BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G23

Length=495
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   238   5e-75   Nicotiana tomentosiformis
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  234   2e-73   Nicotiana tabacum [American tobacco]
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  232   6e-73   Nicotiana tabacum [American tobacco]
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   232   6e-73   Nicotiana sylvestris
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   232   9e-73   Nicotiana tomentosiformis
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like          227   4e-72   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              229   8e-72   Solanum lycopersicum
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        227   9e-71   Solanum tuberosum [potatoes]
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        226   1e-70   Solanum tuberosum [potatoes]
gb|KJB36606.1|  hypothetical protein B456_006G166800                    223   2e-70   Gossypium raimondii
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             224   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   224   1e-69   Nicotiana tomentosiformis
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          223   2e-69   Gossypium arboreum [tree cotton]
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   223   2e-69   Nicotiana sylvestris
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               223   3e-69   Eucalyptus grandis [rose gum]
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               223   3e-69   Populus euphratica
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                     219   7e-69   Eucalyptus grandis [rose gum]
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                221   1e-68   Populus trichocarpa x Populus deltoides
ref|XP_002322877.1|  major intrinsic protein 1                          221   2e-68   Populus trichocarpa [western balsam poplar]
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   219   3e-68   Citrus sinensis [apfelsine]
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             219   3e-68   
gb|KJB62460.1|  hypothetical protein B456_009G418100                    217   5e-68   Gossypium raimondii
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               219   7e-68   Eucalyptus grandis [rose gum]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             219   8e-68   Citrus clementina [clementine]
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   219   8e-68   Populus euphratica
gb|AFH36337.1|  aquaporin PIP2;2                                        219   1e-67   Quercus petraea [durmast oak]
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   218   1e-67   Solanum tuberosum [potatoes]
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   218   2e-67   Eucalyptus grandis [rose gum]
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             218   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                218   3e-67   Theobroma cacao [chocolate]
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                218   3e-67   Populus trichocarpa x Populus deltoides
gb|ABK60196.1|  PIP2 protein                                            218   4e-67   Gossypium hirsutum [American cotton]
gb|KJB62459.1|  hypothetical protein B456_009G418100                    218   4e-67   Gossypium raimondii
gb|KJB16797.1|  hypothetical protein B456_002G2484002                   213   4e-67   Gossypium raimondii
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          217   6e-67   Gossypium arboreum [tree cotton]
emb|CDP06739.1|  unnamed protein product                                217   6e-67   Coffea canephora [robusta coffee]
gb|AAV80229.1|  aquaporin 2                                             216   9e-67   Aegiceras corniculatum
ref|NP_001274308.1|  aquaporin PIP2-1-like                              216   1e-66   Solanum lycopersicum
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         216   1e-66   Ricinus communis
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   215   3e-66   Gossypium raimondii
gb|ABK60195.2|  PIP2 protein                                            215   3e-66   Gossypium hirsutum [American cotton]
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             215   4e-66   Populus trichocarpa [western balsam poplar]
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   215   4e-66   Populus euphratica
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   215   4e-66   Fragaria vesca subsp. vesca
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   214   5e-66   
gb|AAB18227.1|  MipC                                                    214   7e-66   Mesembryanthemum crystallinum
gb|AIA83104.1|  putative aquaporin PIP2                                 214   8e-66   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         214   8e-66   Ricinus communis
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   214   9e-66   Populus euphratica
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               214   1e-65   Pyrus x bretschneideri [bai li]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  214   1e-65   Mimosa pudica [sensitive-plant]
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   213   1e-65   Sesamum indicum [beniseed]
ref|NP_001268058.1|  aquaporin-like                                     213   1e-65   Vitis vinifera
emb|CAH60724.1|  putative plasma membrane intrinsic protein             213   2e-65   Populus tremula x Populus tremuloides
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         213   2e-65   Helianthemum almeriense
gb|AEQ20672.1|  PIP2;1                                                  213   2e-65   Karelinia caspia
gb|KHG08488.1|  putative aquaporin PIP2-2                               213   3e-65   Gossypium arboreum [tree cotton]
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   213   3e-65   Fragaria vesca subsp. vesca
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                     214   3e-65   Eucalyptus grandis [rose gum]
gb|KJB21561.1|  hypothetical protein B456_004G001400                    213   3e-65   Gossypium raimondii
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        212   4e-65   Eucalyptus grandis [rose gum]
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               212   4e-65   Malus domestica [apple tree]
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               212   4e-65   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   212   4e-65   Eucalyptus grandis [rose gum]
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   212   5e-65   Tarenaya hassleriana [spider flower]
ref|XP_008345040.1|  PREDICTED: aquaporin PIP2-1-like                   208   6e-65   
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2             210   6e-65   Elaeis guineensis
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         212   6e-65   Jatropha curcas
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                     213   8e-65   Eucalyptus grandis [rose gum]
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         211   8e-65   Jatropha curcas
gb|AEC45513.1|  plasma membrane intrinsic protein                       211   9e-65   Hevea brasiliensis [jebe]
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     213   1e-64   Eucalyptus grandis [rose gum]
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   211   1e-64   Phoenix dactylifera
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          211   1e-64   Gossypium arboreum [tree cotton]
gb|ACX37450.1|  plasma membrane intrinsic protein                       211   1e-64   Hevea brasiliensis [jebe]
gb|AAC17529.1|  aquaporin 2                                             211   2e-64   Samanea saman [cow-tamarind]
gb|AGG39693.1|  aquaporin protein AQU15                                 211   2e-64   Camellia sinensis [black tea]
ref|XP_010098191.1|  Aquaporin PIP2-7                                   210   2e-64   Morus notabilis
gb|AIA83106.1|  putative aquaporin PIP2                                 211   2e-64   Citrus trifoliata [hardy orange]
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     213   2e-64   Eucalyptus grandis [rose gum]
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    210   3e-64   Pyrus x bretschneideri [bai li]
gb|AGD98708.1|  aquaporin protein 5                                     210   3e-64   Camellia sinensis [black tea]
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             210   3e-64   Elaeis guineensis
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                   208   3e-64   
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    209   4e-64   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         209   5e-64   Jatropha curcas
gb|AHA84284.1|  prolactin-inducible protein                             209   5e-64   Phaseolus vulgaris [French bean]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             209   6e-64   Phaseolus vulgaris [French bean]
gb|AAO39008.1|  plasma intrinsic protein 2,2                            209   6e-64   Juglans regia
gb|ABB88840.1|  aquaporin                                               209   7e-64   Stevia rebaudiana
gb|ACU23034.1|  unknown                                                 205   7e-64   Glycine max [soybeans]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   209   7e-64   Setaria italica
gb|AAO39007.1|  plasma intrinsic protein 2,1                            209   7e-64   Juglans regia
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               209   8e-64   Brassica rapa
gb|KJB56129.1|  hypothetical protein B456_009G107200                    207   1e-63   Gossypium raimondii
gb|AAY22203.1|  putative aquaporin                                      209   1e-63   Phaseolus vulgaris [French bean]
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   208   2e-63   Fragaria vesca subsp. vesca
gb|ADK25057.1|  plasma membrane intrinsic protein                       208   2e-63   Glycine max [soybeans]
ref|NP_001240223.1|  prolactin-inducible protein                        208   2e-63   Glycine max [soybeans]
ref|NP_001268056.1|  aquaporin PIP2                                     207   2e-63   Vitis vinifera
gb|KHN05685.1|  Aquaporin PIP2-7                                        208   2e-63   Glycine soja [wild soybean]
gb|AGD98707.1|  aquaporin protein 4                                     207   2e-63   Camellia sinensis [black tea]
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   207   3e-63   Nelumbo nucifera [Indian lotus]
gb|AIG92831.1|  aquaporin PIP2                                          207   3e-63   Chrysanthemum x morifolium [florist's chrysanthemum]
emb|CDY56697.1|  BnaCnng31040D                                          207   3e-63   Brassica napus [oilseed rape]
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               207   4e-63   Tarenaya hassleriana [spider flower]
gb|EPS68613.1|  hypothetical protein M569_06155                         207   4e-63   Genlisea aurea
gb|KJB56128.1|  hypothetical protein B456_009G107200                    207   4e-63   Gossypium raimondii
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               207   4e-63   Populus euphratica
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   207   4e-63   Glycine max [soybeans]
gb|KHG00060.1|  putative aquaporin PIP2-2                               207   5e-63   Gossypium arboreum [tree cotton]
gb|ACU87558.1|  PIP protein                                             207   5e-63   Gossypium hirsutum [American cotton]
gb|AFK47400.1|  unknown                                                 207   5e-63   Lotus japonicus
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               207   6e-63   Brassica rapa
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   207   6e-63   Phoenix dactylifera
gb|AGD98714.1|  aquaporin protein 11                                    207   6e-63   Camellia sinensis [black tea]
gb|ACZ06859.1|  plasma membrane intrinsic protein                       206   7e-63   Glycine soja [wild soybean]
gb|KHN38765.1|  Aquaporin PIP2-7                                        206   7e-63   Glycine soja [wild soybean]
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        206   7e-63   Glycine max [soybeans]
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   206   9e-63   
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               206   9e-63   Nicotiana tomentosiformis
gb|AAD31846.1|AF133530_1  water channel protein MipH                    206   1e-62   Mesembryanthemum crystallinum
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               206   1e-62   Prunus mume [ume]
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        206   1e-62   Petunia x hybrida [garden petunia]
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              206   1e-62   Populus trichocarpa [western balsam poplar]
gb|KJB26182.1|  hypothetical protein B456_004G229000                    206   1e-62   Gossypium raimondii
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             206   1e-62   Prunus persica
gb|AHG32324.1|  PIP2-3                                                  206   1e-62   Pisum sativum [garden pea]
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   206   1e-62   Elaeis guineensis
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    206   1e-62   Nicotiana sylvestris
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       206   2e-62   Raphanus sativus
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             206   2e-62   Phaseolus vulgaris [French bean]
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   206   2e-62   Cicer arietinum [garbanzo]
gb|AEY75242.1|  plasma membrane intrinsic protein                       205   2e-62   Malus hupehensis
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                205   2e-62   Erythranthe guttata [common monkey flower]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                205   2e-62   Hevea brasiliensis [jebe]
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         205   2e-62   
gb|ACU24483.1|  unknown                                                 205   2e-62   Glycine max [soybeans]
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              205   2e-62   
gb|AFH36338.1|  aquaporin PIP2;3                                        205   3e-62   Quercus petraea [durmast oak]
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        205   3e-62   Brassica rapa
ref|XP_010325989.1|  PREDICTED: aquaporin PIP2-1-like                   204   4e-62   
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               204   4e-62   Populus euphratica
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               204   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             204   5e-62   Eutrema salsugineum [saltwater cress]
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   204   5e-62   Cucumis melo [Oriental melon]
emb|CDX74983.1|  BnaA05g07290D                                          201   5e-62   
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                                 204   6e-62   Gossypium hirsutum [American cotton]
gb|AFQ23567.1|  aquaporin PIP2;2                                        204   8e-62   Eustoma exaltatum subsp. russellianum [bluebells]
gb|KJB20285.1|  hypothetical protein B456_003G141600                    205   8e-62   Gossypium raimondii
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    204   8e-62   Brassica rapa
gb|AFK35635.1|  unknown                                                 199   9e-62   Medicago truncatula
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               204   9e-62   Tarenaya hassleriana [spider flower]
emb|CDY13298.1|  BnaC06g14590D                                          204   9e-62   Brassica napus [oilseed rape]
ref|NP_001105639.1|  aquaporin PIP2-7                                   204   1e-61   
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg             203   1e-61   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          203   1e-61   Cicer arietinum [garbanzo]
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   203   1e-61   Glycine max [soybeans]
gb|AAW80918.1|  putative plasma membrane intrinsic protein              203   1e-61   Astragalus membranaceus
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               203   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        203   1e-61   Phoenix dactylifera
ref|NP_001237286.1|  PIP2,2                                             203   1e-61   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        203   1e-61   
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   203   1e-61   
gb|ACU19125.1|  unknown                                                 203   1e-61   Glycine max [soybeans]
gb|ABH09328.1|  putative aquaporin                                      203   1e-61   Vitis vinifera
gb|AGD98705.1|  aquaporin                                               203   1e-61   Camellia sinensis [black tea]
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   203   1e-61   Nicotiana sylvestris
ref|XP_003625627.1|  Aquaporin PIP2-1                                   203   1e-61   Medicago truncatula
gb|AFK33316.1|  unknown                                                 203   2e-61   Medicago truncatula
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             203   2e-61   Eutrema salsugineum [saltwater cress]
ref|NP_001240039.1|  uncharacterized protein LOC100782155               203   2e-61   Glycine max [soybeans]
emb|CDX67611.1|  BnaA07g16510D                                          203   2e-61   
gb|ACJ85211.1|  unknown                                                 202   2e-61   Medicago truncatula
gb|KHN00691.1|  Aquaporin PIP2-2                                        202   2e-61   Glycine soja [wild soybean]
gb|AHB33479.1|  plasma intrinsic protein 2-3                            202   3e-61   Cucumis sativus [cucumbers]
ref|XP_002316367.1|  putative aquaporin family protein                  202   3e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         202   3e-61   Ricinus communis
gb|ACV70050.1|  aquaporin PIP2;1                                        200   3e-61   Quercus macrocarpa [burr oak]
gb|ACR56613.1|  plasma intrinsic protein 2;3                            202   3e-61   Juglans regia
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             202   3e-61   Eutrema salsugineum [saltwater cress]
ref|XP_006436426.1|  hypothetical protein CICLE_v10032302mg             199   3e-61   
ref|NP_001235204.1|  Pip1 protein                                       202   3e-61   
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               202   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             202   4e-61   
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        202   4e-61   Cucumis melo [Oriental melon]
ref|XP_003606384.1|  Aquaporin PIP2-7                                   199   4e-61   
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             202   4e-61   Phaseolus vulgaris [French bean]
emb|CDY07519.1|  BnaC06g15450D                                          202   4e-61   Brassica napus [oilseed rape]
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  202   4e-61   Pyrus communis
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               202   4e-61   Elaeis guineensis
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             202   4e-61   Capsella rubella
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  202   4e-61   Pyrus communis
gb|ABU94631.1|  putative aquaporin PIP2;3                               202   5e-61   Phaseolus vulgaris [French bean]
gb|AFK47442.1|  unknown                                                 202   5e-61   Medicago truncatula
gb|KHG29841.1|  putative aquaporin PIP2-2                               202   5e-61   Gossypium arboreum [tree cotton]
ref|NP_001047491.1|  Os02g0629200                                       202   5e-61   
gb|EAY86778.1|  hypothetical protein OsI_08158                          202   5e-61   Oryza sativa Indica Group [Indian rice]
gb|ACV70048.1|  aquaporin PIP2;1                                        200   5e-61   Quercus macrocarpa [burr oak]
gb|AEQ29857.1|  aquaporin PIP2                                          202   5e-61   Malus prunifolia
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               202   5e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   202   5e-61   Nelumbo nucifera [Indian lotus]
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        201   6e-61   Malus domestica [apple tree]
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               202   6e-61   Pyrus x bretschneideri [bai li]
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   201   6e-61   Glycine max [soybeans]
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             201   6e-61   Citrus clementina [clementine]
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               201   6e-61   Sesamum indicum [beniseed]
gb|ABC69040.1|  aquaporin PIP2-1                                        201   7e-61   Rhododendron catawbiense [Catawba rosebay]
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        201   7e-61   Brassica rapa
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   201   7e-61   Nicotiana tomentosiformis
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   201   8e-61   Nicotiana tomentosiformis
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             201   8e-61   Phaseolus vulgaris [French bean]
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           201   8e-61   Raphanus sativus
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter        201   8e-61   Medicago truncatula
gb|ACU21481.1|  unknown                                                 201   8e-61   Glycine max [soybeans]
gb|AHG32323.1|  PIP2-2                                                  201   8e-61   Pisum sativum [garden pea]
gb|ABB13430.2|  plasma membrane intrinsic protein                       201   9e-61   Olea europaea
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                  200   9e-61   Citrus sinensis [apfelsine]
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               201   9e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2    201   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001274397.1|  aquaporin PIP2-1-like                              201   1e-60   Cucumis sativus [cucumbers]
emb|CDX91341.1|  BnaC04g08090D                                          201   1e-60   
ref|NP_001105616.1|  aquaporin PIP2-5                                   201   1e-60   Zea mays [maize]
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                     200   1e-60   Eucalyptus grandis [rose gum]
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   201   1e-60   Cucumis melo [Oriental melon]
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        201   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               201   1e-60   
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               200   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   201   1e-60   Setaria italica
emb|CAC82712.1|  major intrinsic protein 1                              201   2e-60   Populus tremula x Populus tremuloides
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                200   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   201   2e-60   Nicotiana sylvestris
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   201   2e-60   Setaria italica
gb|ACU20229.1|  unknown                                                 200   2e-60   Glycine max [soybeans]
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        200   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                200   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               200   2e-60   
gb|AAG44947.1|AF290620_1  putative PIP2                                 200   2e-60   Nicotiana glauca [glaucous tobacco]
emb|CAB45651.1|  putative plasma membrane intrinsic protein             200   2e-60   Pisum sativum [garden pea]
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 200   2e-60   Nicotiana tabacum [American tobacco]
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   200   2e-60   
ref|NP_001105026.1|  aquaporin PIP2-4                                   200   3e-60   Zea mays [maize]
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   200   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_003597235.1|  Aquaporin PIP2-7                                   200   3e-60   Medicago truncatula
gb|ACG33001.1|  aquaporin PIP2.2                                        200   3e-60   Zea mays [maize]
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   200   3e-60   
dbj|BAE02729.1|  PIP aquaporin                                          200   3e-60   Hordeum vulgare [barley]
emb|CDX91340.1|  BnaC04g08100D                                          200   3e-60   
gb|ACV70051.1|  aquaporin PIP2;1                                        197   3e-60   Quercus macrocarpa [burr oak]
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               200   3e-60   Eucalyptus grandis [rose gum]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          200   3e-60   Sorghum bicolor [broomcorn]
gb|ABK93567.1|  unknown                                                 199   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               199   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   200   3e-60   Setaria italica
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           199   3e-60   Raphanus sativus
gb|ACJ85173.1|  unknown                                                 199   3e-60   Medicago truncatula
gb|ABX83874.1|  plasma membrane intrinsic protein                       199   3e-60   Rhododendron catawbiense [Catawba rosebay]
gb|ADJ67992.1|  aquaporin                                               199   3e-60   Fragaria x ananassa
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             199   4e-60   Prunus persica
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             199   4e-60   Eutrema salsugineum [saltwater cress]
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               199   4e-60   Camelina sativa [gold-of-pleasure]
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        199   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   199   5e-60   Camelina sativa [gold-of-pleasure]
gb|AIK66515.1|  putative aquaporin                                      199   5e-60   Vitis vinifera
ref|NP_001267922.1|  aquaporin-like                                     199   5e-60   Vitis vinifera
gb|AEO13898.1|  aquaporin 7                                             199   5e-60   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          199   5e-60   Solanum tuberosum [potatoes]
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        199   5e-60   Camelina sativa [gold-of-pleasure]
gb|AGD98712.1|  aquaporin protein 9                                     199   5e-60   Camellia sinensis [black tea]
gb|ABH09326.1|  putative aquaporin                                      199   5e-60   Vitis vinifera
gb|AAV69744.1|  aquaporin                                               199   5e-60   Vitis vinifera
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   199   5e-60   Brassica rapa
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2           198   6e-60   Triticum aestivum [Canadian hard winter wheat]
emb|CAN75442.1|  hypothetical protein VITISV_019657                     199   6e-60   Vitis vinifera
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             199   6e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               199   6e-60   Brassica rapa
ref|XP_003606383.1|  Aquaporin PIP2-7                                   199   7e-60   Medicago truncatula
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               199   7e-60   Prunus mume [ume]
gb|ABN11917.1|  aquaporin                                               199   7e-60   Cucurbita ficifolia [chilacayote]
ref|NP_191042.1|  putative aquaporin PIP2-5                             199   7e-60   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    199   7e-60   
emb|CDX74984.1|  BnaA05g07300D                                          199   7e-60   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             199   7e-60   
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     199   8e-60   
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        199   8e-60   
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        199   8e-60   
gb|ACV70049.1|  aquaporin PIP2;1                                        197   9e-60   
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        199   9e-60   
ref|NP_001275065.1|  major intrinsic protein 2                          199   9e-60   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   199   9e-60   
emb|CDX10333.1|  aquaporin                                              199   9e-60   
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   198   9e-60   
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg             197   1e-59   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          198   1e-59   
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   198   1e-59   
gb|EMT09900.1|  Putative aquaporin PIP2-2                               199   1e-59   
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   198   1e-59   
gb|ACV70052.1|  aquaporin PIP2;1                                        196   1e-59   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             198   1e-59   
dbj|BAA23744.1|  HvPIP2;1                                               198   1e-59   
ref|XP_010507447.1|  PREDICTED: probable aquaporin PIP2-5               199   1e-59   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   198   1e-59   
ref|XP_004143248.1|  PREDICTED: aquaporin PIP2-1-like                   197   1e-59   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        198   2e-59   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          198   2e-59   
gb|ACV70053.1|  aquaporin PIP2;2                                        196   2e-59   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             197   2e-59   
ref|NP_001234625.1|  aquaporin                                          197   2e-59   
gb|ACM50914.1|  aquaporin                                               197   2e-59   
ref|NP_181255.1|  aquaporin PIP2-3                                      197   2e-59   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          197   2e-59   
ref|NP_001059542.1|  Os07g0448100                                       197   2e-59   
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        197   2e-59   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         197   2e-59   
gb|AAL32127.1|  aquaporin                                               197   2e-59   
ref|XP_006481456.1|  PREDICTED: aquaporin PIP2-2-like                   194   2e-59   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  199   3e-59   
emb|CDX73446.1|  BnaC08g25570D                                          197   3e-59   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             197   3e-59   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   197   3e-59   
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             197   3e-59   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               197   3e-59   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   197   3e-59   
ref|NP_001274386.1|  aquaporin PIP2-1-like                              197   3e-59   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               197   3e-59   
ref|NP_181254.1|  aquaporin PIP2-2                                      197   3e-59   
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                197   3e-59   
gb|AEY75244.1|  plasma membrane intrinsic protein                       197   3e-59   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    197   4e-59   
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             197   4e-59   
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          197   5e-59   
gb|EAZ39657.1|  hypothetical protein OsJ_24085                          197   5e-59   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             196   6e-59   
emb|CDY46759.1|  BnaA03g17030D                                          196   7e-59   
dbj|BAE06148.1|  PIP aquaporin isoform                                  196   8e-59   
gb|EMT03221.1|  hypothetical protein F775_43871                         196   1e-58   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          196   1e-58   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    196   1e-58   
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   196   1e-58   
gb|ACB87734.1|  aquaporin                                               195   1e-58   
ref|NP_001289846.1|  probable aquaporin PIP2-1                          196   1e-58   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  195   2e-58   
ref|NP_190910.1|  aquaporin PIP2-1                                      195   2e-58   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   195   2e-58   
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               195   2e-58   
gb|ABI96813.1|  plasma membrane intrinsic protein                       195   2e-58   
gb|ABM54183.1|  aquaporin                                               195   2e-58   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   195   2e-58   
dbj|BAG06231.1|  plasma membrane intrinsic protein                      195   2e-58   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   195   2e-58   
gb|AFQ23186.1|  aquaporin PIP2;1                                        195   3e-58   
gb|ABU94630.1|  putative aquaporin PIP2;2                               195   3e-58   
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   195   3e-58   
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 195   3e-58   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             195   3e-58   
gb|AAF61463.1|AF139814_1  plasma membrane intrinsic protein 1           195   3e-58   
gb|ADG03686.1|  aquaporin                                               195   3e-58   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               194   3e-58   
dbj|BAF33069.1|  aquaporin                                              194   3e-58   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   194   4e-58   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             194   4e-58   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          194   5e-58   
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          194   6e-58   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                   194   6e-58   
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        194   6e-58   
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   194   6e-58   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          194   7e-58   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   194   7e-58   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   194   7e-58   
ref|NP_001105025.1|  aquaporin PIP2-3                                   194   7e-58   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               193   9e-58   
gb|ACV70047.1|  aquaporin PIP2;1                                        191   1e-57   
ref|XP_002876271.1|  PIP2_5/PIP2D                                       193   1e-57   
ref|NP_200874.1|  putative aquaporin PIP2-4                             193   1e-57   
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    193   1e-57   
ref|NP_001105027.1|  aquaporin PIP2-6                                   193   1e-57   
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               193   2e-57   
ref|NP_001053335.1|  Os04g0521100                                       193   2e-57   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               192   2e-57   
gb|ABO69705.2|  aquaporin PIP2                                          192   3e-57   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        192   3e-57   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  192   3e-57   
gb|ABI96814.1|  plasma membrane intrinsic protein                       192   3e-57   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        192   3e-57   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          192   3e-57   
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        192   4e-57   
gb|EMS51072.1|  Aquaporin PIP2-5                                        192   4e-57   
emb|CDP07111.1|  unnamed protein product                                192   5e-57   
ref|NP_001280185.1|  aquaporin PIP2-2                                   191   5e-57   
gb|EMS56715.1|  putative aquaporin PIP2-2                               193   5e-57   
ref|NP_001274381.1|  aquaporin PIP2-7-like                              191   6e-57   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        191   1e-56   
ref|NP_001289999.1|  aquaporin PIP2-1                                   190   1e-56   
emb|CAB46351.1|  major intrinsic protein 2                              190   2e-56   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             190   2e-56   
ref|XP_010107541.1|  Aquaporin PIP2-2                                   190   2e-56   
gb|KJB73581.1|  hypothetical protein B456_011G239500                    188   2e-56   
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        196   3e-56   
gb|AFQ23181.1|  aquaporin PIP2;2                                        189   4e-56   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               189   4e-56   
ref|XP_006384579.1|  hypothetical protein POPTR_0004s18240g             186   5e-56   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               189   6e-56   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   189   6e-56   
ref|XP_007041805.1|  Plasma membrane intrinsic protein 3 isoform 2      186   7e-56   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               188   1e-55   
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like          188   1e-55   
ref|XP_010935141.1|  PREDICTED: aquaporin PIP2-7-like                   188   1e-55   
ref|XP_006657662.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    187   1e-55   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     187   2e-55   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    187   2e-55   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 187   2e-55   
ref|NP_001267957.1|  aquaporin PIP2;2                                   187   2e-55   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          187   2e-55   
ref|XP_006412151.1|  hypothetical protein EUTSA_v10025940mg             186   2e-55   
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2                186   3e-55   
gb|ACV70057.1|  aquaporin PIP2;3                                        185   3e-55   
gb|ABH09327.1|  putative aquaporin                                      187   3e-55   
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2                186   4e-55   
gb|ACR38689.1|  unknown                                                 185   4e-55   
ref|NP_001052292.1|  Os04g0233400                                       186   5e-55   
ref|XP_010933360.1|  PREDICTED: probable aquaporin PIP2-6               186   5e-55   
ref|NP_001059545.1|  Os07g0448800                                       186   5e-55   
gb|ACV70056.1|  aquaporin PIP2;3                                        184   6e-55   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     186   6e-55   
gb|ACV66986.1|  plasma membrane aquaporin 2                             186   6e-55   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          186   7e-55   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             186   7e-55   
gb|KGN47819.1|  hypothetical protein Csa_6G405320                       186   7e-55   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    186   8e-55   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               186   8e-55   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               186   8e-55   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   186   9e-55   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               186   1e-54   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        185   1e-54   
emb|CDX69112.1|  BnaC01g03410D                                          185   1e-54   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    185   1e-54   
ref|NP_001105638.1|  aquaporin PIP2-2                                   186   1e-54   
ref|XP_002306187.1|  membrane intrinsic family protein                  185   1e-54   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          185   1e-54   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               185   2e-54   
ref|NP_001105024.1|  aquaporin PIP2-1                                   185   2e-54   
gb|AAO86707.1|  aquaporin                                               185   2e-54   
gb|AAC16545.1|  aquaporin                                               185   2e-54   
gb|EMS55627.1|  Aquaporin PIP2-3                                        181   2e-54   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               185   2e-54   
gb|AFH36336.1|  aquaporin PIP2;1                                        184   2e-54   
dbj|BAG68662.1|  plasma membrane intrinsic protein                      184   2e-54   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                186   2e-54   
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg             182   2e-54   
gb|ACV70054.1|  aquaporin PIP2;3                                        182   3e-54   
gb|AEF32110.1|  aquaporin PIP2                                          184   3e-54   
gb|ACF79873.1|  unknown                                                 185   3e-54   
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6                184   4e-54   
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                   184   4e-54   
dbj|BAG68661.1|  plasma membrane intrinsic protein                      184   4e-54   
ref|XP_009345758.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        184   4e-54   
ref|NP_179277.1|  putative aquaporin PIP2-8                             184   5e-54   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               183   6e-54   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            183   6e-54   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               183   6e-54   
gb|ABI96815.1|  plasma membrane intrinsic protein                       183   7e-54   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        183   7e-54   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               183   8e-54   
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             183   8e-54   
gb|KJB15836.1|  hypothetical protein B456_002G198900                    181   8e-54   
gb|KJB15839.1|  hypothetical protein B456_002G198900                    181   8e-54   
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                   183   9e-54   
ref|XP_008806122.1|  PREDICTED: aquaporin PIP2-7-like                   183   9e-54   
gb|ACU87556.1|  PIP protein                                             183   1e-53   
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 182   1e-53   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          183   1e-53   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   183   1e-53   
gb|KHG01329.1|  Aquaporin PIP2-7 -like protein                          181   1e-53   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             183   1e-53   
gb|ABL76066.1|  aquaporin 2                                             182   1e-53   
gb|KJB12139.1|  hypothetical protein B456_002G002500                    182   1e-53   
gb|ACB42441.1|  aquaporin PIP2;4                                        182   1e-53   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               182   1e-53   
gb|ACU87555.1|  PIP protein                                             182   1e-53   
gb|KJB15838.1|  hypothetical protein B456_002G198900                    181   1e-53   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                182   2e-53   
emb|CDX76314.1|  BnaA08g10860D                                          182   2e-53   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             182   2e-53   
ref|XP_004137971.1|  PREDICTED: probable aquaporin PIP2-4-like          182   2e-53   
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8               182   2e-53   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               182   2e-53   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein     182   2e-53   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               182   2e-53   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   182   3e-53   
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                   181   3e-53   
emb|CDY17511.1|  BnaC03g65520D                                          182   3e-53   
gb|AAG30607.1|AF314656_1  aquaporin                                     181   3e-53   
gb|AAB65787.1|  plasma membrane intrinsic protein                       181   3e-53   
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   181   3e-53   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               181   3e-53   
ref|XP_004164389.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    182   4e-53   
dbj|BAG06230.1|  plasma membrane intrinsic protein                      181   4e-53   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        181   4e-53   
gb|ACB42440.1|  aquaporin PIP2;3                                        181   4e-53   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    181   4e-53   



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   238 bits (607),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 137/142 (96%), Gaps = 2/142 (1%)
 Frame = +1

Query  70   KMAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            +MAKD EVGTEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  8    QMAKDTEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  66

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQTDP+ KG ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  67   GYKSQTDPDHKG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  125

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA+MYM+AQCLGAICGCG
Sbjct  126  VSLVRAIMYMLAQCLGAICGCG  147



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 135/142 (95%), Gaps = 2/142 (1%)
 Frame = +1

Query  70   KMAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            +MAKD EVGTEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  8    QMAKDTEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  66

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  67   GYKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  125

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA+MYM+AQCLGAICGCG
Sbjct  126  VSLVRAIMYMLAQCLGAICGCG  147



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   232 bits (592),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVGTEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+MYM+AQCLGAICGCG
Sbjct  119  SLVRAIMYMLAQCLGAICGCG  139



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   232 bits (592),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVGTEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+MYM+AQCLGAICGCG
Sbjct  119  SLVRAIMYMLAQCLGAICGCG  139



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score =   232 bits (591),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVGTEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD +  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTDTDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+MYM+AQCLGAICGCG
Sbjct  119  SLVRAIMYMLAQCLGAICGCG  139



>ref|XP_006367009.1| PREDICTED: probable aquaporin PIP2-2-like [Solanum tuberosum]
Length=204

 Score =   227 bits (579),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 131/141 (93%), Gaps = 6/141 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVGTEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ       TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQNS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+MY+VAQCLGAICGCG
Sbjct  115  SLVRAIMYIVAQCLGAICGCG  135



>ref|NP_001289823.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18626.1| plasmamembrane intrinsic protein 2;1 [Solanum lycopersicum]
Length=279

 Score =   229 bits (584),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 6/141 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVGTEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDMEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQSS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+MY+VAQCLGAICGCG
Sbjct  115  SLVRAIMYIVAQCLGAICGCG  135



>ref|XP_006367007.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Solanum tuberosum]
Length=287

 Score =   227 bits (578),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVGTEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKG---TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            Y SQ   +  G   TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLA
Sbjct  60   YNSQNSTDQCGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA+MY+VAQCLGAICGCG
Sbjct  120  RKVSLVRAIMYIVAQCLGAICGCG  143



>ref|XP_006367008.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Solanum tuberosum]
Length=279

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 130/141 (92%), Gaps = 6/141 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVGTEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQ       TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YNSQNS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+MY+VAQCLGAICGCG
Sbjct  115  SLVRAIMYIVAQCLGAICGCG  135



>gb|KJB36606.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=203

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVEVG E+ A KDY DPPPAPL+D EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP+ KG+DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQVDPD-KGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+ YM AQCLGAICGCG
Sbjct  119  SLVRAIFYMAAQCLGAICGCG  139



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EV       KDYQDPPPAPLID EELG+WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVKDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP+ KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RAV+YMVAQCLGAICGCG
Sbjct  120  SLIRAVLYMVAQCLGAICGCG  140



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 130/142 (92%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+E GT +YA  KDYQDPPPAPLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            +SL RAVMYM+AQCLGAICGCG
Sbjct  120  ISLARAVMYMIAQCLGAICGCG  141



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVEVG E+ A KDY DPPPAPL+D EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP+ KG+DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQVDPD-KGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+ YM AQCLGAICGCG
Sbjct  119  SLVRAIFYMAAQCLGAICGCG  139



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+E GT +YA  KDYQDPPPAPLID EELGKWSFYRAI+AEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            +SL RAVMYM+AQCLGAICGCG
Sbjct  120  ISLARAVMYMIAQCLGAICGCG  141



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+E      A +DYQDPPPAPL+DPEELGKWSFYRA+IAEFIAT+LFLY+TVLTVIG
Sbjct  1    MGKDLEGAQPPLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP + G+D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YKSQTDPTMNGSD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAVMYMVAQCLGAICGCG
Sbjct  120  SLVRAVMYMVAQCLGAICGCG  140



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EV       +DYQDPPPAPLID EELG+WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVRDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP+ KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RAV+YMVAQCLGAICGCG
Sbjct  120  SLIRAVLYMVAQCLGAICGCG  140



>gb|KCW51391.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=209

 Score =   219 bits (559),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 130/143 (91%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVG--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV    E+AA KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPAEFAA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQTDP +KGTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQTDPALKGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV YMVAQCLGAICGCG
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCG  141



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD N  G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQCLGAICGCG
Sbjct  119  SLVRAILYMVAQCLGAICGCG  139



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD N  G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQCLGAICGCG
Sbjct  119  SLVRAILYMVAQCLGAICGCG  139



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 132/147 (90%), Gaps = 8/147 (5%)
 Frame = +1

Query  73   MAKDVEV------GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  234
            M KDVEV      G E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  235  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRL  414
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF L
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  415  FLARKVSLVRAVMYMVAQCLGAICGCG  495
            FL RKVSL+RA++YMVAQCLGAICGCG
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCG  145



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 132/147 (90%), Gaps = 8/147 (5%)
 Frame = +1

Query  73   MAKDVEV------GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  234
            M KDVEV      G E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  235  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRL  414
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF L
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  415  FLARKVSLVRAVMYMVAQCLGAICGCG  495
            FL RKVSL+RA++YMVAQCLGAICGCG
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCG  145



>gb|KJB62460.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=202

 Score =   217 bits (552),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVG E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+ YM AQCLGAICGCG
Sbjct  119  SLVRAIFYMGAQCLGAICGCG  139



>ref|XP_010043747.1| PREDICTED: probable aquaporin PIP2-5 [Eucalyptus grandis]
 gb|KCW85738.1| hypothetical protein EUGRSUZ_B02500 [Eucalyptus grandis]
Length=284

 Score =   219 bits (558),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+E G      +DYQDPPPAPL+DPEELGKWSFYRA+IAEFIAT+LFLY+TVLTVIG
Sbjct  1    MGKDMESGEPPFGARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP + GT EC GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YKSQVDPALNGT-ECDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAVMYMVAQCLGAICGCG
Sbjct  120  SLVRAVMYMVAQCLGAICGCG  140



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 132/147 (90%), Gaps = 8/147 (5%)
 Frame = +1

Query  73   MAKDVEV------GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  234
            M KDVEV      G E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  235  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRL  414
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF L
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  415  FLARKVSLVRAVMYMVAQCLGAICGCG  495
            FL RKVSL+RA++YMVAQCLGAICGCG
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCG  145



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   219 bits (558),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD N  G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTDVNKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQCLGAICGCG
Sbjct  119  SLVRAILYMVAQCLGAICGCG  139



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 131/143 (92%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV    EY+A KDY DPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGEYSA-KDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQTDP +K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQTDP-LKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV+YMVAQCLGAICG G
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVG  141



>ref|XP_006339071.1| PREDICTED: aquaporin PIP2-1-like [Solanum tuberosum]
Length=281

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 129/142 (91%), Gaps = 6/142 (4%)
 Frame = +1

Query  73   MAKDVEVGT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+E G  +YA  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA+ Y+VAQCLGAICGCG
Sbjct  116  VSLVRAIFYIVAQCLGAICGCG  137



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 130/143 (91%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVG--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV    E+AA KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPAEFAA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQTDP +KGTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQTDPALKGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV YMVAQCLGAICGCG
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCG  141



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 128/141 (91%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG E++A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAV+YMVAQCLGAICGCG
Sbjct  119  SLVRAVLYMVAQCLGAICGCG  139



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 128/141 (91%), Gaps = 4/141 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVG ++ A KDY DPPPAPL+D EEL KWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGQFQA-KDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ D   KG DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQID---KGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  116

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YM AQCLGAICGCG
Sbjct  117  SLVRAILYMAAQCLGAICGCG  137



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 127/141 (90%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGREFIA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAV+YMVAQCLGAICGCG
Sbjct  119  SLVRAVLYMVAQCLGAICGCG  139



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score =   218 bits (554),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVG E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+ YM AQCLGAICGCG
Sbjct  119  SLVRAIFYMGAQCLGAICGCG  139



>gb|KJB62459.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=285

 Score =   218 bits (554),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVG E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+ YM AQCLGAICGCG
Sbjct  119  SLVRAIFYMGAQCLGAICGCG  139



>gb|KJB16797.1| hypothetical protein B456_002G2484002, partial [Gossypium raimondii]
Length=142

 Score =   213 bits (541),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 127/141 (90%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVEVG E+ A KDY DPPPAP +D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPFVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YM AQCLGAICGCG
Sbjct  119  SLVRAILYMAAQCLGAICGCG  139



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   217 bits (552),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVEVG E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP+ KG+ +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQVDPD-KGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YM AQCLGAICGCG
Sbjct  119  SLVRAILYMAAQCLGAICGCG  139



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   217 bits (552),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVG---TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKD+EVG    E+   KDYQDPPPAPL+DPEEL +WSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  61   VIGYKSQSDTKANG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRAV+YMVAQCLGAICGCG
Sbjct  120  RKVSLVRAVLYMVAQCLGAICGCG  143



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score =   216 bits (551),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 128/141 (91%), Gaps = 1/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVG    APKDYQDPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGPGANAPKDYQDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVLTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQTDP+ K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT  LFLA+KV
Sbjct  61   YSSQTDPD-KNPDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLAQKV  119

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YM+AQCLGAICGCG
Sbjct  120  SLVRAMLYMMAQCLGAICGCG  140



>ref|NP_001274308.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18628.1| plasmamembrane intrinsic protein 2;5 [Solanum lycopersicum]
Length=281

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 128/142 (90%), Gaps = 6/142 (4%)
 Frame = +1

Query  73   MAKDVEVGT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+E G  +YA  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF L LARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARK  115

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA+ Y+VAQCLGAICGCG
Sbjct  116  VSLVRAIFYIVAQCLGAICGCG  137



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 127/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  73   MAKDVEVGT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KDVEVG    E+ A KDY DPPPAPLID EEL KWSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEVGGHGGEFHA-KDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLA
Sbjct  60   VIGYKSQTDP-AKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA+MYM AQCLGAICGCG
Sbjct  119  RKVSLVRAIMYMAAQCLGAICGCG  142



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVEVG E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YM AQCLGAICGCG
Sbjct  119  SLVRAILYMAAQCLGAICGCG  139



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 127/141 (90%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVEVG E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIA LLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YM AQCLGAICGCG
Sbjct  119  SLVRAILYMAAQCLGAICGCG  139



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDVEV  E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDVEVRGEFIA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAV+YMVAQCLGAICGCG
Sbjct  119  SLVRAVLYMVAQCLGAICGCG  139



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 127/141 (90%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG E++A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ D    G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQIDTTKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQCLGAICGCG
Sbjct  119  SLVRAILYMVAQCLGAICGCG  139



>ref|XP_004304426.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 128/141 (91%), Gaps = 3/141 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M +D+EVG    A KDYQDPPP PLIDPEE GKWSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGRDIEVGG--FAAKDYQDPPPTPLIDPEEFGKWSFYRAIIAEFVATLLFLYITVLTVIG  58

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  59   YKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL RAV+Y+VAQCLGAICGCG
Sbjct  118  SLPRAVLYIVAQCLGAICGCG  138



>ref|XP_006367014.1| PREDICTED: aquaporin PIP2-1-like, partial [Solanum tuberosum]
Length=279

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 126/136 (93%), Gaps = 4/136 (3%)
 Frame = +1

Query  97   TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPN  276
            TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ   +
Sbjct  1    TEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQNSTD  59

Query  277  VKG---TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKVSLVRA  447
              G   TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKVSLVRA
Sbjct  60   QCGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRA  119

Query  448  VMYMVAQCLGAICGCG  495
            +MY+VAQCLGAICGCG
Sbjct  120  IMYIVAQCLGAICGCG  135



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   214 bits (546),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 127/144 (88%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KDVEV  + A   + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYKSQTDPN    D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLA
Sbjct  61   VIGYKSQTDPNTNA-DQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL++AV+YMVAQCLGAICG G
Sbjct  120  RKVSLIKAVLYMVAQCLGAICGVG  143



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   214 bits (545),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 126/147 (86%), Gaps = 7/147 (5%)
 Frame = +1

Query  73   MAKDVEVGTEYA------APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  234
            M KDVEV  +        + KDY DPPPAPLID EELGKWSFYRA+IAEFIATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  235  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRL  414
            VLT IGYKSQTDP +  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF L
Sbjct  61   VLTAIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  119

Query  415  FLARKVSLVRAVMYMVAQCLGAICGCG  495
            FL RKVSL+RA++YMVAQCLGAICGCG
Sbjct  120  FLGRKVSLIRALLYMVAQCLGAICGCG  146



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   214 bits (545),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 130/145 (90%), Gaps = 6/145 (4%)
 Frame = +1

Query  73   MAKDVEV----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            MAKDVEV    G E++A KDY DPPPAPLID +ELGKWSFYRA+IAEFIATLLFLY+TVL
Sbjct  1    MAKDVEVAEATGGEFSA-KDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVL  59

Query  241  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFL  420
            TVIGYKSQTDP+ K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL
Sbjct  60   TVIGYKSQTDPD-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  421  ARKVSLVRAVMYMVAQCLGAICGCG  495
             RKVSL+RA+ YMVAQCLGAICGCG
Sbjct  119  GRKVSLIRALGYMVAQCLGAICGCG  143



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   214 bits (545),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFNA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ D    G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQIDTTKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQCLGAICGCG
Sbjct  119  SLVRAILYMVAQCLGAICGCG  139



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 127/141 (90%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG  Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF L LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQ LGAICG G
Sbjct  119  SLVRAILYMVAQSLGAICGVG  139



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 127/143 (89%), Gaps = 3/143 (2%)
 Frame = +1

Query  73   MAKDVEVGTE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV     Y+A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGSYSA-KDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQTD  V   D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQTDTTVATGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RA++Y+VAQCLGAICG G
Sbjct  120  KVSLIRAILYIVAQCLGAICGVG  142



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 129/142 (91%), Gaps = 7/142 (5%)
 Frame = +1

Query  73   MAKDVEVG-TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EVG TEY A KDYQDPPPAPLIDPEELGKWS YRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEVGGTEYGA-KDYQDPPPAPLIDPEELGKWSLYRAVIAEFIATLLFLYITVLTVI  59

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+      TDECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  60   GYKSQS-----ATDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  114

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRAV+Y++AQCLGAI G G
Sbjct  115  VSLVRAVLYIIAQCLGAISGVG  136



>ref|NP_001268058.1| aquaporin-like [Vitis vinifera]
 gb|ABN14352.1| aquaporin PIP2;3 [Vitis vinifera]
 emb|CAN77241.1| hypothetical protein VITISV_029527 [Vitis vinifera]
 gb|AIK66516.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEV-GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV G      KDY DPPPAPL+DPEELG WSFYRAIIAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEVAGHGDLTLKDYHDPPPAPLVDPEELGSWSFYRAIIAEFVATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK+QTDP   G +EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKNQTDPYHHG-NECNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRAVMYMVAQC GAICGCG
Sbjct  120  VSLVRAVMYMVAQCGGAICGCG  141



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG E+ A KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFIA-KDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD   K  D CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTD-TAKNGDVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQCLGAICGCG
Sbjct  119  SLVRAILYMVAQCLGAICGCG  139



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 125/141 (89%), Gaps = 5/141 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAK+ E   E+ A KDY DPPPAPL D EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKEAEAAGEFRA-KDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQID----GGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  115

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQCLGAICGCG
Sbjct  116  SLVRAILYMVAQCLGAICGCG  136



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVG      KDYQDPPPA L D EEL KWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVGGNDYGAKDYQDPPPAELFDAEELTKWSFYRAIIAEFIATLLFLYVTVLTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP    +D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR V
Sbjct  61   YKSQTDP-ANSSDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARXV  119

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL RA MYMVAQCLGAICGCG
Sbjct  120  SLPRAFMYMVAQCLGAICGCG  140



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+E   E  + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIESSVEQVSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLTVIG  60

Query  253  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL RK
Sbjct  61   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  120

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICGCG
Sbjct  121  VSLIRAIMYMVAQCLGAICGCG  142



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 126/140 (90%), Gaps = 3/140 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVG    A KDY DPPP PLIDPEE GKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGF--AAKDYHDPPPTPLIDPEEFGKWSFYRAIIAEFIATLLFLYITVLTVIG  58

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  59   YKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  433  SLVRAVMYMVAQCLGAICGC  492
            SL RAVMY+VAQ LGAICGC
Sbjct  118  SLPRAVMYIVAQSLGAICGC  137



>gb|KCW51593.1| hypothetical protein EUGRSUZ_J01087 [Eucalyptus grandis]
Length=336

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 7/148 (5%)
 Frame = +1

Query  70   KMAKDVEVGTEYAAP------KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyv  231
            + AK+  + T++AA       KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+
Sbjct  93   RFAKNTSM-TKHAAEHGSFSAKDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYI  151

Query  232  tvltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFR  411
            TVLTVIGYKSQTD    GTD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF 
Sbjct  152  TVLTVIGYKSQTDDKKPGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  211

Query  412  LFLARKVSLVRAVMYMVAQCLGAICGCG  495
            LFLARKVSLVRA+MYMVAQCLGAICG G
Sbjct  212  LFLARKVSLVRAIMYMVAQCLGAICGVG  239



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+E   E  + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIESSVEQGSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLTVIG  60

Query  253  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL RK
Sbjct  61   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  120

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICGCG
Sbjct  121  VSLIRAIMYMVAQCLGAICGCG  142



>ref|XP_010032196.1| PREDICTED: aquaporin PIP2-1 [Eucalyptus grandis]
Length=284

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  115  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  294
            KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+TVLTVIGYKSQTD    GTD 
Sbjct  14   KDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIGYKSQTDDKKPGTDA  73

Query  295  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKVSLVRAVMYMVAQCL  474
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKVSLVRA+MYMVAQCL
Sbjct  74   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQCL  133

Query  475  GAICGCG  495
            GAICG G
Sbjct  134  GAICGVG  140



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG  Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF L LARKV
Sbjct  60   YKSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YM AQ LGAICG G
Sbjct  119  SLVRAILYMTAQSLGAICGVG  139



>ref|XP_008366675.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=281

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG  Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF L LARKV
Sbjct  60   YKSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YM AQ LGAICG G
Sbjct  119  SLVRAILYMTAQSLGAICGVG  139



>ref|XP_010046653.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=286

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 5/143 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD+EVG  + +   KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  61   IGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVRAV+YMVAQCLGA+CGCG
Sbjct  118  KVSLVRAVLYMVAQCLGAVCGCG  140



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 129/145 (89%), Gaps = 7/145 (5%)
 Frame = +1

Query  73   MAKDVEVGTEYAAP----KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            MAKDVEV  + +AP    KDY DPPPAPLIDPEEL KWSFYRA+IAEFIATLLFLYVTVL
Sbjct  1    MAKDVEV--QESAPEFTAKDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVL  58

Query  241  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFL  420
            TVIGYK Q+D    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL
Sbjct  59   TVIGYKVQSDTKAGG-DDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  421  ARKVSLVRAVMYMVAQCLGAICGCG  495
            ARKVSLVRA++YMVAQCLGAICGCG
Sbjct  118  ARKVSLVRALLYMVAQCLGAICGCG  142



>ref|XP_008345040.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=166

 Score =   208 bits (529),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVG+   A KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVGSGNPA-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK QTD  + G ++CGGVGI GIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFL RKV
Sbjct  60   YKQQTDTTLNG-NQCGGVGIHGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLTRKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RA++YMVAQ LGAI G G
Sbjct  119  SLMRAILYMVAQSLGAIWGVG  139



>ref|XP_010920406.1| PREDICTED: aquaporin PIP2-4 isoform X2 [Elaeis guineensis]
Length=238

 Score =   210 bits (535),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+E G E+ A KDY DPPPAPL+D EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MRKDMEAGAEFTA-KDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVATVIG  59

Query  253  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            YK Q+DPNV G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  60   YKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA++YM+AQCLGAICG G
Sbjct  120  VSLIRALLYMIAQCLGAICGVG  141



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   212 bits (539),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 127/143 (89%), Gaps = 3/143 (2%)
 Frame = +1

Query  73   MAKDVEVG--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV   T   + KDY DPPPAPLID +ELG+WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLTV  60

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQTDPN K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL R
Sbjct  61   IGYKSQTDPN-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RA+ YM+AQCLGAICGCG
Sbjct  120  KVSLIRALGYMIAQCLGAICGCG  142



>gb|KCW88816.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=325

 Score =   213 bits (542),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 5/146 (3%)
 Frame = +1

Query  64   ELKMAKDVEVGTEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  237
            E  MAKD+EVG  + +   KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TV
Sbjct  68   EAGMAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITV  127

Query  238  ltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLF  417
            LTVIGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LF
Sbjct  128  LTVIGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  184

Query  418  LARKVSLVRAVMYMVAQCLGAICGCG  495
            LARKVSLVRAV+YMVAQCLGA+CGCG
Sbjct  185  LARKVSLVRAVLYMVAQCLGAVCGCG  210



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   211 bits (538),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 125/141 (89%), Gaps = 3/141 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDVE G   A  KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDVEGGDFQA--KDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVIG  58

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP+ K +D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  59   YKSQTDPS-KNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  117

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YM AQCLGAICGCG
Sbjct  118  SLVRAILYMAAQCLGAICGCG  138



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   211 bits (537),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  73   MAKDVEVGT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVEV     E++A KDY DPPPAPLID EELGKWS YRA+IAEFIATLLFLY TVLT
Sbjct  1    MAKDVEVAENPGEFSA-KDYHDPPPAPLIDVEELGKWSLYRALIAEFIATLLFLYNTVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYKSQTDP +K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  LFL 
Sbjct  60   VIGYKSQTDP-LKNADVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  118

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++YMVAQCLGAICGCG
Sbjct  119  RKVSLIRALLYMVAQCLGAICGCG  142



>gb|KCW88815.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=356

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 5/146 (3%)
 Frame = +1

Query  64   ELKMAKDVEVGTEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  237
            E  MAKD+EVG  + +   KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TV
Sbjct  68   EAGMAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITV  127

Query  238  ltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLF  417
            LTVIGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LF
Sbjct  128  LTVIGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  184

Query  418  LARKVSLVRAVMYMVAQCLGAICGCG  495
            LARKVSLVRAV+YMVAQCLGA+CGCG
Sbjct  185  LARKVSLVRAVLYMVAQCLGAVCGCG  210



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+E G      KDY DPPPAPLID EEL KWS YRA+IAEF+ATLLFLY+TV TVIG
Sbjct  1    MGKDMEAGAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVATVIG  60

Query  253  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            YK Q+DPNV GTD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   YKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  120

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA++YM+AQCLGAICG G
Sbjct  121  VSLIRALLYMIAQCLGAICGAG  142



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAK +EVG E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATL FLY+TVLTVIG
Sbjct  1    MAKAIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK+QTD   KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKTQTDL-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+ YM AQCLGAICGCG
Sbjct  119  SLVRAIFYMGAQCLGAICGCG  139



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  73   MAKDVEVGT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVEVG    E+ A KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVGGQGGEFQA-KDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  LFLA
Sbjct  60   VIGYKSQTDP-AKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  118

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA++YM AQCLGAICGCG
Sbjct  119  RKVSLVRAILYMAAQCLGAICGCG  142



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 127/143 (89%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGTE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV     Y+A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGSYSA-KDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQSDTKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RA++YMVAQCLGAICG G
Sbjct  119  KVSLIRAILYMVAQCLGAICGVG  141



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 128/141 (91%), Gaps = 4/141 (3%)
 Frame = +1

Query  73   MAKDVEVGTE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD+ V  +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICG  489
            KVSL+RAVMY+VAQCLGAICG
Sbjct  119  KVSLIRAVMYIVAQCLGAICG  139



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 128/143 (90%), Gaps = 8/143 (6%)
 Frame = +1

Query  73   MAKDVEV--GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV  G E+ A KDY DPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLYVT+LTV
Sbjct  1    MAKDVEVVEGGEFQA-KDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYVTILTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ+      TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQS-----ATDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVRAV+Y+VAQCLGAICG G
Sbjct  115  KVSLVRAVLYIVAQCLGAICGTG  137



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 127/149 (85%), Gaps = 9/149 (6%)
 Frame = +1

Query  73   MAKDVEVGTEYA--------APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllfly  228
            M KDVEV  +          + KDY D PPAPLID +ELGKWSFYRA+IAEFIATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  229  vtvltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  408
            VTVLTVIGYKSQTDP +  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  61   VTVLTVIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  119

Query  409  RLFLARKVSLVRAVMYMVAQCLGAICGCG  495
             LFL RKVSL+RA++YMVAQCLGAICGCG
Sbjct  120  GLFLGRKVSLIRALLYMVAQCLGAICGCG  148



>gb|KCW51592.1| hypothetical protein EUGRSUZ_J01087 [Eucalyptus grandis]
Length=383

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 7/148 (5%)
 Frame = +1

Query  70   KMAKDVEVGTEYAAP------KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyv  231
            + AK+  + T++AA       KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+
Sbjct  93   RFAKNTSM-TKHAAEHGSFSAKDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYI  151

Query  232  tvltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFR  411
            TVLTVIGYKSQTD    GTD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF 
Sbjct  152  TVLTVIGYKSQTDDKKPGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  211

Query  412  LFLARKVSLVRAVMYMVAQCLGAICGCG  495
            LFLARKVSLVRA+MYMVAQCLGAICG G
Sbjct  212  LFLARKVSLVRAIMYMVAQCLGAICGVG  239



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+EVG  Y+A KDYQD PP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF L LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQ LGAICG G
Sbjct  119  SLVRAILYMVAQSLGAICGVG  139



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 128/142 (90%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAKDVEVGTE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD+ V  +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGC  492
            KVSL+RAVMY+VAQCLGAICG 
Sbjct  119  KVSLIRAVMYIVAQCLGAICGV  140



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+E G E+ A KDY DPPPAPL+D EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MRKDMEAGAEFTA-KDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVATVIG  59

Query  253  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            YK Q+DPNV G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  60   YKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA++YM+AQCLGAICG G
Sbjct  120  VSLIRALLYMIAQCLGAICGVG  141



>ref|XP_008345410.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=227

 Score =   208 bits (529),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 127/142 (89%), Gaps = 3/142 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EVG+   A KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVGSGNPA-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGIS-GGHINPAVTFRLFLARK  429
            YK QTD  + G ++CGGVGI GIAWAFGGMIF+LVYCTAGIS GGHINPAVTF LFL RK
Sbjct  60   YKQQTDTTLNG-NQCGGVGIHGIAWAFGGMIFVLVYCTAGISGGGHINPAVTFGLFLTRK  118

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA++YMVAQ LGAICG G
Sbjct  119  VSLMRAILYMVAQSLGAICGVG  140



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD+E+G  Y+A KDYQD PP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEIGGGYSA-KDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF L LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQ LGAICG G
Sbjct  119  SLVRAILYMVAQSLGAICGVG  139



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDV     ++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MVKDVAEQGSFSA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTDP-AKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAVMYMVAQ LGAICG G
Sbjct  119  SLVRAVMYMVAQSLGAICGVG  139



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 127/143 (89%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV    EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RA++Y+VAQC GAICG G
Sbjct  119  KVSLIRALLYIVAQCAGAICGTG  141



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 127/143 (89%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV    EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RA++Y+VAQC GAICG G
Sbjct  119  KVSLIRALLYIVAQCAGAICGTG  141



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEV-GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+E  G    + KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQTD   KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRAV YM AQCLGA+CGCG
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCG  141



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   209 bits (532),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +1

Query  100  EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNV  279
            E+   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIGYKSQTDPN+
Sbjct  7    EHHGGKDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNL  66

Query  280  KGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKVSLVRAVMYM  459
              TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKVSL+RA++YM
Sbjct  67   N-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYM  125

Query  460  VAQCLGAICGCG  495
            VAQCLGAICG G
Sbjct  126  VAQCLGAICGVG  137



>gb|ACU23034.1| unknown [Glycine max]
Length=158

 Score =   205 bits (521),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVEV    + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY  QTD    G + CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYNHQTDLKENG-EICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  120  VSLIRAIMYMVAQCLGAICGVG  141



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   209 bits (532),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = +1

Query  94   GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDP  273
            G E+AA KDY DPPPAPLID  ELG WS YRA+IAEFIATLLFLY+TVLTVIGYK QTDP
Sbjct  13   GGEFAA-KDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTDP  71

Query  274  NVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKVSLVRAVM  453
            NV GTD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKVSLVRA++
Sbjct  72   NVAGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALL  131

Query  454  YMVAQCLGAICGCG  495
            Y+VAQCLGAICG G
Sbjct  132  YIVAQCLGAICGVG  145



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   209 bits (532),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEV-GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+E  G    + KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQTD   KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRAV YM AQCLGA+CGCG
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCG  141



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+EV  E  A +DYQDPPPAPL D EELGKWS YRA+IAEF+ATLLFLYV++LTVIG
Sbjct  1    MAKDLEV-QEGRAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKAQTDASAGGAD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVR V+Y+VAQCLGAICGCG
Sbjct  119  SLVRTVLYIVAQCLGAICGCG  139



>gb|KJB56129.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=232

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KD+E   ++    + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  244  vIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFL  420
            VIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  421  ARKVSLVRAVMYMVAQCLGAICGCG  495
             RKVSL+RA+MYMVAQCLGAICGCG
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCG  145



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 127/143 (89%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV    EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RA++Y+VAQC GAICG G
Sbjct  119  KVSLIRALLYIVAQCAGAICGTG  141



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            M KD+EVG +   + KDY DPPP PLID EE GKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MGKDIEVGPQGGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL RAV+Y+VAQ LGAICGCG
Sbjct  120  VSLPRAVLYIVAQSLGAICGCG  141



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVEV   G EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++YMVAQC GAICG G
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTG  142



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVEV   G EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++YMVAQC GAICG G
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTG  142



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 5/141 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDVE   +  + KDY DPPPAPLIDP+EL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKDVETSGQEFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIATLLFLYITVLTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ+D     TD CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YKSQSD-----TDPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  115

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA+MYM+AQCLGA+CG G
Sbjct  116  SLVRALMYMIAQCLGAVCGVG  136



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVEV   G EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK QTD  V GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQTDTTVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++YMVAQC GAICG G
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTG  142



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 127/141 (90%), Gaps = 4/141 (3%)
 Frame = +1

Query  73   MAKDVEVGTE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD+ V  +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICG  489
            KVSL+RA +YMVAQCLGAICG
Sbjct  119  KVSLIRAGLYMVAQCLGAICG  139



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 128/143 (90%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVE  +E++  + KDY DPPPA LIDP+EL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVE-SSEHSQFSAKDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK QTD +  GTD CGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKRQTDSSHNGTD-CGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAVMY++AQCLGAICG G
Sbjct  119  KVSLIRAVMYIIAQCLGAICGVG  141



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDV     ++A KDY DPPPAPLIDP EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKDVPEQGSFSA-KDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKS TDP +   D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSTTDPALN-ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RA+MYMVAQCLGAICG G
Sbjct  119  SLIRAIMYMVAQCLGAICGVG  139



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVE-VGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVE V  E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF L LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA++YMVAQCLGAICG G
Sbjct  120  VSLVRAILYMVAQCLGAICGVG  141



>ref|XP_010554547.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDV     ++  KDY DPPPAPL D  ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVAEHGSFSG-KDYHDPPPAPLFDATELGKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVK-GTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            Y SQT+  +  G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  60   YNSQTNTTLNPGADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRAVMYMVAQCLGAICG G
Sbjct  120  VSLVRAVMYMVAQCLGAICGVG  141



>gb|EPS68613.1| hypothetical protein M569_06155, partial [Genlisea aurea]
Length=280

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 123/143 (86%), Gaps = 7/143 (5%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            M KD+EVG   EY   KDY DPPPAPLIDPEEL KWS YRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MTKDLEVGRSGEYGHAKDYHDPPPAPLIDPEELVKWSLYRAVIAEFIATLLFLYITVLTV  60

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ       TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  61   IGYKSQF-----ATDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVRA +Y+VAQCLGAICGCG
Sbjct  116  KVSLVRAFLYIVAQCLGAICGCG  138



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KD+E   ++    + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  244  vIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFL  420
            VIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  421  ARKVSLVRAVMYMVAQCLGAICGCG  495
             RKVSL+RA+MYMVAQCLGAICGCG
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCG  145



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKDIEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ D N    D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQIDGN---ADPCNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAVMYMVAQCLGAICG G
Sbjct  118  VSLIRAVMYMVAQCLGAICGVG  139



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 124/142 (87%), Gaps = 5/142 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVEV    + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  117  VSLIRAIMYMVAQCLGAICGVG  138



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 126/146 (86%), Gaps = 6/146 (4%)
 Frame = +1

Query  73   MAKDVEV----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            M KD+E     G E++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVL
Sbjct  1    MTKDIETAEQRGGEFSA-KDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVL  59

Query  241  tvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLF  417
            TVIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF
Sbjct  60   TVIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  418  LARKVSLVRAVMYMVAQCLGAICGCG  495
            + RKVSL+RA+MYMVAQCLGAICGCG
Sbjct  120  VGRKVSLIRALMYMVAQCLGAICGCG  145



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 124/142 (87%), Gaps = 5/142 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDVE+    AA +DY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MVKDVEM----AAGRDYHDPPPAPLIDSEELTQWSFYRALIAEFIATLLFLYVTVLTVIG  56

Query  253  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            Y+ QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL RK
Sbjct  57   YRVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  116

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRAVMYMVAQCLGAICGCG
Sbjct  117  VSLVRAVMYMVAQCLGAICGCG  138



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVEV    + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK Q+D    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKVQSDVK-NGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA++YMVAQCLGAICG G
Sbjct  120  VSLIRAILYMVAQCLGAICGVG  141



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   207 bits (526),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    A A +DYQDPPPAPL D EELGKWS YRA+IAEF+ATLLFLYV++LTVI
Sbjct  1    MAKDLEVQEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT  LFLARK
Sbjct  61   GYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVR V+Y+VAQCLGAICGCG
Sbjct  120  VSLVRTVLYIVAQCLGAICGCG  141



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   207 bits (526),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 121/144 (84%), Gaps = 3/144 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            M KDVE   E      KDY DPPPAPLID EEL  WS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVATV  60

Query  247  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            IGYK Q+DPNV GTD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLA
Sbjct  61   IGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++YM+AQCLGAICG G
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAG  144



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   207 bits (526),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVE---VGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAK+VE   V  +  + KDY DPPPAPL+D  EL KWSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MAKEVEETVVTEQEFSAKDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVLT  60

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYKSQTDP +K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLA
Sbjct  61   VIGYKSQTDP-IKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++YMVAQC GAICG G
Sbjct  120  RKVSLIRALLYMVAQCSGAICGVG  143



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   206 bits (525),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 5/142 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  117  VSLIRAIMYMVAQCLGAICGVG  138



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   206 bits (525),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVEV   G EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK QTD  + GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQTDATLGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++YMVAQC GAICG G
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTG  142



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   206 bits (525),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVEV   G EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK QTD  + GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQTDATLGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++YMVAQC GAICG G
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTG  142



>ref|XP_010325988.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=269

 Score =   206 bits (523),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 5/127 (4%)
 Frame = +1

Query  115  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  294
            K YQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ+      TD+
Sbjct  4    KTYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQSS-----TDQ  58

Query  295  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKVSLVRAVMYMVAQCL  474
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKVSLVRA+MY+VAQCL
Sbjct  59   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCL  118

Query  475  GAICGCG  495
            GAICGCG
Sbjct  119  GAICGCG  125



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDVE  TE++A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDVEAATEFSA-KDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK Q+D +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKHQSDVDANG-DVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RA++YMVAQCLGAICG G
Sbjct  119  SLIRALVYMVAQCLGAICGVG  139



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 123/144 (85%), Gaps = 3/144 (2%)
 Frame = +1

Query  73   MAKDVEVG--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD E G        KDYQDPPP+PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDFETGGGEVRDVAKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLTV  60

Query  247  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            IGYK Q+DP V G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLA
Sbjct  61   IGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RK+SL+RA+MYMVAQCLGAICG G
Sbjct  121  RKLSLIRAIMYMVAQCLGAICGVG  144



>ref|XP_008243934.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=284

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 126/143 (88%), Gaps = 7/143 (5%)
 Frame = +1

Query  73   MAKDVEVGTEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD EVG  +   + KDYQDPPPAPLID EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDSEVGGGHNRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  61   IGYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVRA++YMVAQ LGAICG G
Sbjct  116  KVSLVRAILYMVAQSLGAICGVG  138



>gb|AAL49752.1|AF452014_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK+V  G+E +   KDYQDPPPAPLIDP EL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKNV--GSEGSFTTKDYQDPPPAPLIDPAELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKS++DP  K  D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSESDP-AKNADPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAVMYMVAQCLGAICG G
Sbjct  118  VSLIRAVMYMVAQCLGAICGVG  139



>ref|XP_002311092.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK95655.1| unknown [Populus trichocarpa]
 gb|EEE88459.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=285

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD EV    + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKDTEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ D N    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQIDGN---ADPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAVMYMVAQC GAICG G
Sbjct  118  VSLIRAVMYMVAQCAGAICGVG  139



>gb|KJB26182.1| hypothetical protein B456_004G229000 [Gossypium raimondii]
Length=282

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 123/142 (87%), Gaps = 5/142 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDVE     AA +DY DPPPAPLI+ EEL +WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MVKDVET----AAGRDYHDPPPAPLINAEELTQWSFYRALIAEFIATLLFLYVTVLTVIG  56

Query  253  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL RK
Sbjct  57   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  116

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRAVMYMVAQCLGAICGCG
Sbjct  117  VSLVRAVMYMVAQCLGAICGCG  138



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 126/143 (88%), Gaps = 7/143 (5%)
 Frame = +1

Query  73   MAKDVEVG--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD+EVG      + KDYQDPPPAPLID EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGGQHRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  61   IGYKSQSE-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVRA++YMVAQ LGAICG G
Sbjct  116  KVSLVRAILYMVAQSLGAICGVG  138



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVEV    + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY  QTD    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYSIQTDVKAGG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAVMYMVAQ LGAICG G
Sbjct  120  VSLIRAVMYMVAQSLGAICGVG  141



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDVE   E+ A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MGKDVE--AEFTA-KDYTDPPPAPLIDAEELAKWSLYRAVIAEFIATLLFLYITVATVIG  57

Query  253  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            YK Q+DPNV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  58   YKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA++YM+AQCLGAICG G
Sbjct  118  VSLIRALLYMIAQCLGAICGVG  139



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDVE  TE++A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLYVTV TVIG
Sbjct  1    MGKDVEAATEFSA-KDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVFTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK Q+D +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKHQSDVDANG-DVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RA++YMVAQCLGAICG G
Sbjct  119  SLIRALVYMVAQCLGAICGVG  139



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVE-VGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVE V  E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK +TD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF L LARK
Sbjct  61   GYKIETDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA++YMVAQCLGAICG G
Sbjct  120  VSLVRAILYMVAQCLGAICGVG  141



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 125/143 (87%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV TE  +   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEV-TERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RA+MYMVAQCLGAICG G
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVG  141



>ref|XP_004487111.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=287

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KDVEV   G EY+A KDYQDPPPAPL DP EL KWS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEVQEQGGEYSA-KDYQDPPPAPLFDPAELTKWSLYRAVIAEFIATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGY  QTD  + G  EC GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYSRQTDTTITGNTECDGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RAV+Y++AQCLGAICG G
Sbjct  120  RKVSLIRAVLYIIAQCLGAICGAG  143



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EVG   + + KDYQDPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVGERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQTDP     D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQTDPATNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGC  492
            VSLVRAVMYMVAQ LGAI G 
Sbjct  120  VSLVRAVMYMVAQSLGAIAGV  140



>gb|EYU39575.1| hypothetical protein MIMGU_mgv1a011441mg [Erythranthe guttata]
Length=281

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 120/141 (85%), Gaps = 6/141 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDV     + A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MAKDVAEQGSFGA-KDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVATVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ        DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQA-----AVDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAVMYMVAQCLGAICG G
Sbjct  115  SLVRAVMYMVAQCLGAICGVG  135



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDV     + A KDY DPPPAPLID  EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MVKDVTEQGSFPA-KDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQTDP-AKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAVMYMVAQCLGAI G G
Sbjct  119  SLVRAVMYMVAQCLGAIAGVG  139



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVEV    + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY  QTD    G + CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYNHQTDLKENG-EICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  120  VSLIRAIMYMVAQCLGAICGVG  141



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 123/142 (87%), Gaps = 5/142 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVEV    + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCL AICG G
Sbjct  117  VSLIRAIMYMVAQCLSAICGVG  138



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 126/146 (86%), Gaps = 6/146 (4%)
 Frame = +1

Query  73   MAKDVEV----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            MAK+VE     G E++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYV+VL
Sbjct  1    MAKEVETAEQGGGEFSA-KDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVL  59

Query  241  tvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLF  417
            TVIGYK QTD      D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF
Sbjct  60   TVIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  418  LARKVSLVRAVMYMVAQCLGAICGCG  495
            L RKVSL+RA+MYMVAQCLGAICGCG
Sbjct  120  LGRKVSLIRAIMYMVAQCLGAICGCG  145



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 122/139 (88%), Gaps = 2/139 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDV     + A KDY DPPPAPL DP EL KWSFYRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MTKDVAEHGSFPA-KDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ DP +KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQIDPALKG-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICG  489
            SL+RAV+YMVAQCLGAICG
Sbjct  119  SLIRAVLYMVAQCLGAICG  137



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVE-VGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVE V  E    +DYQDPPPAPL DP EL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF L LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA++YMVAQCLGAICG G
Sbjct  120  VSLVRAILYMVAQCLGAICGVG  141



>ref|XP_010325989.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=259

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 5/127 (4%)
 Frame = +1

Query  115  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  294
            K YQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ+      TD+
Sbjct  4    KIYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQSS-----TDQ  58

Query  295  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKVSLVRAVMYMVAQCL  474
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKVSLVRA+MY+VAQCL
Sbjct  59   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCL  118

Query  475  GAICGCG  495
            GAICGCG
Sbjct  119  GAICGCG  125



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    + + KDY DPPPAPL D +EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ D N    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQIDGN---ADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAVMYMVAQCLGAICG G
Sbjct  118  VSLIRAVMYMVAQCLGAICGVG  139



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 124/144 (86%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD+EV    EY A KDY DPPPAPL+D EEL KWS YRA IAEFIAT+LFLYVTVLTV
Sbjct  1    MAKDIEVAEQGEYTA-KDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLTV  59

Query  247  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            IGYK Q+DPNV  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLA
Sbjct  60   IGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA +Y+VAQCLGAICG G
Sbjct  120  RKVSLVRAFLYIVAQCLGAICGVG  143



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score =   204 bits (520),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVE-VGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVE V  E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVPGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF L LARK
Sbjct  61   GYKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA++YMVAQCLGAICG G
Sbjct  120  VSLVRAILYMVAQCLGAICGVG  141



>ref|XP_008446888.1| PREDICTED: aquaporin PIP2-1-like [Cucumis melo]
Length=287

 Score =   204 bits (520),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD        + KDY DPPPAPL D  ELGKWSFYRAIIAEFIATLLFLYVT+LT+IG
Sbjct  1    MAKDDVTAARGFSGKDYHDPPPAPLFDAAELGKWSFYRAIIAEFIATLLFLYVTILTIIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQTD N  GT+ C GVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YNSQTDTNKPGTNACDGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  120

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAV YM+AQCLGA+CG G
Sbjct  121  SLVRAVAYMIAQCLGAVCGAG  141



>emb|CDX74983.1| BnaA05g07290D [Brassica napus]
Length=197

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVE G E  A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVE-GAEGFAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RAV+YMVAQCLGAICG G
Sbjct  119  SLIRAVLYMVAQCLGAICGVG  139



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 125/148 (84%), Gaps = 8/148 (5%)
 Frame = +1

Query  73   MAKDVEV------GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  234
            M KD+E       G E++A KDYQDPPPAPLID EEL KWS YRA IAEFIATLLFLYVT
Sbjct  1    MTKDIETTAEQGGGAEFSA-KDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVT  59

Query  235  vltvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFR  411
            VLTVIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF 
Sbjct  60   VLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  119

Query  412  LFLARKVSLVRAVMYMVAQCLGAICGCG  495
            LF+ RKVSL+RA++YMVAQCLGAICGCG
Sbjct  120  LFVGRKVSLIRALLYMVAQCLGAICGCG  147



>gb|AFQ23567.1| aquaporin PIP2;2 [Eustoma exaltatum subsp. russellianum]
Length=287

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAK V     + A KDY +PPP PL D EELGKWSFYRA+IAEFIA+LLFLY+ V TVIG
Sbjct  1    MAKQVSENGSFEA-KDYHEPPPTPLFDREELGKWSFYRALIAEFIASLLFLYIGVTTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            + +Q+DP +   D+CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   HSNQSDPTLHPGDQCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RAVMYM+AQCLGAICG G
Sbjct  120  SLIRAVMYMMAQCLGAICGAG  140



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 130/171 (76%), Gaps = 8/171 (5%)
 Frame = +1

Query  4    HNSLHLLRLVLFFNHILSC*ELKMAKDVEV------GTEYAAPKDYQDPPPAPLIDPEEL  165
            H+  H        N      +  M KD+E       G E++A KDYQDPPPAPLID EEL
Sbjct  7    HSLAHSPLFTHSLNEHFHSLKHNMTKDIETTAEQGGGAEFSA-KDYQDPPPAPLIDLEEL  65

Query  166  GKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGM  342
             KWS YRA IAEFIATLLFLYVTVLTVIGYK QTDP     D +CGGVGILGIAWAFGGM
Sbjct  66   TKWSLYRAAIAEFIATLLFLYVTVLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGM  125

Query  343  IFILVYCTAGISGGHINPAVTFRLFLARKVSLVRAVMYMVAQCLGAICGCG  495
            IFILVYCTAGISGGHINPAVTF LF+ RKVSL+RA++YMVAQCLGAICGCG
Sbjct  126  IFILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALLYMVAQCLGAICGCG  176



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    A A +DY DPPPAPL+D EE GKWS YRA+IAEF+ TLLFLYV+VLTVI
Sbjct  1    MAKDLEVQEGGATAARDYVDPPPAPLLDMEEFGKWSLYRAVIAEFVXTLLFLYVSVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTF LFLARK
Sbjct  61   GYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVR V+Y+VAQCLGAICGCG
Sbjct  120  VSLVRTVLYIVAQCLGAICGCG  141



>gb|AFK35635.1| unknown [Medicago truncatula]
Length=162

 Score =   199 bits (507),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVEV    + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY  QTD    G D CGGVGILGIAWAFGGMIF+LVYC AGISGGHINPAVTF LFLARK
Sbjct  61   GYSIQTDVKAGG-DACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAI G G
Sbjct  120  VSLIRAIMYMVAQCLGAIAGVG  141



>ref|XP_010555818.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   204 bits (518),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDV     ++  KDY DPPPAP+ D  ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVAEQGSFSG-KDYHDPPPAPVFDTAELGKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVK-GTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            YKSQTD  +  G D+CGGVGILGIAWAFGGMIFILVYCT GISGGHINPAVTF L LARK
Sbjct  60   YKSQTDATLNAGADQCGGVGILGIAWAFGGMIFILVYCTGGISGGHINPAVTFGLLLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRAVMY+VAQCLGAICG G
Sbjct  120  VSLVRAVMYIVAQCLGAICGVG  141



>emb|CDY13298.1| BnaC06g14590D [Brassica napus]
Length=287

 Score =   204 bits (518),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVE-VGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVE V  E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVAGEGFQSRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
             YK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF L LARK
Sbjct  61   CYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA++YMVAQCLGAICG G
Sbjct  120  VSLVRAILYMVAQCLGAICGVG  141



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA++YM+AQC GAICG G
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAG  143



>ref|XP_006291621.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
 gb|EOA24519.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
Length=271

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDV       + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MMKDVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP++   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTF L LARKV
Sbjct  61   YKSQTDPHLH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  433  SLVRAVMYMVAQCLGAICG  489
            SLVRAVMYMVAQCLGAICG
Sbjct  120  SLVRAVMYMVAQCLGAICG  138



>ref|XP_004493972.1| PREDICTED: probable aquaporin PIP2-5-like [Cicer arietinum]
Length=287

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD++   + A P KDYQDPPPAPL D  EL +WSFYRA+IAEF+ATLLFLYVTV TVI
Sbjct  1    MAKDIQTEPQTALPNKDYQDPPPAPLFDTSELSQWSFYRALIAEFVATLLFLYVTVATVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY SQTDP   GT  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYNSQTDPAHNGT-ACDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA++YMV QCLGAICG G
Sbjct  120  VSLIRAILYMVVQCLGAICGVG  141



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAK-DVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK DVE G+   A KDY DPPPAPLID EEL +WSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKHDVEGGSF--AAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  118  VSLIRAIMYMVAQCLGAICGVG  139



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 124/143 (87%), Gaps = 8/143 (6%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            M KDVEV    E++A KDY DPPPAPLID  EL  WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MGKDVEVAEHGEFSA-KDYTDPPPAPLIDMAELASWSFYRAIIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQS-----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAVMYMVAQCLGAICG G
Sbjct  115  KVSLIRAVMYMVAQCLGAICGVG  137



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  73   MAKDVEV--GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD++V  G   AA +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  1    MAKDLDVQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  60

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT  LFLAR
Sbjct  61   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVR V+Y+VAQCLGAICGCG
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCG  142



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 120/144 (83%), Gaps = 3/144 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            M KDVE   E      KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVATV  60

Query  247  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            IGYK Q+D NV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLA
Sbjct  61   IGYKHQSDANVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++YM+AQCLGAICG G
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAG  144



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA++YM+AQC GAICG G
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAG  143



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA++YM+AQC GAICG G
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAG  143



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 123/140 (88%), Gaps = 3/140 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M+KD+E G    A KDYQDPPPAPLID EEL +WSFYRAIIAEF+ATLLFLYVTVLTVIG
Sbjct  1    MSKDLEAGGF--AVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIG  58

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  59   YSSQSDTK-NGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  433  SLVRAVMYMVAQCLGAICGC  492
            SL+RA++YMVAQCLGAICGC
Sbjct  118  SLIRAILYMVAQCLGAICGC  137



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA++YM+AQC GAICG G
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAG  143



>gb|ABH09328.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEV-GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV G      KDY D PPAPL+ PEELG WSFYRAII+EF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEVAGHGDLTLKDYHDSPPAPLVYPEELGSWSFYRAIISEFVATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK+QTDP   G +EC GVGILGIAWAFGG+IFILVYCTAGISGGHINPAVTF +FLARK
Sbjct  61   GYKNQTDPYHHG-NECNGVGILGIAWAFGGVIFILVYCTAGISGGHINPAVTFGVFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRAVMYMVAQC GAICGCG
Sbjct  120  VSLVRAVMYMVAQCGGAICGCG  141



>gb|AGD98705.1| aquaporin [Camellia sinensis]
Length=283

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 6/142 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK VEV  E   + KDY+DPPPAPL+DP+ELGKWSFYRA+IAEFIATLLFLY+T+LTVI
Sbjct  1    MAKGVEVVEEGTFSAKDYEDPPPAPLMDPKELGKWSFYRALIAEFIATLLFLYITILTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+      TD+CGGVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQS-----ATDDCGGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAV YM+AQCLGAICG G
Sbjct  116  VSLIRAVSYMIAQCLGAICGVG  137



>ref|XP_009772697.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana sylvestris]
Length=283

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 6/142 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK+V  G+E +   KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKNV--GSEGSFTTKDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+      TD C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSQS---ATATDPCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAVMYMVAQCLGAICG G
Sbjct  116  VSLIRAVMYMVAQCLGAICGVG  137



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAV+YMVAQCLGAICG G
Sbjct  120  VSLIRAVLYMVAQCLGAICGVG  141



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAV+YMVAQCLGAICG G
Sbjct  120  VSLIRAVLYMVAQCLGAICGVG  141



>ref|XP_006403531.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
 gb|ESQ44984.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
Length=286

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M K+V       + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGEKRSFSGKDYQDPPPEPLFDAAELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP +   D+C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  433  SLVRAVMYMVAQCLGAICG  489
            +LVRAVMYMVAQCLGAICG
Sbjct  120  TLVRAVMYMVAQCLGAICG  138



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAK-DVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK DVE G+  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  118  VSLIRAIMYMVAQCLGAICGVG  139



>emb|CDX67611.1| BnaA07g16510D [Brassica napus]
Length=286

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDV       + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  433  SLVRAVMYMVAQCLGAICG  489
            +LVRAVMYMVAQCLGAICG
Sbjct  120  TLVRAVMYMVAQCLGAICG  138



>gb|ACJ85211.1| unknown [Medicago truncatula]
Length=259

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAV+YMVAQCLGAICG G
Sbjct  120  VSLIRAVLYMVAQCLGAICGVG  141



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAK-DVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK DVE G+  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  118  VSLIRAIMYMVAQCLGAICGVG  139



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 122/140 (87%), Gaps = 3/140 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M+KD+E G    A KDYQDPPPAPLID EEL +WSFYRAIIAEF+ATLLFLYVTVLTVIG
Sbjct  1    MSKDLEAGGF--AVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIG  58

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  59   YSSQSDTK-NGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  433  SLVRAVMYMVAQCLGAICGC  492
            SL RA++YMVAQCLGAICGC
Sbjct  118  SLTRAILYMVAQCLGAICGC  137



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    + + KDY DPPPAPL D +EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ D +    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQIDGS---ADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAVMYMVAQCLGAICG G
Sbjct  118  VSLIRAVMYMVAQCLGAICGVG  139



>ref|XP_002532756.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF29633.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=283

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 125/143 (87%), Gaps = 8/143 (6%)
 Frame = +1

Query  73   MAKDVEVGTE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            M KD+EVG    ++A KDY DPPPAPLID  EL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MVKDMEVGERGPFSA-KDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ++     +D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQSE-----SDSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVRA+MYMVAQCLGAICG G
Sbjct  115  KVSLVRAIMYMVAQCLGAICGVG  137



>gb|ACV70050.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=224

 Score =   200 bits (509),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 118/128 (92%), Gaps = 4/128 (3%)
 Frame = +1

Query  115  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQT-DPNVKGTD  291
            KDY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+TVLTVIGYKSQT DP     D
Sbjct  1    KDYDDPPPAPLVDAEELTQWSFYRAIIAEFIATLLFLYITVLTVIGYKSQTADPT---AD  57

Query  292  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKVSLVRAVMYMVAQC  471
            +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKVSLVRA++YM+AQC
Sbjct  58   QCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMIAQC  117

Query  472  LGAICGCG  495
            LGAICGCG
Sbjct  118  LGAICGCG  125



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 125/143 (87%), Gaps = 5/143 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            M KDVE     EY+A KDYQDPPPAPLIDPEEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MGKDVEGAEQGEYSA-KDYQDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK Q+  +    D+C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKVQS--SAPDADDCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  117

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV+YMVAQCLGAICG G
Sbjct  118  KVSLIRAVLYMVAQCLGAICGVG  140



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    A A +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV++LTVI
Sbjct  1    MAKDLEVQEGGATAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSILTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTF LFLARK
Sbjct  61   GYKAQTDASAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVR V+Y+VAQCLGAICGCG
Sbjct  120  VSLVRTVLYIVAQCLGAICGCG  141



>ref|XP_006436426.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 gb|ESR49666.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=206

 Score =   199 bits (507),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 120/143 (84%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGTE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD  V     Y+A KDY DPPP PL D  EL KWSFYRA+IAEFIATLLFLYVTVLTV
Sbjct  1    MAKDTGVAEHGSYSA-KDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQTDP  K  D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVRAVMYMVAQCLGAI G G
Sbjct  119  KVSLVRAVMYMVAQCLGAISGVG  141



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAK-DVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK DVE G+  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  118  VSLIRAIMYMVAQCLGAICGVG  139



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAAP--KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD++V  E  AP  +DY+DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  1    MAKDLDV-QEGGAPAARDYKDPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT  LFLAR
Sbjct  60   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVR V+Y+VAQCLGAICGCG
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCG  141



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAAP--KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD++V  E  AP  +DY+DPPPAPL+D EELGKWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  13   MAKDLDV-QEGGAPAARDYKDPPPAPLLDMEELGKWSLYRAVIAEFVATLLFLYVSVLTV  71

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK+QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT  LFLAR
Sbjct  72   IGYKAQTDATAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLAR  130

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVR V+Y+VAQCLGAICGCG
Sbjct  131  KVSLVRTVLYIVAQCLGAICGCG  153



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 3/140 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M+KD+E G    A KDYQDPPPAPLID EEL +WSFYRAIIAEF+ATLLFLYVTVLTVIG
Sbjct  1    MSKDLEAGGF--AVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIG  58

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  59   YSSQSDTK-SGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  433  SLVRAVMYMVAQCLGAICGC  492
            SL+RA++YM AQCLGAICGC
Sbjct  118  SLIRAILYMAAQCLGAICGC  137



>ref|XP_003606384.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88581.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=204

 Score =   199 bits (507),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 122/143 (85%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV    EY+A KDYQDPPPAPLID EEL KWSFYRA+IAEF+ATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYSA-KDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLTI  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGY  Q+DP   GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF+ R
Sbjct  60   IGYSHQSDPKAGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV YM AQ  GAICG G
Sbjct  119  KVSLIRAVFYMAAQSAGAICGTG  141



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAK-DVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK DVE G+  A  KDY DPPPAPLID +EL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSQSDAKAGG-DLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  118  VSLIRAIMYMVAQCLGAICGVG  139



>emb|CDY07519.1| BnaC06g15450D [Brassica napus]
Length=286

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDV       + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YKSQTDPTLY-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  433  SLVRAVMYMVAQCLGAICG  489
            +LVRAVMYMVAQCLGAICG
Sbjct  120  TLVRAVMYMVAQCLGAICG  138



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 8/143 (6%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV    E+AA KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEHGEFAA-KDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV+Y++AQCLGAICG G
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVG  137



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 123/145 (85%), Gaps = 5/145 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KDVE    G E+ A KDY DPPPA LID EE+ KWS YRA+IAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEGGEFTA-KDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVAT  59

Query  244  vIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFL  420
            VIGYK Q+DPNV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL
Sbjct  60   VIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  421  ARKVSLVRAVMYMVAQCLGAICGCG  495
            ARKVSLVRA++YM+AQCLGAICG G
Sbjct  120  ARKVSLVRALLYMIAQCLGAICGVG  144



>ref|XP_006291622.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
 gb|EOA24520.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
Length=286

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KDV       + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MMKDVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQTDP++   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTF L LARKV
Sbjct  61   YKSQTDPHLH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  433  SLVRAVMYMVAQCLGAICG  489
            SLVRAVMYMVAQCLGAICG
Sbjct  120  SLVRAVMYMVAQCLGAICG  138



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 122/141 (87%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQTDP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGC  492
            VSLVRAV+YMVAQ LGAI G 
Sbjct  120  VSLVRAVLYMVAQSLGAIAGV  140



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 124/143 (87%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV TE  +   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEV-TERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK Q+D    G D CGGVGILGIAWAFGGMIFILVY TAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYWTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RA+MYMVAQCLGAICG G
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVG  141



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKDVEV    + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY  QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYSIQTDVKAGG-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAI G G
Sbjct  120  VSLIRAIMYMVAQCLGAIAGVG  141



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   202 bits (514),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 127/149 (85%), Gaps = 10/149 (7%)
 Frame = +1

Query  73   MAKDVEV------GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  234
            M KD+E       G E++A KDY DPPPAPLID EEL KWS YRA IAEFIATLLFLYVT
Sbjct  1    MTKDIETTAEQGGGAEFSA-KDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVT  59

Query  235  vltvIGYKSQTDPNVKGTDE--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  408
            VLTVIGYK QTDP VK T++  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  60   VLTVIGYKVQTDP-VKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  118

Query  409  RLFLARKVSLVRAVMYMVAQCLGAICGCG  495
             LF+ RKVSL+RA++YMVAQCLGAICGCG
Sbjct  119  GLFVGRKVSLIRALLYMVAQCLGAICGCG  147



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 6/146 (4%)
 Frame = +1

Query  73   MAKDVEV----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            MAKD+E     G E++A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASAPEGGEFSA-KDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVA  59

Query  241  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLF  417
            TVIGYK Q+D  V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF
Sbjct  60   TVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  418  LARKVSLVRAVMYMVAQCLGAICGCG  495
            LARKVSL+RAV+Y++AQCLGAICG G
Sbjct  120  LARKVSLIRAVLYIIAQCLGAICGVG  145



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 6/146 (4%)
 Frame = +1

Query  73   MAKDVEV----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            MAKD+E     G E++A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASAPEGGEFSA-KDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVA  59

Query  241  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLF  417
            TVIGYK Q+D  V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF
Sbjct  60   TVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  418  LARKVSLVRAVMYMVAQCLGAICGCG  495
            LARKVSL+RAV+Y++AQCLGAICG G
Sbjct  120  LARKVSLIRAVLYIIAQCLGAICGVG  145



>gb|ACV70048.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=224

 Score =   200 bits (508),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 118/128 (92%), Gaps = 4/128 (3%)
 Frame = +1

Query  115  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQT-DPNVKGTD  291
            KDY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+TVLTVIGYKSQT DP     D
Sbjct  1    KDYVDPPPAPLVDAEELTQWSFYRAIIAEFIATLLFLYITVLTVIGYKSQTADPT---AD  57

Query  292  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKVSLVRAVMYMVAQC  471
            +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKVSLVRA++YM+AQC
Sbjct  58   QCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMIAQC  117

Query  472  LGAICGCG  495
            LGAICGCG
Sbjct  118  LGAICGCG  125



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 125/143 (87%), Gaps = 8/143 (6%)
 Frame = +1

Query  73   MAKDVEVGTEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD+E G E+   A KDYQDPPP PL D EEL KWSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDIE-GAEHGEFASKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV+Y+VAQCLGAICG G
Sbjct  115  KVSLIRAVLYIVAQCLGAICGVG  137



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 121/145 (83%), Gaps = 5/145 (3%)
 Frame = +1

Query  73   MAKDVEVGT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVE      EYA  KDY DPPPAPL D EEL KWS YRA IAEFIAT+LFLYVTV T
Sbjct  1    MAKDVEAAAGHGEYAV-KDYTDPPPAPLFDWEELTKWSLYRAAIAEFIATMLFLYVTVAT  59

Query  244  vIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFL  420
            VIGYK Q+DPNV  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL
Sbjct  60   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  421  ARKVSLVRAVMYMVAQCLGAICGCG  495
            ARKVSL+RA++YM+ QCLGAICG G
Sbjct  120  ARKVSLIRALLYMIGQCLGAICGVG  144



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            M KDVEV    + + KDY DPPP PLID  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MGKDVEVAEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GY+SQTD    G D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYRSQTDQAHNGGD-CEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAVMYMVAQCLGAICG G
Sbjct  120  VSLIRAVMYMVAQCLGAICGVG  141



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 125/143 (87%), Gaps = 8/143 (6%)
 Frame = +1

Query  73   MAKDVEVGTEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD+E G E+   A KDYQDPPP PL D EEL KWSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDIE-GAEHGEFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV+Y+VAQCLGAICG G
Sbjct  115  KVSLIRAVLYIVAQCLGAICGVG  137



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 122/141 (87%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQTDP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGC  492
            VSLVRAV+YMVAQ LGAI G 
Sbjct  120  VSLVRAVLYMVAQSLGAIAGV  140



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAK-DVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK DVE G+  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGA+CG G
Sbjct  118  VSLIRAIMYMVAQCLGAMCGVG  139



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 129/143 (90%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD+EVG   E+ A KDY DPPPAPLID EEL KWSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGQGEFHA-KDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVRAVMYMVAQCLGAICGCG
Sbjct  119  KVSLVRAVMYMVAQCLGAICGCG  141



>ref|XP_011077012.1| PREDICTED: probable aquaporin PIP2-5 [Sesamum indicum]
Length=281

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 120/141 (85%), Gaps = 6/141 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M K+V     Y A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKEVAEHGSYGA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ+       D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQS-----AADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  114

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAVMYMVAQCLGAICG G
Sbjct  115  SLVRAVMYMVAQCLGAICGVG  135



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 123/142 (87%), Gaps = 6/142 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            M+KDVEV  + A + KDY DPPPA LID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MSKDVEVAEQPAYSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQT      TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQTT-----TDPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL RAV+YMVAQCLGAICG G
Sbjct  116  VSLFRAVLYMVAQCLGAICGVG  137



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVE G E  A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVE-GAEGFAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAV+YMVAQCLGAICG G
Sbjct  119  SLVRAVLYMVAQCLGAICGVG  139



>ref|XP_009593453.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana tomentosiformis]
Length=283

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAK+V     +   KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNVNSEGSFTT-KDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ+      +D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQSATT---SDPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RA+MYMVAQCLGAICG G
Sbjct  117  SLIRALMYMVAQCLGAICGVG  137



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAAP---KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M K+VEV  E AA    KDY DPPPAPL+D EEL +WS YRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVAREQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLA
Sbjct  61   VIGYKVQSDVKADG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RAV+YMVAQCLGAICG G
Sbjct  120  RKVSLIRAVLYMVAQCLGAICGVG  143



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAK    G  ++A KDY DPPPAPLID +EL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKHDAEGGSFSA-KDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKSQSDVKAGG-DLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RA+MYMVAQCLGAICG G
Sbjct  119  SLIRAIMYMVAQCLGAICGVG  139



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   201 bits (511),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVE G E    +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLY+TVLTVIG
Sbjct  1    MAKDVE-GAEGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK  +D    G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAV+YMVAQCLGAICG G
Sbjct  119  SLVRAVLYMVAQCLGAICGVG  139



>gb|KEH39328.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=268

 Score =   201 bits (510),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KDVEV   G E++A KDYQDPPPAPL D +EL KWS YRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVEVQEQGGEFSA-KDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGY  Q+D  +KG  EC GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF+ 
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA +Y+VAQCLGAICG G
Sbjct  120  RKVSLIRAFLYIVAQCLGAICGAG  143



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 122/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKDVE  TE   Y+A KDY DPPPAPLI P+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIHPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA++YM+AQC GAICG G
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAG  143



>gb|AHG32323.1| PIP2-2 [Pisum sativum]
Length=287

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 124/144 (86%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KDVEV   G E++A KDYQDPPPAPL D  E  KWS YRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVEVQEQGAEFSA-KDYQDPPPAPLFDSAEFKKWSLYRAVIAEFVATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGYK Q+D ++KG  EC GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF+ 
Sbjct  60   IIGYKRQSDTDIKGNTECDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA++Y++AQCLGAICG G
Sbjct  120  RKVSLIRALLYIIAQCLGAICGAG  143



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   201 bits (512),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 122/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KDVE   E A   + KDY DPPPAPLID +EL  WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVESHVEPAEEYSAKDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVLT  60

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYKSQ DP   G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  LFL 
Sbjct  61   VIGYKSQIDP-AHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RAV+YMVAQCLGAICG G
Sbjct  120  RKVSLIRAVLYMVAQCLGAICGVG  143



>gb|KDO44717.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=256

 Score =   200 bits (509),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 120/143 (84%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGTE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD  V     Y+A KDY DPPP PL D  EL KWSFYRA+IAEFIATLLFLYVTVLTV
Sbjct  51   MAKDTGVAEHGSYSA-KDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTV  109

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQTDP  K  D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  110  IGYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  168

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVRAVMYMVAQCLGAI G G
Sbjct  169  KVSLVRAVMYMVAQCLGAISGVG  191



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  73   MAKDVEV--GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD++V  G   A  +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  1    MAKDLDVQEGGAPAPSRDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  60

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT  LFLAR
Sbjct  61   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSLVR V+Y+VAQCLGAICGCG
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCG  142



>ref|XP_009413716.1| PREDICTED: probable aquaporin PIP2-3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 120/144 (83%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD EV    EY   KDY DPPPAPLID EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDTEVAGRGEYGG-KDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  247  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            IGYK Q+DPNV   D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  LFLA
Sbjct  60   IGYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA++YMVAQCLGAICG G
Sbjct  120  RKVSLVRALLYMVAQCLGAICGVG  143



>ref|NP_001274397.1| aquaporin PIP2-1-like [Cucumis sativus]
 gb|AHB33478.1| plasma intrinsic protein 2-2 [Cucumis sativus]
 gb|KGN48147.1| Aquaporin [Cucumis sativus]
Length=284

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD + G    A KDY DPPPAP IDP E  +WSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDSDAGAF--AAKDYHDPPPAPFIDPHEFTQWSFYRAIIAEFIATLLFLYVTVLTVIG  58

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  59   YSSQSDIKHNG-QICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  433  SLVRAVMYMVAQCLGAICGC  492
            SLVRAV+YMVAQCLGAICGC
Sbjct  118  SLVRAVLYMVAQCLGAICGC  137



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVE G E  A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVE-GAEGFAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RAV+YMVAQCLGAICG G
Sbjct  119  SLIRAVLYMVAQCLGAICGVG  139



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD+E    +   KDY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLY+TV TVIG
Sbjct  1    MAKDIEAAAAHEG-KDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVATVIG  59

Query  253  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            YK QTD    G D  CGGVG+LGIAWAFGGMIFILVYCTAG+SGGHINPAVTF LFLARK
Sbjct  60   YKHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSLVRA++Y+VAQCLGAICG G
Sbjct  120  VSLVRALLYIVAQCLGAICGVG  141



>gb|KCW49751.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=258

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 6/145 (4%)
 Frame = +1

Query  73   MAKDVEV----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            MAKD EV    G E+   KDY+DPPPAPL+D EEL KWSFYRA+IAEF+ATLLFLY+TVL
Sbjct  1    MAKDDEVVEQQGGEFHG-KDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVL  59

Query  241  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFL  420
            TVIGY  Q+D    G D+C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFL
Sbjct  60   TVIGYSRQSD-TTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  118

Query  421  ARKVSLVRAVMYMVAQCLGAICGCG  495
            AR+VSLVRA++YMVAQCLGA+CGCG
Sbjct  119  ARRVSLVRAILYMVAQCLGAVCGCG  143



>ref|XP_008449255.1| PREDICTED: aquaporin PIP2-2-like [Cucumis melo]
Length=284

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD + G    A KDY DPPPAP IDP E  +WSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDSDAGAF--AAKDYHDPPPAPFIDPHEFTQWSFYRAIIAEFIATLLFLYVTVLTVIG  58

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  59   YSSQSDIKHNG-QICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  433  SLVRAVMYMVAQCLGAICGC  492
            SLVRAV+YMVAQCLGAICGC
Sbjct  118  SLVRAVLYMVAQCLGAICGC  137



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 120/144 (83%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKD EV    EY   KDY DPPPAPLID EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDTEVAGRGEYGG-KDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  247  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            IGYK Q+DPNV   D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  LFLA
Sbjct  60   IGYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRA++YMVAQCLGAICG G
Sbjct  120  RKVSLVRALLYMVAQCLGAICGVG  143



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAKD+EV    + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQTDP     D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  61   GYKSQTDPATNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  430  VSLVRAVMYMVAQCLGAICGC  492
            VSLVRAV+YMVAQ LGAI G 
Sbjct  120  VSLVRAVLYMVAQSLGAIAGV  140



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 8/143 (6%)
 Frame = +1

Query  73   MAKDVEVGTEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVE G E+   A KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVE-GAEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV+Y++AQCLGAICG G
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVG  137



>ref|XP_004956116.1| PREDICTED: aquaporin PIP2-6-like [Setaria italica]
Length=286

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            M K+V+V T E    +DY DPPPAPL+D +ELGKWS YRA+IAEF+ATLLFLY+TV TVI
Sbjct  1    MGKEVDVSTLEAGGARDYADPPPAPLVDIDELGKWSLYRAVIAEFVATLLFLYITVATVI  60

Query  250  GYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            GYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLAR
Sbjct  61   GYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  427  KVSLVRAVMYMVAQCLGAICG  489
            KVSLVRA++YM AQCLGAICG
Sbjct  121  KVSLVRAILYMAAQCLGAICG  141



>emb|CAC82712.1| major intrinsic protein 1 [Populus tremula x Populus tremuloides]
 emb|CAH60722.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M KD E G E +A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDFEGGGELSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK+QTD +  G  ECGGVGILGIAWAFGGM FILVYCTAGISG HINPAVTF LFLARKV
Sbjct  60   YKNQTDVHKNG-HECGGVGILGIAWAFGGMNFILVYCTAGISGRHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRA++YMVAQCL AICGCG
Sbjct  119  SLVRAILYMVAQCLWAICGCG  139



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 123/144 (85%), Gaps = 9/144 (6%)
 Frame = +1

Query  73   MAKDVEVGT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKD+E G    EY A KDY DPPPAPLID EEL KWS YRA+IAEF ATLLFLY+TVLT
Sbjct  1    MAKDIEGGAAAHEYGA-KDYHDPPPAPLIDSEELTKWSLYRAVIAEFTATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYKSQ+       D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLA
Sbjct  60   VIGYKSQS-----AADGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  114

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSLVRAV+Y++AQCLGAICGCG
Sbjct  115  RKVSLVRAVLYIIAQCLGAICGCG  138



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M K+VEV TE     + KDY DPPPAPL+D EEL +WS YRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVATEQPTEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLA
Sbjct  61   VIGYKVQSDVKADG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RAV+YMVAQCLGAICG G
Sbjct  120  RKVSLIRAVLYMVAQCLGAICGVG  143



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 122/147 (83%), Gaps = 7/147 (5%)
 Frame = +1

Query  73   MAKDVEV-----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  237
            MAKD+E      G EY A KDY DPPPAPLID EEL KWS YRA+IAEF+ATLLFLY+TV
Sbjct  1    MAKDIEAAAAPEGGEYTA-KDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITV  59

Query  238  ltvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRL  414
             TVIGYK QTD    G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVT  L
Sbjct  60   ATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTLGL  119

Query  415  FLARKVSLVRAVMYMVAQCLGAICGCG  495
            FLARKVSLVRA++Y+VAQCLGAICG G
Sbjct  120  FLARKVSLVRALLYIVAQCLGAICGVG  146



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 4/142 (3%)
 Frame = +1

Query  73   MAK-DVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK DVE G+  A  KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RA+MYMVAQCLGAICG G
Sbjct  118  VSLIRAIMYMVAQCLGAICGVG  139



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 121/144 (84%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVE G   EY   KDY DPPP PL+D EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDVEAGGRGEYGG-KDYSDPPPEPLVDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  247  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            IGYK Q+DP V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLA
Sbjct  60   IGYKHQSDPAVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RK+SLVRA++YM+AQCLGAICG G
Sbjct  120  RKISLVRALLYMIAQCLGAICGVG  143



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 126/144 (88%), Gaps = 9/144 (6%)
 Frame = +1

Query  73   MAKDVEVG---TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAK+VE      E+AA KDY DPPPAPLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVECAEPAAEFAA-KDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            VIGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLA
Sbjct  60   VIGYKSQSE-----YDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  114

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RAV+YMVAQCLGAICG G
Sbjct  115  RKVSLIRAVLYMVAQCLGAICGVG  138



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 8/143 (6%)
 Frame = +1

Query  73   MAKDVEVGTEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVE G E+   A KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVE-GAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLAR
Sbjct  60   IGYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV+Y++AQCLGAICG G
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVG  137



>gb|AAG44947.1|AF290620_1 putative PIP2 [Nicotiana glauca]
Length=284

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 6/142 (4%)
 Frame = +1

Query  73   MAKDVEVGTEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  249
            MAK+V  G+E +   KDYQDPPPAPLIDP EL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKNV--GSEGSFTTKDYQDPPPAPLIDPVELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  250  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARK  429
            GYKSQ+      TD C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARK
Sbjct  59   GYKSQSATT---TDPCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  430  VSLVRAVMYMVAQCLGAICGCG  495
            VSL+RAVMYMVAQCLGAICG G
Sbjct  116  VSLIRAVMYMVAQCLGAICGVG  137



>emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum]
Length=285

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 123/143 (86%), Gaps = 4/143 (3%)
 Frame = +1

Query  73   MAKDVEVGT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  246
            MAKDVEV    EY+A KDYQDPPPAPLID +EL KWSFYRA+IAEF+ATLLFLYVT+LT+
Sbjct  1    MAKDVEVQEQGEYSA-KDYQDPPPAPLIDLDELTKWSFYRALIAEFVATLLFLYVTILTI  59

Query  247  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLAR  426
            IGY  QTD N  GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF+ R
Sbjct  60   IGYSHQTDANAGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  427  KVSLVRAVMYMVAQCLGAICGCG  495
            KVSL+RAV YM AQC GA+CG G
Sbjct  119  KVSLLRAVFYMAAQCAGAVCGTG  141



>tpg|DAA64687.1| TPA_exp: aquaporin PIP2 10 [Nicotiana tabacum]
Length=283

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAK+V     +   KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNVNSEGSFTT-KDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK+Q+      +D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKNQSATT---SDPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RA+MYMVAQCLGAICG G
Sbjct  117  SLIRALMYMVAQCLGAICGVG  137



>ref|XP_004157526.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33483.1| plasma intrinsic protein 2-7 [Cucumis sativus]
 gb|KGN52272.1| hypothetical protein Csa_5G623360 [Cucumis sativus]
Length=287

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKD        + KDY DPPPAPL D  ELGKWSFYRAIIAEFIATLLFLYVT+LT+IG
Sbjct  1    MAKDDVTTARGFSGKDYHDPPPAPLFDAAELGKWSFYRAIIAEFIATLLFLYVTILTIIG  60

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQTD +  G + C GVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTF LFLARKV
Sbjct  61   YNSQTDTDKPGANACDGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  120

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAV YMVAQCLGA+CG G
Sbjct  121  SLVRAVAYMVAQCLGAVCGAG  141



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 6/146 (4%)
 Frame = +1

Query  73   MAKDVEV----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            MAKD+E       E++A KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  241  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLF  417
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF
Sbjct  60   TVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  418  LARKVSLVRAVMYMVAQCLGAICGCG  495
            LARKVSLVRA++Y++AQCLGAICG G
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVG  145



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAKDVE G E    +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVE-GAEGYQARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SL+RAV+YMVAQCLGAICG G
Sbjct  119  SLIRAVLYMVAQCLGAICGVG  139



>ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES67486.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            M KDVEV   G E++A KDYQDPPPAPL D +EL KWS YRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVEVQEQGGEFSA-KDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  244  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLA  423
            +IGY  Q+D  +KG  EC GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF+ 
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVG  119

Query  424  RKVSLVRAVMYMVAQCLGAICGCG  495
            RKVSL+RA +Y+VAQCLGAICG G
Sbjct  120  RKVSLIRAFLYIVAQCLGAICGAG  143



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 6/146 (4%)
 Frame = +1

Query  73   MAKDVEV----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            MAKD+E       E++A KDY DPPPAPL+D EEL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  241  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLF  417
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF LF
Sbjct  60   TVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  418  LARKVSLVRAVMYMVAQCLGAICGCG  495
            LARKVSLVRA++Y+VAQCLGAICG G
Sbjct  120  LARKVSLVRALLYIVAQCLGAICGVG  145



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 121/140 (86%), Gaps = 3/140 (2%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            M+KD+E G    A KDYQDPPPAPLID EEL +WSFYRAIIAEF+ATLLFLYVTVLTVIG
Sbjct  1    MSKDLEAGGF--AVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIG  58

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISG HINPAVTF LFLARKV
Sbjct  59   YSSQSDTK-NGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGDHINPAVTFGLFLARKV  117

Query  433  SLVRAVMYMVAQCLGAICGC  492
            SL RA++YMVAQCLGAICGC
Sbjct  118  SLTRAILYMVAQCLGAICGC  137



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 5/145 (3%)
 Frame = +1

Query  73   MAKDVEV---GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  243
            MAKD+E    G E+++ KDY DPPPAP++D EEL KWS YRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPQGGEFSS-KDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFL  420
            VIGYK Q+DP V  TD  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTF LFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  421  ARKVSLVRAVMYMVAQCLGAICGCG  495
            ARKVSL+RA++Y++AQCLGAICG G
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVG  144



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +1

Query  73   MAKDVEVGTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  252
            MAK+VE G E  A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKEVE-GAEGFASRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  253  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKV  432
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTF LFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  433  SLVRAVMYMVAQCLGAICGCG  495
            SLVRAV+YMVAQCLGAICG G
Sbjct  119  SLVRAVLYMVAQCLGAICGVG  139



>gb|ACV70051.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=223

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 117/127 (92%), Gaps = 4/127 (3%)
 Frame = +1

Query  118  DYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQT-DPNVKGTDE  294
            DY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+TVLTVIGYKSQT DP     D+
Sbjct  1    DYDDPPPAPLVDAEELTQWSFYRAIIAEFIATLLFLYITVLTVIGYKSQTADPT---ADQ  57

Query  295  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFLARKVSLVRAVMYMVAQCL  474
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFLARKVSLVRA++YM+AQCL
Sbjct  58   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMIAQCL  117

Query  475  GAICGCG  495
            GAICGCG
Sbjct  118  GAICGCG  124



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 6/145 (4%)
 Frame = +1

Query  73   MAKDVEV----GTEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  240
            MAKD EV    G E+   KDY+DPPPAPL+D EEL KWSFYRA+IAEF+ATLLFLY+TVL
Sbjct  1    MAKDDEVVEQQGGEFHG-KDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVL  59

Query  241  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFRLFL  420
            TVIGY  Q+D    G D+C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTF LFL
Sbjct  60   TVIGYSRQSD-TTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  118

Query  421  ARKVSLVRAVMYMVAQCLGAICGCG  495
            AR+VSLVRA++YMVAQCLGA+CGCG
Sbjct  119  ARRVSLVRAILYMVAQCLGAVCGCG  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190