK++ + R  P  P    +IGN+  LG+ PHQ++  +  +YG ++ L++G V 
Sbjct  19   LVFLIDTKKNTRASRNLPPGPRKLPIIGNLHQLGSPPHQSLTRLSKQYGEIMLLQLGVVP  78

Query  400  TMAILSAKAAAELFKNHDVSFADR  471
            T+ I S   A E+FK HD++F+ R
Sbjct  79   TLVISSEDVAREVFKVHDIAFSGR  102



>ref|XP_002276487.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=494

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 40/101 (40%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M W     +W+A+ LI  +VFL    K+    RLPPGP G+P++GNM  LG+ PH+ +  
Sbjct  1    MAW-----IWTALALI-AIVFLFNMMKNKHK-RLPPGPRGIPILGNMHMLGSLPHRALQA  53

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +  KYG ++++R+G V  + + S +AA +  K HD+ FA+R
Sbjct  54   LSKKYGPIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANR  94



>gb|AFK47133.1| unknown [Lotus japonicus]
Length=314

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+  LG FPH+T+  +  K+G V+ L +GSV    I SA+AA E+ K HD  FA+R
Sbjct  38   VIGNLHQLGLFPHRTLQSLARKHGPVMLLHLGSVPVPVISSAEAACEIMKTHDRVFANR  96



>gb|KCW80425.1| hypothetical protein EUGRSUZ_C01776 [Eucalyptus grandis]
Length=520

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  223  LVFLLARKKSSSSYRlppgppglp-VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            LVFL+  KK++ + R  P  P    +IGN+  LG+ PHQ++  +  +YG ++ L++G V 
Sbjct  39   LVFLIDTKKNTRASRNLPPGPRKLPIIGNLHQLGSPPHQSLTRLSKQYGEIMLLQLGVVP  98

Query  400  TMAILSAKAAAELFKNHDVSFADR  471
            T+ I S   A E+FK HD++F+ R
Sbjct  99   TLVISSEDVAREVFKVHDIAFSGR  122



>ref|XP_008382575.1| PREDICTED: cytochrome P450 71A3-like [Malus domestica]
Length=515

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+  LG +PH+++  +  ++GS++ L  GS+  + + SA+AA+E+ K HD++F+DR 
Sbjct  54   VIGNLHQLGLYPHRSLRALAQRHGSLMMLHFGSMPVLVVSSAEAASEVMKTHDITFSDRP  113

Query  475  XI  480
             I
Sbjct  114  KI  115



>gb|AJD25151.1| cytochrome P450 CYP71AH15 [Salvia miltiorrhiza]
Length=496

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 62/97 (64%), Gaps = 8/97 (8%)
 Frame = +1

Query  205  IFLIPGLVFLL--------ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            I LIP L F+          RK   ++ +LPPGP  LP+IGN+  LG  PH+++ ++   
Sbjct  5    IPLIPFLTFITLFFLILKKTRKPVINAAKLPPGPRQLPIIGNLHQLGKLPHRSLQKLSKT  64

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            YG +++L++GSV T+ + SA  A ++FKNHD++F+ R
Sbjct  65   YGDLMFLQLGSVPTLVVSSADKARDIFKNHDLAFSGR  101



>gb|EPS57376.1| hypothetical protein M569_17442, partial [Genlisea aurea]
Length=479

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG+ PH+++  + N+YGS++ LRIGS   +   SA AA E+ KN D+ F++R 
Sbjct  22   IIGNLHQLGSLPHRSLQSLSNRYGSLMLLRIGSFPVLVASSANAAREIMKNQDLIFSNRP  81

Query  475  XIXV  486
             + +
Sbjct  82   YLSI  85



>ref|XP_002276561.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=498

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 62/95 (65%), Gaps = 5/95 (5%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            + W++I+++     + AR+  S + +LPPGP   P+IGN+L+LG  PH+++A +   YG 
Sbjct  12   VAWTSIYIV-----VSARRSKSGAGKLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGP  66

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+ L++G V+T+ I SA  A E+ +  D SF +RT
Sbjct  67   VMSLKLGCVTTVVITSATMAKEVLQKKDQSFCNRT  101



>ref|XP_003558352.1| PREDICTED: LOW QUALITY PROTEIN: geraniol 8-hydroxylase-like [Brachypodium 
distachyon]
Length=501

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/100 (36%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            E+  L  + + LI   ++LL R  ++++ R  P  P   P+IGN+LDLGA PH+++A + 
Sbjct  2    EFSLLYTTYVILIVSSLYLLRRHFAAAACRNLPPGPRPWPLIGNLLDLGAQPHRSLARLA  61

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
             ++G ++ LR+G+V+T+   SA+AA +  + HD +F+ R+
Sbjct  62   GRHGPLMTLRLGAVTTVVASSAEAARDFLQRHDAAFSARS  101



>gb|AFP95893.1| F3'H [Narcissus tazetta]
Length=528

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++GN+L LGA PHQT+  +   YG +  LR GSV+ +A+ SA  AA+  + HD +F++R
Sbjct  61   ILGNLLQLGAKPHQTLCALSRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNR  119



>gb|KCW74943.1| hypothetical protein EUGRSUZ_E03687 [Eucalyptus grandis]
Length=411

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+L+LG  PH+++A++   YG +I L +G V+T+ + S K A E+ + HD  F++RT
Sbjct  74   IIGNLLELGDLPHKSLAKLARTYGPIIKLELGFVTTVVVSSPKLAKEILQTHDAVFSNRT  133



>ref|XP_004241226.1| PREDICTED: cytochrome P450 71A9-like [Solanum lycopersicum]
Length=504

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++GN+  LG  PH+++ ++ ++YG  I+L++GS+ T+ + SA  A E+F+ HDV+FA R
Sbjct  42   IVGNLHQLGKLPHRSLQKLSHEYGDFIFLQLGSIPTLLVSSADVAKEIFRVHDVAFAGR  100



>gb|KHG11226.1| Cytochrome P450 [Gossypium arboreum]
Length=508

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PH ++  + NK+G VI+L++G + TM + SAK A ++ K HD++ ++R 
Sbjct  49   IIGNLHQLGTMPHLSLRRLSNKFGPVIYLQLGQIPTMVVSSAKLAKQVMKTHDLALSNRP  108

Query  475  XI  480
             I
Sbjct  109  PI  110



>emb|CBI33813.3| unnamed protein product [Vitis vinifera]
Length=594

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 62/95 (65%), Gaps = 5/95 (5%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            + W++I+++     + AR+  S + +LPPGP   P+IGN+L+LG  PH+++A +   YG 
Sbjct  12   VAWTSIYIV-----VSARRSKSGAGKLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGP  66

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+ L++G V+T+ I SA  A E+ +  D SF +RT
Sbjct  67   VMSLKLGCVTTVVITSATMAKEVLQKKDQSFCNRT  101



>gb|AFK79030.1| cytochrome P450 CYP736A53 [Bupleurum chinense]
Length=498

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 45/95 (47%), Positives = 61/95 (64%), Gaps = 7/95 (7%)
 Frame = +1

Query  196  WSAIFLIPGLVF---LLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +S +FLI G VF   L AR++      LPPGP GLP++G++L LG  PH+T  E+  KYG
Sbjct  7    FSFLFLILGAVFWWILDARQRK----LLPPGPRGLPIVGSLLHLGKLPHRTFQELAKKYG  62

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             ++ LR+G VST+ + S +AA    K HD  FADR
Sbjct  63   PIMSLRLGYVSTIVVSSPEAAKLFLKTHDSVFADR  97



>ref|XP_010053375.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 ref|XP_010053376.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 ref|XP_010053377.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77654.1| hypothetical protein EUGRSUZ_D01952 [Eucalyptus grandis]
Length=498

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LG  PH+++A++   YG +I L++G V+T+ I S   A E+ ++HD  FA+RT
Sbjct  43   VIGNLLELGNLPHKSLAKLARTYGPIIKLQLGFVTTVVISSPTLAKEILQSHDAIFANRT  102



>gb|KDO36937.1| hypothetical protein CISIN_1g044449mg, partial [Citrus sinensis]
Length=200

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 57/95 (60%), Gaps = 5/95 (5%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +L+++ +F++    F   RKK          P   PVIGN+L+LG  PH+++AE+   YG
Sbjct  21   WLLFTCVFVMALSSFSRGRKKPLPPG-----PTPYPVIGNLLELGEKPHKSLAELAKIYG  75

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             ++ L++G V+T+ + SA  A  + ++HD SF +R
Sbjct  76   PILSLKLGEVTTVVVSSAPMAKYILQDHDSSFYNR  110



>sp|H2DH20.1|C7D13_PANGI RecName: Full=Cytochrome P450 CYP71D313 [Panax ginseng]
 gb|AEY75217.1| cytochrome P450 CYP71D313 [Panax ginseng]
Length=505

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  202  AIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIW  378
            +IF +  L F L +K S ++  LPPGP  LP+IGN+L+L G   H+ +AE+  K+G ++ 
Sbjct  9    SIFFVTILFFFLFKKSSKTTKNLPPGPRKLPIIGNILELAGEVQHRVLAELSQKHGPIMH  68

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            L++  +S + + S+K A E+ K HD++F+DR  + +
Sbjct  69   LQLAEISAIVVSSSKVAKEVLKTHDLAFSDRAQLQL  104



>gb|KEH34024.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 63/100 (63%), Gaps = 2/100 (2%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNK  360
            YL +   F++  L+    RKK S S+Y +PPGP  LP+IGN+ +L  + PHQ + ++  K
Sbjct  7    YLPYIFFFILLTLIVQKIRKKKSYSAYNIPPGPRKLPIIGNIHNLLSSQPHQKLRDLAKK  66

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXI  480
            YG V+ L++G VS M I S + A+E+ K HD+ F+ R  I
Sbjct  67   YGPVMHLQLGEVSAMVISSPECASEVMKTHDIHFSSRPQI  106



>ref|XP_002303546.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
 gb|EEE78525.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
Length=505

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +1

Query  211  LIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG  390
            +I  L ++L R K  S  +LPPGP  LP++GN+LDLG  PH+++A++   +G ++ L++G
Sbjct  17   VIQSLDYILRRSKRKSG-KLPPGPSRLPIVGNLLDLGDKPHKSLAKLAKTHGQLMSLKLG  75

Query  391  SVSTMAILSAKAAAELFKNHDVSFADRTXI  480
             V+T+ + SA  A E+ + HD++F +RT +
Sbjct  76   QVTTIVVSSATMAKEVLQKHDLTFCNRTVV  105



>ref|XP_007137994.1| hypothetical protein PHAVU_009G172100g [Phaseolus vulgaris]
 gb|ESW09988.1| hypothetical protein PHAVU_009G172100g [Phaseolus vulgaris]
Length=523

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query  205  IFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR  384
            IF +  L+F+L+ K+  +   LPP PP LP+IGN+  LG  PH++   +  KYG +  L+
Sbjct  24   IFFL-SLLFVLSYKRRKNKLNLPPSPPKLPIIGNLHQLGTLPHRSFQALSRKYGPLFLLQ  82

Query  385  IGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +G   T+ + S   A E+FK HDV+F+D++
Sbjct  83   LGQTPTLLVSSVDLAKEVFKTHDVAFSDKS  112



>ref|XP_003600319.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70570.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +1

Query  229  FLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMA  408
            F+   K   ++Y+LPPGP  LP+IGN+  LG  PHQ +A++  +YGS++ +++G +S + 
Sbjct  24   FIWRSKTKKTTYKLPPGPRKLPLIGNIHQLGTLPHQALAKLAQEYGSLMHMQLGELSCIV  83

Query  409  ILSAKAAAELFKNHDVSFADRTXI  480
            + S + A E+ K HD++FA+R  +
Sbjct  84   VSSQEMAKEIMKTHDLNFANRPPL  107



>ref|XP_007048087.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92244.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = +1

Query  169  MEWEWKYLVWSA-IFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            M+W W  L  +A IF    LV+    K+S+ + RLPPGP GLP++GN+L +G  PH+ + 
Sbjct  1    MDWTWTTLAVAALIFFFQSLVW----KRSAKNKRLPPGPRGLPILGNLLMIGDKPHRDLQ  56

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++  KYG ++ LR GS+  + + S +AA +  K +D+ FA R
Sbjct  57   QLAQKYGPIMHLRFGSMPVIVVSSPEAAEQFLKTYDLVFASR  98



>ref|XP_006841385.1| hypothetical protein AMTR_s00181p00057690 [Amborella trichopoda]
 gb|ERN03060.1| hypothetical protein AMTR_s00181p00057690 [Amborella trichopoda]
Length=506

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG+ PH T+A +   YG +I L++G V T+ + SAK A E+ K HD++F  R 
Sbjct  44   IIGNLHQLGSMPHLTLARLAETYGPLIHLKMGQVPTLVVSSAKMAEEIMKTHDLTFCSRP  103

Query  475  XI  480
             +
Sbjct  104  AL  105



>ref|XP_007159748.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31742.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=389

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            ++W +I L+  L +L  R+++S   +LPPGP GLP++G++  LGA PH+ + ++  KYG 
Sbjct  1    MIWISIILL-SLAYLWLRRRNSKGKKLPPGPRGLPILGSLHKLGANPHRDLHQLALKYGP  59

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V++LR+G V T+ + S +AA    K HD+ FA R
Sbjct  60   VMYLRLGFVPTVVVSSPQAAELFLKTHDLVFASR  93



>ref|XP_001782843.1| predicted protein [Physcomitrella patens]
 gb|EDQ52357.1| predicted protein [Physcomitrella patens]
Length=531

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++GN+  L   PH+++ ++  KYGS+++LR+G V  + I SA  A +LFK HD+ F++R
Sbjct  60   ILGNIASLAGLPHRSLEKLARKYGSLMYLRLGEVPCIVISSADVAKQLFKTHDILFSNR  118



>ref|XP_011012702.1| PREDICTED: cytochrome P450 71D11-like [Populus euphratica]
Length=515

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PHQ + +M +KYG V+ L+IG VST+ I S +AA E  K H+++F DR
Sbjct  47   LIGNLHQLLGSLPHQVLRDMASKYGPVMQLQIGEVSTVIISSPEAAKEAMKTHEINFVDR  106

Query  472  TXIXV  486
              + V
Sbjct  107  PCLLV  111



>ref|XP_007020023.1| Cytochrome P450 71A9, putative [Theobroma cacao]
 gb|EOY17248.1| Cytochrome P450 71A9, putative [Theobroma cacao]
Length=500

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = +1

Query  181  WKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            +  L+  A+  +  L+ +  RKK++ + RLPPGP  LP++GN+  LG FPH +I  +  +
Sbjct  6    YSMLLLVAVTTLVVLLLIKQRKKTAEASRLPPGPRKLPILGNLHQLGRFPHLSIQFLSQE  65

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            YG +++L++GSV T+ I SA  A  + K+HD+ F+ R  + V
Sbjct  66   YGPLMFLQLGSVPTIVISSADMARAICKSHDIIFSGRPPLYV  107



>ref|XP_011029123.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=501

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = +1

Query  208  FLIPGLVFLLAR-KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR  384
            F+I   +  +AR  K+ SS +LPPGP  LP+IGN+LDLG  PH+++A +   +G ++ L+
Sbjct  15   FVIVKTLHFIARGSKTESSGKLPPGPAALPIIGNLLDLGDKPHKSLARLAKTHGPLMSLK  74

Query  385  IGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +G ++T+ I S   A E+ + HDVS ++RT
Sbjct  75   LGQITTVVISSPTLAKEVLQKHDVSLSNRT  104



>ref|XP_010100353.1| Cytochrome P450 [Morus notabilis]
 gb|EXB82487.1| Cytochrome P450 [Morus notabilis]
Length=347

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +1

Query  226  VFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTM  405
            +F++  KKS +  RL PGPP LP+IGN+  +G+ PH+++ ++  +YGSV+ LR G V  +
Sbjct  22   IFIIKLKKSENDPRLLPGPPRLPIIGNLHQIGSLPHRSLYQLSRRYGSVMRLRFGGVPVI  81

Query  406  AILSAKAAAELFKNHDVSFADR  471
             + SA+AA E+ K HD+    R
Sbjct  82   IVSSAEAAKEVLKIHDLECCSR  103



>ref|XP_002310636.2| hypothetical protein POPTR_0007s07310g [Populus trichocarpa]
 gb|EEE91086.2| hypothetical protein POPTR_0007s07310g [Populus trichocarpa]
Length=509

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 9/103 (9%)
 Frame = +1

Query  205  IFLIPGL--VFLLAR--KKS----SSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKN  357
            I ++P L  +F + R  KKS    SS+   PPGP  LP+IGN+  L G+ PHQ + +M N
Sbjct  10   ILIVPFLLLIFTVLRLWKKSQGNNSSTPPPPPGPWKLPLIGNLHQLLGSLPHQVLRDMAN  69

Query  358  KYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTXIXV  486
            KYG V+ L+IG V T+ I S +AA E  K H+++F DR  + V
Sbjct  70   KYGPVMQLQIGEVPTVIISSPEAAKEAIKTHEINFVDRPCLLV  112



>ref|XP_002299579.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
 gb|EEE84384.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
Length=502

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +1

Query  208  FLIPGLVFLLAR-KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR  384
            F++  ++  +AR  K+ SS +LPPGP  LP+IG++LDLG  PH+++A +   +G ++ L+
Sbjct  15   FVLVKILHFIARGSKTESSGKLPPGPAALPIIGSLLDLGDKPHKSLARLAKTHGPLMSLK  74

Query  385  IGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +G ++T+ I S   A E+ + HDVSF++RT
Sbjct  75   LGQITTIVISSPTLAKEVLQKHDVSFSNRT  104



>ref|XP_007142620.1| hypothetical protein PHAVU_007G003100g [Phaseolus vulgaris]
 gb|ESW14614.1| hypothetical protein PHAVU_007G003100g [Phaseolus vulgaris]
Length=520

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V+GNM  LG  PH++ A++  K+G ++ L +GS+ T+ I S++ A E+FKNHDV  A R
Sbjct  51   VVGNMFQLGWSPHESFAKLAQKHGPIMTLWLGSMCTVVISSSEVAGEMFKNHDVVLAGR  109



>ref|XP_011091088.1| PREDICTED: ferruginol synthase-like [Sesamum indicum]
Length=491

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+L LG+ PHQ++A++   YG V+ L++GS++T+ + S +AA  + + HDV+F+ R
Sbjct  42   IIGNILQLGSKPHQSLAKLSRIYGPVMSLKLGSITTVVVSSPEAAKIILQKHDVAFSSR  100



>ref|XP_007159749.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31743.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=483

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            ++W +I L+  L +L  R+++S   +LPPGP GLP++G++  LGA PH+ + ++  KYG 
Sbjct  1    MIWISIILL-SLAYLWLRRRNSKGKKLPPGPRGLPILGSLHKLGANPHRDLHQLALKYGP  59

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V++LR+G V T+ + S +AA    K HD+ FA R
Sbjct  60   VMYLRLGFVPTVVVSSPQAAELFLKTHDLVFASR  93



>gb|KEH31760.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=516

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = +1

Query  199  SAIFLIPGL-VFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            S  FL+  L VF  A +KS ++   PP PP LP+IGN+  LG  P++++  + +KYG+++
Sbjct  22   SLFFLVSVLIVFKFAIRKSKTNINQPPSPPKLPIIGNLHQLGTLPYRSLRNLSHKYGNIM  81

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             L++G   T+ I SA  A E+  NHD++F++R
Sbjct  82   LLQLGQRQTLVISSADIAMEIMNNHDLAFSNR  113



>gb|KEH28165.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=427

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  229  FLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMA  408
              L  K+ +  ++ PP PP LP+IGN+  LG  PH+T+  +  KYG ++ L++G V T+ 
Sbjct  24   LFLHSKQKTIIHKKPPCPPTLPIIGNLHILGKLPHRTLQSLSKKYGPIMSLQLGQVPTIV  83

Query  409  ILSAKAAAELFKNHDVSFADRTXI  480
            I S+KAA    K HD+ FA+R  +
Sbjct  84   ISSSKAAESFLKTHDIVFANRPKL  107



>gb|ABC69415.1| CYP71AH2 [Nicotiana tabacum]
Length=494

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  +G  PH+++ ++ N+YG  I+L++GSV T+ + SA  A E+F+ HD+ F+ R 
Sbjct  34   IIGNLHQIGKLPHRSLQKLSNEYGDFIFLQLGSVPTVVVSSADIAREIFRTHDLVFSGRP  93

Query  475  XI  480
             +
Sbjct  94   AL  95



>ref|XP_006854377.1| hypothetical protein AMTR_s00039p00170160 [Amborella trichopoda]
 gb|ERN15844.1| hypothetical protein AMTR_s00039p00170160 [Amborella trichopoda]
Length=521

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = +1

Query  175  WEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMK  354
            W W  LV++AI  +  +  LL RK  + S  LPPGP   PVIGN+  LG  PHQ++A + 
Sbjct  5    WVW-LLVFAAILAV--IQILLNRK--ARSLNLPPGPRRFPVIGNLHQLGKRPHQSLARLS  59

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             +YG ++++++G V T+ + SA+ A E+ K  D+ FA+R
Sbjct  60   QQYGPLMFIKVGRVPTIVVSSAEIAKEVMKTQDMVFANR  98



>gb|EYU30852.1| hypothetical protein MIMGU_mgv1a020394mg [Erythranthe guttata]
Length=289

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+L++G  PH+++A++  KYG V+ L++G+++T+ I S KAA  + + HD+ F+ RT
Sbjct  24   IIGNILEIGPKPHKSLAKLAAKYGPVMSLKLGTLTTVIISSPKAAKAVLQTHDLIFSSRT  83



>gb|AFK73717.1| cytochrome P450 [Papaver somniferum]
Length=507

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  LG  PH+ + E+  KYG ++ L++GS+ T+ I SA+AA ++ K HD+ F +R
Sbjct  42   IIGNLHQLGKPPHRILHELSQKYGPIMLLQLGSIPTLVITSAEAAEQVLKTHDLDFCNR  100



>ref|XP_010102940.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB94458.1| Cytochrome P450 71A1 [Morus notabilis]
Length=534

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = +1

Query  193  VWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            ++  IFL+  L+F + +KK +   + LPP PP LP+IGN+  LG  PH ++  +  KYG 
Sbjct  10   LFPTIFLLVLLMFFILKKKPTKLEFNLPPSPPKLPIIGNLHQLGNNPHISLHHLAQKYGP  69

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            + +L +G + T+ I SA+ A E  K HD++FA R
Sbjct  70   IFYLELGQIPTVIISSARLAKEALKTHDLAFASR  103



>ref|XP_004295869.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 60/91 (66%), Gaps = 1/91 (1%)
 Frame = +1

Query  202  AIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIW  378
            ++F++  L   +  K  SSS  LPPGP  LP IGN+  L G+ PH+++  + NKYG ++ 
Sbjct  15   SLFVVMVLKITIRGKTKSSSSNLPPGPRELPFIGNIHQLAGSLPHRSLRNLANKYGPLMH  74

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            LR+G +ST+ + SA+ A E+ K HDV+FA R
Sbjct  75   LRLGEISTVVVSSAEFAREVMKTHDVTFATR  105



>gb|KJB51557.1| hypothetical protein B456_008G222600 [Gossypium raimondii]
Length=501

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/90 (39%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +1

Query  205  IFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR  384
            IFL+  + F L  ++ SS++ LPPGP   P+ G++  LG+ P+Q++ E+   YG ++ LR
Sbjct  5    IFLLFCISFFLLFRRRSSAHSLPPGPINFPIFGSLHRLGSHPNQSLYELAKTYGPLMTLR  64

Query  385  IGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +G ++T+ + SA+ A ++F+ H+ SF+DRT
Sbjct  65   LGYITTVIVSSAEFAKQVFQTHEHSFSDRT  94



>gb|KEH31755.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=500

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 40/96 (42%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARK--KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKY  363
            L+ S+IFLI   +FLL +    S+ +   PP PP  P+IGN+  LG FPH+T+  +  +Y
Sbjct  3    LIISSIFLI---LFLLIKWYFNSTKTKNSPPSPPKFPIIGNLHQLGLFPHRTLQSLAKEY  59

Query  364  GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            G ++ L +GSV  + I S + A+E+ K HD  FA+R
Sbjct  60   GPLMQLHLGSVPVLVISSPEGASEIMKTHDRVFANR  95



>ref|XP_010093536.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXB54226.1| Cytochrome P450 76C4 [Morus notabilis]
Length=498

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +1

Query  205  IFLIPGLVFLLARK---KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            +F IP + FL  R    + S + RLPPGP G+P++GN+L LG  PH+++ EM   YG ++
Sbjct  9    LFSIP-IFFLFIRPFILRKSDTKRLPPGPRGIPILGNLLQLGPRPHESLHEMAKLYGPLM  67

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
             LR+GSV+T+   S   A EL  NHD  FA+R
Sbjct  68   TLRLGSVTTVVASSPDMARELLHNHDQVFANR  99



>ref|XP_011047544.1| PREDICTED: cytochrome P450 71D11-like isoform X1 [Populus euphratica]
Length=508

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G  PHQ + +M +KYG V+ L+IG V T+ I S +AA E  KNH+++F DR
Sbjct  47   LIGNLPQLLGPLPHQVLRDMASKYGPVMQLQIGEVPTVIISSPEAAKEAMKNHEINFVDR  106

Query  472  TXIXV  486
              + V
Sbjct  107  PCLLV  111



>gb|AFK73716.1| cytochrome P450 [Papaver somniferum]
Length=503

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  LG  PH+ + E+  KYG ++ L++GS+ T+ I SA+AA ++ K HD+ F +R
Sbjct  42   IIGNLHQLGKPPHRILHELSQKYGPIMLLQLGSIPTLVITSAEAAEQVLKTHDLDFCNR  100



>ref|XP_002312659.2| hypothetical protein POPTR_0008s18790g [Populus trichocarpa]
 gb|EEE90026.2| hypothetical protein POPTR_0008s18790g [Populus trichocarpa]
Length=507

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  301  GNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            GN+  LG+ PHQ++ ++  KYG V+ +R+G + T+ I SA+AA E+ K HDV+F  R
Sbjct  47   GNLHQLGSLPHQSLWQLSKKYGPVMLIRLGRIPTVVISSAEAAREVLKVHDVAFCSR  103



>gb|AIU56747.1| cytochrome P450 CYP71B41v2 [Populus trichocarpa]
Length=507

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  301  GNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            GN+  LG+ PHQ++ ++  KYG V+ +R+G + T+ I SA+AA E+ K HDV+F  R
Sbjct  47   GNLHQLGSLPHQSLWQLSKKYGPVMLIRLGRIPTVVISSAEAAREVLKVHDVAFCSR  103



>ref|XP_011014080.1| PREDICTED: cytochrome P450 71D11-like [Populus euphratica]
Length=508

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G  PHQ + +M +KYG V+ L+IG V T+ I S +AA E  KNH+++F DR
Sbjct  47   LIGNLHQLLGPLPHQVLRDMASKYGPVMQLQIGEVPTVIISSPEAAKEAMKNHEINFVDR  106

Query  472  TXIXV  486
              + V
Sbjct  107  PCLLV  111



>ref|XP_008659837.1| PREDICTED: cytochrome P450 93A3-like [Zea mays]
 gb|AFW87467.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=539

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query  205  IFLIPGL-VFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
            + L+ GL VF + R++SS   RLPP P  LPV+G++  L   PHQ +  +  ++G +++L
Sbjct  18   LLLVAGLTVFFVLRRRSSGGLRLPPSPFALPVLGHLHLLAPLPHQALHRLAARHGPLLYL  77

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            R+GS+  +A  S  AA E+ K H+ +F DR
Sbjct  78   RLGSMPAIAACSPDAAREVLKTHEAAFLDR  107



>emb|CBI34790.3| unnamed protein product [Vitis vinifera]
Length=373

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 63/93 (68%), Gaps = 4/93 (4%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            W++I+++    F   R +  ++++LPPGP  LP+IG++L+LG  PH+++A +   YG ++
Sbjct  14   WTSIYIM----FSARRGRKHAAHKLPPGPVPLPIIGSLLNLGNRPHESLANLAKTYGPIM  69

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
             L++G V+T+ I SA  A E+ +  D+SF +R+
Sbjct  70   TLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRS  102



>gb|EYU22202.1| hypothetical protein MIMGU_mgv1a005074mg [Erythranthe guttata]
Length=497

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +1

Query  202  AIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWL  381
            ++FLI  +   L +K   ++  +PP PP LP+IGN+  LG+ PH+ +  +  KYG ++ L
Sbjct  15   SLFLISYITKWLYKKSYGNNKNVPPSPPKLPIIGNLHQLGSLPHRNLQSLAKKYGPIMLL  74

Query  382  RIGSVSTMAILSAKAAAELFKNHDVSFADR  471
              GS  T+ + SA AA E+ K HD+ F+DR
Sbjct  75   HFGSKPTLIVSSADAAREIMKTHDLVFSDR  104



>ref|XP_002523238.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39159.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN   LG  PHQ++ +   KYGSV+ +++G V T+ I S+ AA ELFK HD++   R
Sbjct  42   IIGNFHQLGVLPHQSLCQYSKKYGSVMLVKLGRVPTVIISSSGAAKELFKTHDLNSCSR  100



>ref|XP_010911520.1| PREDICTED: cytochrome P450 71A9-like, partial [Elaeis guineensis]
Length=405

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAK  423
            ++ ++ YRLPPGP  LP+IGN+  LG  PH ++ ++  KYG +++L +GS+ T+ I SA+
Sbjct  75   EQRNAVYRLPPGPKKLPLIGNLHQLGRLPHHSLWQLSQKYGPLMYLELGSMPTVVISSAE  134

Query  424  AAAELFKNHDVSFADRTXI  480
             A E+ K HD+ F  R  +
Sbjct  135  MAREVMKTHDLDFCSRPRL  153



>ref|XP_006417158.1| hypothetical protein EUTSA_v10009445mg, partial [Eutrema salsugineum]
 gb|ESQ35511.1| hypothetical protein EUTSA_v10009445mg, partial [Eutrema salsugineum]
Length=468

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +1

Query  229  FLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMA  408
            F+ ++K+  S ++LPP P   P+IGN+  L   PH+ I ++  KYG V+ LR+GS+  + 
Sbjct  3    FIFSKKQQHSKWKLPPSPSSFPIIGNLHHLTGLPHRCIHKLCIKYGPVMLLRLGSLPLVV  62

Query  409  ILSAKAAAELFKNHDVSFADRTXI  480
            I S++AA E+ K HD+  ++R+ +
Sbjct  63   ISSSEAAEEVLKTHDLECSNRSKM  86



>ref|XP_006584398.1| PREDICTED: cytochrome P450 71A6-like [Glycine max]
 gb|KHN07277.1| Cytochrome P450 71A21 [Glycine soja]
Length=202

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+  LG F H+T+  +  KYG ++ L  G V+ + + SA AA EL K HD+ F+DR 
Sbjct  44   LVGNLHQLGLFLHRTLQTLAKKYGPLMLLHFGEVAVLVVSSADAARELMKTHDLVFSDRP  103

Query  475  XI  480
             +
Sbjct  104  HL  105



>gb|KJB78919.1| hypothetical protein B456_013G025300 [Gossypium raimondii]
Length=343

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  223  LVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVST  402
            + F L R    +  + PPGP  LP+IGN+  LG FPHQT+  +  KYG ++ +++G V T
Sbjct  64   IYFFLPRNHHKNGRKPPPGPAPLPIIGNLHMLGNFPHQTLHHLGKKYGPIMSIKLGYVPT  123

Query  403  MAILSAKAAAELFKNHDVSFADRTXI  480
            + + S +AA    K HD+ FA R  +
Sbjct  124  IVVSSPEAAELFLKVHDLVFASRPNL  149



>gb|KHG17729.1| Cytochrome P450 [Gossypium arboreum]
Length=534

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            IGN+  LG  PH+++ ++  KYGS++ L++G   T+ + SA    E+ KNHDV+F+DR
Sbjct  73   IGNIHQLGKLPHRSLRDLSRKYGSLLLLQLGHNQTLVVSSADMVKEIVKNHDVAFSDR  130



>ref|XP_006854384.1| hypothetical protein AMTR_s00039p00175330 [Amborella trichopoda]
 gb|ERN15851.1| hypothetical protein AMTR_s00039p00175330 [Amborella trichopoda]
Length=508

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 39/101 (39%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = +1

Query  175  WEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlpp--gppglpVIGNMLDLGAFPHQTIAE  348
            W W     + + LI  L  LL  + +  + RL    GP GLP+IGN+  LG+ PH++ A 
Sbjct  5    WPWIQACLAIVTLIEILWLLLRNRSTKETARLNLPPGPLGLPIIGNLHQLGSLPHRSFAS  64

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +  K+G +++L++G V T+ I SAK A E+ K  D++FA R
Sbjct  65   LSWKHGPLMFLQLGRVPTLVISSAKMAKEVMKTQDLAFASR  105



>ref|XP_008239593.1| PREDICTED: cytochrome P450 71A25-like [Prunus mume]
Length=369

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  +G++PH+T+  +  ++G ++ L  GSV  + + SA+AA E+ K HD++F+DR
Sbjct  58   IIGNLHQIGSYPHRTLQALSQRHGPLMLLHFGSVPVLVVSSAEAAREILKTHDLAFSDR  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370