BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G22

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004250110.1|  PREDICTED: ras-related protein Rab11D              269   7e-88   
ref|XP_009798472.1|  PREDICTED: ras-related protein Rab11D-like         269   8e-88   Nicotiana sylvestris
ref|XP_009620681.1|  PREDICTED: ras-related protein Rab11D-like         268   4e-87   Nicotiana tomentosiformis
emb|CDP01498.1|  unnamed protein product                                267   4e-87   Coffea canephora [robusta coffee]
emb|CBI33135.3|  unnamed protein product                                265   1e-86   Vitis vinifera
ref|XP_006353216.1|  PREDICTED: ras-related protein Rab11D-like         266   1e-86   Solanum tuberosum [potatoes]
gb|KDP29718.1|  hypothetical protein JCGZ_18653                         266   2e-86   Jatropha curcas
ref|XP_002273530.1|  PREDICTED: ras-related protein Rab11D              265   2e-86   Vitis vinifera
ref|XP_008440577.1|  PREDICTED: ras-related protein Rab11A              265   3e-86   
ref|XP_011100043.1|  PREDICTED: ras-related protein Rab11D              265   3e-86   Sesamum indicum [beniseed]
ref|XP_004143457.1|  PREDICTED: ras-related protein Rab11A-like         265   3e-86   Cucumis sativus [cucumbers]
ref|XP_007205846.1|  hypothetical protein PRUPE_ppa011070mg             265   5e-86   Prunus persica
ref|XP_002307071.1|  GTP-BINDING protein 3                              265   5e-86   
ref|XP_008235004.1|  PREDICTED: ras-related protein Rab11A              265   6e-86   Prunus mume [ume]
ref|XP_011022819.1|  PREDICTED: ras-related protein Rab11D              263   1e-85   Populus euphratica
gb|KHN44351.1|  Ras-related protein Rab11A                              263   1e-85   Glycine soja [wild soybean]
ref|XP_007047879.1|  RAB GTPase A4A                                     263   1e-85   
ref|XP_002310552.1|  GTP-BINDING protein 3                              263   2e-85   Populus trichocarpa [western balsam poplar]
gb|EPS65006.1|  hypothetical protein M569_09770                         263   2e-85   Genlisea aurea
ref|XP_002531672.1|  protein with unknown function                      262   4e-85   Ricinus communis
ref|XP_010027921.1|  PREDICTED: ras-related protein Rab11A              262   5e-85   Eucalyptus grandis [rose gum]
gb|KJB40355.1|  hypothetical protein B456_007G060000                    262   5e-85   Gossypium raimondii
gb|KJB44099.1|  hypothetical protein B456_007G234300                    262   5e-85   Gossypium raimondii
ref|XP_010106271.1|  Ras-related protein Rab11D                         262   6e-85   Morus notabilis
gb|KHG10894.1|  Ras-related protein Rab11A                              262   6e-85   Gossypium arboreum [tree cotton]
gb|KHG10895.1|  Ras-related protein Rab11A                              262   7e-85   Gossypium arboreum [tree cotton]
ref|NP_001237375.1|  uncharacterized protein LOC100527786               261   7e-85   
ref|XP_004502410.1|  PREDICTED: ras-related protein Rab11A-like         261   7e-85   Cicer arietinum [garbanzo]
gb|KJB44100.1|  hypothetical protein B456_007G234300                    261   9e-85   Gossypium raimondii
ref|XP_006426348.1|  hypothetical protein CICLE_v10026427mg             261   9e-85   Citrus clementina [clementine]
ref|XP_006394054.1|  hypothetical protein EUTSA_v10004873mg             260   2e-84   Eutrema salsugineum [saltwater cress]
ref|XP_009802845.1|  PREDICTED: ras-related protein Rab11D              260   2e-84   Nicotiana sylvestris
ref|XP_009591756.1|  PREDICTED: ras-related protein Rab11D              260   3e-84   Nicotiana tomentosiformis
ref|XP_007163663.1|  hypothetical protein PHAVU_001G253300g             260   3e-84   Phaseolus vulgaris [French bean]
sp|Q40522.1|RB11D_TOBAC  RecName: Full=Ras-related protein Rab11D       259   4e-84   Nicotiana tabacum [American tobacco]
gb|KFK28209.1|  hypothetical protein AALP_AA8G486600                    259   7e-84   Arabis alpina [alpine rockcress]
gb|KHG08307.1|  Ras-related Rab11A                                      259   9e-84   Gossypium arboreum [tree cotton]
ref|XP_010267206.1|  PREDICTED: ras-related protein Rab11A              259   1e-83   Nelumbo nucifera [Indian lotus]
ref|XP_003552040.1|  PREDICTED: ras-related protein Rab11A-like         258   1e-83   Glycine max [soybeans]
gb|AFK49375.1|  unknown                                                 258   1e-83   Medicago truncatula
gb|KEH20797.1|  RAB GTPase-like protein A1D                             258   2e-83   Medicago truncatula
sp|Q40191.1|RB11A_LOTJA  RecName: Full=Ras-related protein Rab11A...    258   2e-83   Lotus japonicus
sp|Q40520.1|RB11C_TOBAC  RecName: Full=Ras-related protein Rab11C       258   3e-83   Nicotiana tabacum [American tobacco]
ref|XP_006346741.1|  PREDICTED: ras-related protein Rab11D-like         258   3e-83   Solanum tuberosum [potatoes]
ref|XP_006281052.1|  hypothetical protein CARUB_v10027070mg             257   4e-83   Capsella rubella
ref|NP_201330.1|  RAB GTPase homolog A4A                                257   4e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864949.1|  hypothetical protein ARALYDRAFT_919858             257   4e-83   Arabidopsis lyrata subsp. lyrata
ref|XP_010484385.1|  PREDICTED: ras-related protein RABA4a-like         257   4e-83   Camelina sativa [gold-of-pleasure]
ref|XP_006466254.1|  PREDICTED: ras-related protein Rab11A-like         257   4e-83   Citrus sinensis [apfelsine]
ref|XP_011097540.1|  PREDICTED: ras-related protein Rab11D-like         257   5e-83   Sesamum indicum [beniseed]
ref|XP_010319241.1|  PREDICTED: ras-related protein Rab11D-like         256   1e-82   Solanum lycopersicum
ref|XP_009344449.1|  PREDICTED: ras-related protein Rab11D              256   1e-82   Pyrus x bretschneideri [bai li]
dbj|BAA02110.1|  GTP-binding protein                                    255   3e-82   Pisum sativum [garden pea]
gb|ACJ84079.1|  unknown                                                 254   4e-82   Medicago truncatula
ref|XP_010926325.1|  PREDICTED: ras-related protein Rab11D-like i...    254   5e-82   Elaeis guineensis
ref|XP_004288173.1|  PREDICTED: ras-related protein Rab11D              253   1e-81   Fragaria vesca subsp. vesca
ref|XP_010273010.1|  PREDICTED: ras-related protein Rab11A-like         253   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010463230.1|  PREDICTED: ras-related protein RABA4a-like         253   1e-81   Camelina sativa [gold-of-pleasure]
ref|XP_008381984.1|  PREDICTED: ras-related protein Rab11D              253   1e-81   
gb|KJB40356.1|  hypothetical protein B456_007G060000                    252   3e-81   Gossypium raimondii
gb|KFK25337.1|  hypothetical protein AALP_AA8G099600                    251   5e-81   Arabis alpina [alpine rockcress]
ref|XP_010680988.1|  PREDICTED: ras-related protein Rab11D              251   7e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002871417.1|  hypothetical protein ARALYDRAFT_325580             251   1e-80   Arabidopsis lyrata subsp. lyrata
ref|XP_010519373.1|  PREDICTED: ras-related protein RABA4a              251   1e-80   Tarenaya hassleriana [spider flower]
ref|XP_010453062.1|  PREDICTED: ras-related protein RABA4a-like         251   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010422850.1|  PREDICTED: ras-related protein RABA4a-like i...    251   2e-80   Camelina sativa [gold-of-pleasure]
gb|AAB97114.1|  small GTP-binding protein                               250   3e-80   Glycine max [soybeans]
ref|XP_003601931.1|  GTP-binding protein                                250   3e-80   Medicago truncatula
ref|XP_010917311.1|  PREDICTED: ras-related protein Rab11D-like         249   3e-80   Elaeis guineensis
ref|XP_006290108.1|  hypothetical protein CARUB_v10003752mg             249   5e-80   Capsella rubella
ref|XP_010491702.1|  PREDICTED: ras-related protein RABA4a-like         249   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_008782165.1|  PREDICTED: ras-related protein Rab11D-like         248   1e-79   Phoenix dactylifera
ref|XP_006404694.1|  hypothetical protein EUTSA_v10000314mg             248   2e-79   Eutrema salsugineum [saltwater cress]
ref|XP_006404948.1|  hypothetical protein EUTSA_v10000315mg             248   2e-79   Eutrema salsugineum [saltwater cress]
ref|XP_003573862.1|  PREDICTED: ras-related protein Rab11D-like         247   2e-79   
ref|XP_009393549.1|  PREDICTED: ras-related protein Rab11D-like         247   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390909.1|  PREDICTED: ras-related protein Rab11D-like         247   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010523299.1|  PREDICTED: ras-related protein RABA4a-like         248   2e-79   Tarenaya hassleriana [spider flower]
ref|NP_001064476.1|  Os10g0377400                                       247   3e-79   
ref|XP_006827843.1|  hypothetical protein AMTR_s00008p00026380          247   4e-79   Amborella trichopoda
ref|XP_009122063.1|  PREDICTED: ras-related protein RABA4a-like         246   6e-79   Brassica rapa
emb|CDX69843.1|  BnaA10g21920D                                          246   7e-79   
ref|XP_003577923.1|  PREDICTED: ras-related protein RGP1                246   8e-79   
ref|XP_006399529.1|  hypothetical protein EUTSA_v10014596mg             246   1e-78   Eutrema salsugineum [saltwater cress]
ref|XP_004985399.1|  PREDICTED: ras-related protein Rab11D-like         245   1e-78   Setaria italica
ref|NP_001149604.1|  LOC100283230                                       245   2e-78   Zea mays [maize]
ref|XP_007159716.1|  hypothetical protein PHAVU_002G261400g             245   2e-78   Phaseolus vulgaris [French bean]
ref|XP_006662306.1|  PREDICTED: ras-related protein Rab11D-like         244   3e-78   Oryza brachyantha
ref|XP_002489255.1|  hypothetical protein SORBIDRAFT_0012s021070        244   4e-78   Sorghum bicolor [broomcorn]
ref|NP_001151068.1|  ras-related protein Rab11D                         244   4e-78   
ref|NP_001151560.1|  ras-related protein Rab11D                         244   4e-78   Zea mays [maize]
emb|CDX81274.1|  BnaC09g06850D                                          244   4e-78   
ref|XP_002465727.1|  hypothetical protein SORBIDRAFT_01g044550          244   4e-78   Sorghum bicolor [broomcorn]
ref|XP_009112174.1|  PREDICTED: ras-related protein RABA4a              244   5e-78   Brassica rapa
emb|CDP07731.1|  unnamed protein product                                244   6e-78   Coffea canephora [robusta coffee]
ref|XP_006660497.1|  PREDICTED: ras-related protein RGP1-like           244   7e-78   Oryza brachyantha
gb|KHN29041.1|  Ras-related protein Rab11A                              244   8e-78   Glycine soja [wild soybean]
ref|XP_003532818.1|  PREDICTED: ras-related protein Rab11A-like         243   9e-78   
dbj|BAJ93377.1|  predicted protein                                      243   2e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004983071.1|  PREDICTED: ras-related protein Rab11D-like         242   2e-77   Setaria italica
ref|XP_004504100.1|  PREDICTED: ras-related protein Rab11A-like         242   3e-77   Cicer arietinum [garbanzo]
ref|XP_009413627.1|  PREDICTED: ras-related protein Rab11D-like         242   4e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003525046.1|  PREDICTED: ras-related protein Rab11A              242   5e-77   
gb|ABK22282.1|  unknown                                                 241   7e-77   Picea sitchensis
gb|ACU16457.1|  unknown                                                 241   7e-77   Glycine max [soybeans]
ref|XP_009799541.1|  PREDICTED: ras-related protein RGP1-like           241   8e-77   Nicotiana sylvestris
sp|P25766.2|RLGP1_ORYSJ  RecName: Full=Ras-related protein RGP1; ...    241   9e-77   Oryza sativa Japonica Group [Japonica rice]
gb|ABK25126.1|  unknown                                                 241   9e-77   Picea sitchensis
ref|XP_010422851.1|  PREDICTED: ras-related protein RABA4a-like i...    241   1e-76   Camelina sativa [gold-of-pleasure]
gb|EYU27083.1|  hypothetical protein MIMGU_mgv1a013266mg                241   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_010555372.1|  PREDICTED: ras-related protein RABA4b              241   1e-76   Tarenaya hassleriana [spider flower]
ref|XP_009129562.1|  PREDICTED: ras-related protein RABA4b              241   1e-76   Brassica rapa
ref|XP_002459958.1|  hypothetical protein SORBIDRAFT_02g018890          241   1e-76   Sorghum bicolor [broomcorn]
gb|KFK30576.1|  hypothetical protein AALP_AA7G279800                    240   1e-76   Arabis alpina [alpine rockcress]
ref|XP_009612391.1|  PREDICTED: ras-related protein RGP1-like           240   2e-76   Nicotiana tomentosiformis
ref|XP_006366509.1|  PREDICTED: ras-related protein RGP1-like           240   2e-76   Solanum tuberosum [potatoes]
ref|XP_010102630.1|  Ras-related protein RGP1                           239   3e-76   Morus notabilis
gb|EYU39898.1|  hypothetical protein MIMGU_mgv1a020125mg                239   5e-76   Erythranthe guttata [common monkey flower]
gb|KJB18227.1|  hypothetical protein B456_003G040900                    238   8e-76   Gossypium raimondii
ref|XP_010067891.1|  PREDICTED: ras-related protein RABA4c-like         238   9e-76   Eucalyptus grandis [rose gum]
ref|XP_010928849.1|  PREDICTED: ras-related protein RGP1                238   1e-75   Elaeis guineensis
ref|XP_008787280.1|  PREDICTED: ras-related protein RGP1                238   2e-75   Phoenix dactylifera
ref|XP_010265793.1|  PREDICTED: ras-related protein RGP1-like           238   2e-75   Nelumbo nucifera [Indian lotus]
gb|KHG00253.1|  Ras-related Rab11A                                      238   2e-75   Gossypium arboreum [tree cotton]
ref|XP_004229604.1|  PREDICTED: ras-related protein RGP1                238   2e-75   Solanum lycopersicum
ref|XP_011087327.1|  PREDICTED: ras-related protein RGP1                238   2e-75   Sesamum indicum [beniseed]
ref|XP_010913931.1|  PREDICTED: ras-related protein RGP1-like           237   3e-75   Elaeis guineensis
tpg|DAA39806.1|  TPA: ras protein RGP1                                  237   3e-75   
ref|XP_010446581.1|  PREDICTED: ras-related protein RABA4b-like         237   3e-75   Camelina sativa [gold-of-pleasure]
gb|EMT23732.1|  Ras-related protein RGP1                                236   4e-75   
ref|XP_009590361.1|  PREDICTED: ras-related protein RABA4d-like         237   4e-75   Nicotiana tomentosiformis
ref|XP_002863846.1|  small molecular weight G-protein 1                 237   4e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_010437126.1|  PREDICTED: ras-related protein RABA4b              237   4e-75   Camelina sativa [gold-of-pleasure]
ref|XP_002298447.1|  GTP-binding family protein                         237   5e-75   Populus trichocarpa [western balsam poplar]
ref|XP_002264293.1|  PREDICTED: ras-related protein RGP1                237   5e-75   Vitis vinifera
ref|XP_004956465.1|  PREDICTED: ras-related protein RGP1-like           236   5e-75   Setaria italica
ref|XP_006284416.1|  hypothetical protein CARUB_v10005586mg             238   5e-75   
ref|XP_011025048.1|  PREDICTED: ras-related protein RABA4d              236   6e-75   Populus euphratica
ref|XP_007028923.1|  RAB GTPase A4D                                     236   7e-75   
ref|XP_010257365.1|  PREDICTED: ras-related protein RABA4d              236   7e-75   Nelumbo nucifera [Indian lotus]
emb|CDY69836.1|  BnaAnng31680D                                          236   7e-75   Brassica napus [oilseed rape]
ref|XP_006395225.1|  hypothetical protein EUTSA_v10004881mg             236   7e-75   Eutrema salsugineum [saltwater cress]
ref|XP_004249189.1|  PREDICTED: ras-related protein RABA4d-like         236   8e-75   Solanum lycopersicum
ref|XP_010695403.1|  PREDICTED: ras-related protein RABA4d              236   9e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006351381.1|  PREDICTED: ras-related protein RABA4d-like         236   9e-75   Solanum tuberosum [potatoes]
gb|AAM66946.1|  GTP-binding protein GB3                                 236   9e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AAA87884.1|  ATGB3                                                   236   1e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KHG15141.1|  Ras-related RABA4c -like protein                        236   1e-74   Gossypium arboreum [tree cotton]
ref|XP_010431983.1|  PREDICTED: ras-related protein RABA4b-like         236   1e-74   Camelina sativa [gold-of-pleasure]
ref|NP_195709.1|  GTP-binding protein ATGB3                             235   1e-74   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69369.1|  BnaC01g00840D                                          241   1e-74   
emb|CDP10094.1|  unnamed protein product                                235   1e-74   Coffea canephora [robusta coffee]
ref|XP_008240816.1|  PREDICTED: ras-related protein RABA4d              235   1e-74   Prunus mume [ume]
ref|XP_007204003.1|  hypothetical protein PRUPE_ppa025526mg             235   1e-74   Prunus persica
ref|XP_002866902.1|  hypothetical protein ARALYDRAFT_490786             235   2e-74   
ref|XP_004172276.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    235   2e-74   
ref|XP_006850119.1|  hypothetical protein AMTR_s00022p00227570          235   2e-74   Amborella trichopoda
ref|XP_004149604.1|  PREDICTED: ras-related protein RABA4c-like         235   2e-74   Cucumis sativus [cucumbers]
ref|XP_007052583.1|  RAB GTPase A4C                                     235   2e-74   
ref|XP_006421492.1|  hypothetical protein CICLE_v10005824mg             235   2e-74   Citrus clementina [clementine]
ref|XP_006281058.1|  hypothetical protein CARUB_v10027077mg             235   2e-74   Capsella rubella
ref|XP_010442212.1|  PREDICTED: ras-related protein RABA4c-like         235   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010439146.1|  PREDICTED: ras-related protein RABA4c              235   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_009399667.1|  PREDICTED: ras-related protein RGP1-like           235   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011078858.1|  PREDICTED: ras-related protein RABA4d              234   2e-74   Sesamum indicum [beniseed]
ref|XP_010057727.1|  PREDICTED: ras-related protein RABA4d              234   3e-74   Eucalyptus grandis [rose gum]
ref|XP_009151604.1|  PREDICTED: ras-related protein RABA4c              234   3e-74   Brassica rapa
ref|XP_002513185.1|  protein with unknown function                      234   3e-74   Ricinus communis
ref|XP_009804804.1|  PREDICTED: ras-related protein RABA4d-like         234   3e-74   Nicotiana sylvestris
ref|XP_010482045.1|  PREDICTED: ras-related protein RABA4c-like         234   4e-74   Camelina sativa [gold-of-pleasure]
emb|CDX86332.1|  BnaA06g30490D                                          234   4e-74   
gb|EYU20715.1|  hypothetical protein MIMGU_mgv1a013518mg                234   4e-74   Erythranthe guttata [common monkey flower]
ref|XP_009411810.1|  PREDICTED: ras-related protein RGP1-like           234   5e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146862.1|  LOC100280470                                       234   5e-74   Zea mays [maize]
emb|CDY54519.1|  BnaC07g49230D                                          234   6e-74   Brassica napus [oilseed rape]
ref|XP_008461787.1|  PREDICTED: ras-related protein RABA4c              234   7e-74   Cucumis melo [Oriental melon]
ref|XP_009763158.1|  PREDICTED: ras-related protein RABA4d-like         234   7e-74   Nicotiana sylvestris
ref|XP_009391884.1|  PREDICTED: ras-related protein RGP1-like           233   8e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_199607.1|  RAB GTPase homolog A4C                                233   8e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534274.1|  PREDICTED: ras-related protein RABA4c              233   1e-73   Tarenaya hassleriana [spider flower]
ref|XP_009345104.1|  PREDICTED: ras-related protein RABA4d-like         234   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_001775770.1|  predicted protein                                  233   1e-73   
ref|XP_008375145.1|  PREDICTED: ras-related protein RABA4c-like         233   2e-73   Malus domestica [apple tree]
ref|XP_009354700.1|  PREDICTED: ras-related protein RABA4c-like         233   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_002282798.1|  PREDICTED: ras-related protein RABA4d              233   2e-73   Vitis vinifera
ref|XP_009347482.1|  PREDICTED: ras-related protein RABA4d-like         234   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_008392105.1|  PREDICTED: ras-related protein RABA4d-like         234   2e-73   
emb|CDY00758.1|  BnaC03g37420D                                          232   2e-73   
ref|XP_009135214.1|  PREDICTED: ras-related protein RABA4d-like         232   2e-73   Brassica rapa
gb|KDP43443.1|  hypothetical protein JCGZ_16730                         232   2e-73   Jatropha curcas
ref|XP_008460801.1|  PREDICTED: ras-related protein RABA4d              232   2e-73   Cucumis melo [Oriental melon]
ref|XP_009120881.1|  PREDICTED: ras-related protein RABA4d              232   2e-73   Brassica rapa
ref|NP_187823.1|  RAB GTPase-like protein A4D                           232   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557931.1|  PREDICTED: ras-related protein RABA4d-like         232   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_004150166.1|  PREDICTED: ras-related protein RABA4d-like         232   3e-73   Cucumis sativus [cucumbers]
ref|XP_010520062.1|  PREDICTED: ras-related protein RABA4d              232   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_011075182.1|  PREDICTED: ras-related protein RABA4d-like         232   4e-73   Sesamum indicum [beniseed]
ref|XP_009591241.1|  PREDICTED: ras-related protein RABA4d-like         232   4e-73   Nicotiana tomentosiformis
ref|XP_008344636.1|  PREDICTED: ras-related protein RABA4d              230   4e-73   
emb|CAA41966.1|  GTP-binding protein                                    231   4e-73   Oryza sativa [red rice]
ref|XP_008373738.1|  PREDICTED: ras-related protein RABA4d              231   5e-73   
ref|XP_004234844.1|  PREDICTED: ras-related protein RABA4d-like         231   5e-73   Solanum lycopersicum
ref|XP_008350827.1|  PREDICTED: ras-related protein RABA4d              229   7e-73   
ref|XP_006438973.1|  hypothetical protein CICLE_v10032676mg             231   7e-73   Citrus clementina [clementine]
ref|XP_007140805.1|  hypothetical protein PHAVU_008G143600g             231   7e-73   Phaseolus vulgaris [French bean]
ref|XP_001753670.1|  Rab11/RabA-family small GTPase                     231   7e-73   
emb|CDY42133.1|  BnaC05g40860D                                          231   9e-73   Brassica napus [oilseed rape]
ref|XP_003516822.1|  PREDICTED: ras-related protein RABA4d-like         231   1e-72   Glycine max [soybeans]
ref|XP_010672725.1|  PREDICTED: ras-related protein RABA4d              231   1e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010489789.1|  PREDICTED: ras-related protein RABA4d-like         230   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_007218358.1|  hypothetical protein PRUPE_ppa011105mg             230   2e-72   Prunus persica
ref|XP_002532404.1|  protein with unknown function                      230   2e-72   Ricinus communis
ref|XP_008231353.1|  PREDICTED: ras-related protein RABA4c              230   2e-72   Prunus mume [ume]
ref|XP_004494010.1|  PREDICTED: ras-related protein RABA4d-like         229   3e-72   
gb|EPS73160.1|  hypothetical protein M569_01593                         229   3e-72   Genlisea aurea
gb|KHN07997.1|  Ras-related protein RABA4d                              231   3e-72   Glycine soja [wild soybean]
ref|XP_003539132.1|  PREDICTED: ras-related protein RABA4d-like         229   4e-72   Glycine max [soybeans]
ref|XP_001760654.1|  Rab11/RabA-family small GTPase                     229   4e-72   
ref|XP_007145654.1|  hypothetical protein PHAVU_007G257200g             229   4e-72   Phaseolus vulgaris [French bean]
ref|XP_004309478.1|  PREDICTED: ras-related protein RABA4d isofor...    229   4e-72   Fragaria vesca subsp. vesca
gb|KHG02480.1|  Ras-related RABA4d -like protein                        229   5e-72   Gossypium arboreum [tree cotton]
gb|KEH16247.1|  RAB GTPase-like protein A1D                             228   6e-72   Medicago truncatula
ref|XP_009146635.1|  PREDICTED: ras-related protein RABA4d-like         229   1e-71   Brassica rapa
ref|XP_009365017.1|  PREDICTED: ras-related protein RABA4c-like         228   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_002972485.1|  rab family GTPase                                  228   1e-71   Selaginella moellendorffii
ref|XP_002984315.1|  rab family GTPase                                  228   1e-71   Selaginella moellendorffii
ref|XP_004497938.1|  PREDICTED: ras-related protein RABA4d-like         228   1e-71   Cicer arietinum [garbanzo]
ref|XP_002323298.1|  Ras-related GTP-binding family protein             228   2e-71   Populus trichocarpa [western balsam poplar]
gb|KJB36087.1|  hypothetical protein B456_006G140300                    227   2e-71   Gossypium raimondii
gb|AFK37481.1|  unknown                                                 227   2e-71   Medicago truncatula
gb|KHG20755.1|  Ras-related RABA4d -like protein                        227   2e-71   Gossypium arboreum [tree cotton]
ref|XP_011016542.1|  PREDICTED: ras-related protein RABA4d-like         226   4e-71   Populus euphratica
ref|XP_010111429.1|  Ras-related protein RABA4d                         227   4e-71   
gb|AFK40086.1|  unknown                                                 226   4e-71   Lotus japonicus
ref|XP_011033268.1|  PREDICTED: ras-related protein RABA4d-like i...    226   4e-71   Populus euphratica
gb|ABK23331.1|  unknown                                                 226   4e-71   Picea sitchensis
gb|ACU18500.1|  unknown                                                 226   6e-71   Glycine max [soybeans]
ref|XP_004306514.1|  PREDICTED: ras-related protein RABA4c              226   1e-70   Fragaria vesca subsp. vesca
gb|KHN09949.1|  Ras-related protein RABA4d                              225   1e-70   Glycine soja [wild soybean]
ref|XP_006381042.1|  Ras-related GTP-binding family protein             224   3e-70   Populus trichocarpa [western balsam poplar]
gb|AAG51053.1|AC069473_15  ras-related GTP-binding protein, putat...    223   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422852.1|  PREDICTED: ras-related protein RABA4a-like i...    223   1e-69   
gb|EPS69801.1|  hypothetical protein M569_04963                         222   2e-69   Genlisea aurea
ref|XP_009375439.1|  PREDICTED: ras-related protein RABA3               223   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_011020284.1|  PREDICTED: ras-related protein RABA4d-like         222   2e-69   Populus euphratica
ref|XP_002262618.3|  PREDICTED: ras-related protein RABA3               222   4e-69   Vitis vinifera
ref|XP_007135286.1|  hypothetical protein PHAVU_010G116500g             221   7e-69   Phaseolus vulgaris [French bean]
ref|XP_006339750.1|  PREDICTED: ras-related protein RABA3-like          221   1e-68   Solanum tuberosum [potatoes]
gb|KHF99482.1|  Ras-related RABA3 -like protein                         220   2e-68   Gossypium arboreum [tree cotton]
ref|XP_011470829.1|  PREDICTED: ras-related protein RABA4d isofor...    219   2e-68   Fragaria vesca subsp. vesca
ref|XP_004230007.1|  PREDICTED: ras-related protein RABA3               220   3e-68   Solanum lycopersicum
emb|CAA98178.1|  RAB11B                                                 219   4e-68   Lotus japonicus
gb|KJB09611.1|  hypothetical protein B456_001G152600                    219   5e-68   Gossypium raimondii
gb|AES82796.2|  small GTPase family RAB protein                         218   5e-68   Medicago truncatula
emb|CDP08641.1|  unnamed protein product                                219   5e-68   Coffea canephora [robusta coffee]
ref|XP_003548240.1|  PREDICTED: ras-related protein RABA3-like is...    219   6e-68   
ref|XP_002974254.1|  rab family GTPase                                  218   6e-68   Selaginella moellendorffii
ref|XP_002985624.1|  rab family GTPase                                  218   6e-68   Selaginella moellendorffii
ref|XP_007220411.1|  hypothetical protein PRUPE_ppa010826mg             218   8e-68   
ref|XP_008233092.1|  PREDICTED: ras-related protein RABA3               219   8e-68   Prunus mume [ume]
ref|XP_003528777.1|  PREDICTED: ras-related protein RABA3-like          219   8e-68   Glycine max [soybeans]
gb|KJB41593.1|  hypothetical protein B456_007G110800                    218   9e-68   Gossypium raimondii
ref|XP_010693617.1|  PREDICTED: ras-related protein RABA3               218   1e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011094230.1|  PREDICTED: ras-related protein RABA3               218   1e-67   Sesamum indicum [beniseed]
gb|KHN27367.1|  Ras-related protein RABA4d                              218   1e-67   Glycine soja [wild soybean]
ref|XP_003626578.1|  Ras-related GTP-binding protein                    218   1e-67   
ref|XP_002320214.2|  GTP-binding family protein                         218   2e-67   
ref|XP_010252473.1|  PREDICTED: ras-related protein RABA3               218   2e-67   Nelumbo nucifera [Indian lotus]
gb|AFK45144.1|  unknown                                                 218   2e-67   Lotus japonicus
ref|XP_010100694.1|  Ras-related protein RABA3                          217   2e-67   Morus notabilis
ref|XP_011033267.1|  PREDICTED: ras-related protein RABA4d-like i...    217   3e-67   Populus euphratica
ref|XP_011038764.1|  PREDICTED: ras-related protein RABA3-like          217   3e-67   Populus euphratica
ref|XP_004494844.1|  PREDICTED: ras-related protein RABA3-like          216   4e-67   Cicer arietinum [garbanzo]
gb|AET02012.2|  Ras-related small GTP-binding family protein            216   7e-67   Medicago truncatula
ref|XP_007147338.1|  hypothetical protein PHAVU_006G115500g             216   7e-67   Phaseolus vulgaris [French bean]
ref|XP_008376179.1|  PREDICTED: ras-related protein RABA3               216   7e-67   Malus domestica [apple tree]
ref|XP_004306638.1|  PREDICTED: ras-related protein RABA3               216   7e-67   Fragaria vesca subsp. vesca
ref|XP_007051475.1|  RAB GTPase A3                                      218   1e-66   
gb|KDO83348.1|  hypothetical protein CISIN_1g040835mg                   214   1e-66   Citrus sinensis [apfelsine]
dbj|BAA84640.1|  PRA2                                                   215   1e-66   
dbj|BAA02109.1|  GTP-binding protein                                    215   2e-66   
ref|XP_009617959.1|  PREDICTED: ras-related protein RABA3               216   2e-66   
ref|NP_001239700.1|  uncharacterized protein LOC100787725               215   2e-66   
ref|XP_011023129.1|  PREDICTED: ras-related protein RABA3-like          214   3e-66   
gb|ACU22888.1|  unknown                                                 214   6e-66   
ref|XP_003554775.1|  PREDICTED: ras-related protein RABA3-like          214   7e-66   
gb|EMS64557.1|  Ras-related protein RGP1                                213   7e-66   
ref|XP_002533328.1|  protein with unknown function                      213   8e-66   
ref|XP_009797391.1|  PREDICTED: ras-related protein RABA3               214   9e-66   
ref|XP_004510635.1|  PREDICTED: ras-related protein RABA3-like          213   1e-65   
ref|XP_010054978.1|  PREDICTED: ras-related protein RABA3               213   1e-65   
ref|XP_010934494.1|  PREDICTED: ras-related protein RABA3               213   1e-65   
gb|KDP28444.1|  hypothetical protein JCGZ_14215                         211   6e-65   
ref|XP_009392203.1|  PREDICTED: ras-related protein RABA4d-like         211   8e-65   
ref|XP_002302656.2|  GTP-binding family protein                         211   1e-64   
ref|XP_009415825.1|  PREDICTED: ras-related protein RABA3-like          211   1e-64   
gb|AAM08543.1|AC079935_15  Putative Ras-related protein Rab             209   2e-64   
gb|KFK42506.1|  hypothetical protein AALP_AA1G002500                    210   2e-64   
ref|XP_008806367.1|  PREDICTED: ras-related protein RABA3               209   4e-64   
ref|XP_006598887.1|  PREDICTED: ras-related protein RABA3-like is...    209   4e-64   
ref|XP_002889376.1|  hypothetical protein ARALYDRAFT_470156             209   5e-64   
ref|XP_002315193.2|  hypothetical protein POPTR_0010s20460g             208   6e-64   
ref|XP_002312127.2|  GTP-binding family protein                         208   6e-64   
ref|XP_010521896.1|  PREDICTED: ras-related protein RABA2b-like         207   7e-64   
ref|XP_010522902.1|  PREDICTED: ras-related protein RABA3               208   7e-64   
ref|XP_006444779.1|  hypothetical protein CICLE_v10021994mg             208   1e-63   
ref|XP_010480581.1|  PREDICTED: ras-related protein RABA3               208   1e-63   
ref|XP_010474709.1|  PREDICTED: ras-related protein RABA3-like          208   1e-63   
ref|XP_009119679.1|  PREDICTED: ras-related protein RABA3               207   2e-63   
ref|XP_006418398.1|  hypothetical protein EUTSA_v10009311mg             207   2e-63   
ref|XP_007009171.1|  RAB GTPase A2B                                     206   2e-63   
gb|KJB19978.1|  hypothetical protein B456_003G128100                    206   2e-63   
ref|XP_010905873.1|  PREDICTED: ras-related protein Rab2BV-like         206   2e-63   
ref|XP_010457157.1|  PREDICTED: ras-related protein RABA3-like          207   3e-63   
gb|KHG15679.1|  Ras-related Rab11C                                      206   3e-63   
gb|KHG06460.1|  Ras-related Rab11C                                      206   3e-63   
ref|XP_003544161.1|  PREDICTED: ras-related protein Rab2BV-like         206   4e-63   
gb|KHN13102.1|  Ras-related protein Rab2BV                              206   4e-63   
gb|KHN20893.1|  Ras-related protein Rab2BV                              206   4e-63   
dbj|BAJ98193.1|  predicted protein                                      207   4e-63   
ref|NP_171628.2|  RAB GTPase homolog A3                                 206   4e-63   
ref|XP_010033213.1|  PREDICTED: ras-related protein Rab2BV-like         206   4e-63   
ref|XP_009588584.1|  PREDICTED: ras-related protein Rab2BV              206   4e-63   
ref|XP_006400995.1|  hypothetical protein EUTSA_v10014634mg             206   4e-63   
ref|XP_006305568.1|  hypothetical protein CARUB_v10010167mg             206   5e-63   
ref|XP_007141835.1|  hypothetical protein PHAVU_008G229600g             206   5e-63   
ref|XP_010905396.1|  PREDICTED: ras-related protein Rab2BV              206   5e-63   
ref|XP_003519369.1|  PREDICTED: ras-related protein Rab11C-like         206   6e-63   
ref|XP_006486541.1|  PREDICTED: ras-related protein Rab11C-like         205   6e-63   
ref|NP_001290016.1|  ras-related protein Rab2BV                         205   6e-63   
ref|XP_008811507.1|  PREDICTED: ras-related protein Rab11C isofor...    205   6e-63   
gb|KDO69222.1|  hypothetical protein CISIN_1g042687mg                   205   6e-63   
ref|XP_009351264.1|  PREDICTED: ras-related protein Rab2BV-like         205   7e-63   
emb|CDP09116.1|  unnamed protein product                                205   7e-63   
gb|KDP44862.1|  hypothetical protein JCGZ_01362                         205   7e-63   
emb|CDY02867.1|  BnaC02g10220D                                          205   8e-63   
emb|CDM84991.1|  unnamed protein product                                205   8e-63   
dbj|BAJ96755.1|  predicted protein                                      205   8e-63   
ref|XP_004307586.1|  PREDICTED: ras-related protein Rab2BV-like i...    205   9e-63   
sp|Q40193.1|RB11C_LOTJA  RecName: Full=Ras-related protein Rab11C       205   9e-63   
gb|AFK33953.1|  unknown                                                 205   9e-63   
ref|XP_008811352.1|  PREDICTED: ras-related protein Rab11C-like         205   1e-62   
ref|XP_003564610.1|  PREDICTED: ras-related protein Rab11C-like         205   1e-62   
gb|KJB60697.1|  hypothetical protein B456_009G320100                    205   1e-62   
ref|XP_006488403.1|  PREDICTED: ras-related protein Rab11C-like i...    205   1e-62   
ref|XP_007148577.1|  hypothetical protein PHAVU_006G220200g             205   1e-62   
ref|XP_003600801.1|  Ras-related protein Rab11A                         205   1e-62   
ref|XP_004507156.1|  PREDICTED: ras-related protein Rab11C-like         205   1e-62   
ref|XP_009402312.1|  PREDICTED: ras-related protein Rab11C-like         205   1e-62   
ref|XP_003537971.1|  PREDICTED: ras-related protein Rab11C-like         204   1e-62   
ref|XP_006650816.1|  PREDICTED: ras-related protein Rab11C-like         204   1e-62   
ref|XP_010227523.1|  PREDICTED: ras-related protein Rab11C              204   1e-62   
ref|XP_002524247.1|  protein with unknown function                      204   1e-62   
gb|KJB08770.1|  hypothetical protein B456_001G113000                    204   1e-62   
dbj|BAK01667.1|  predicted protein                                      204   1e-62   
ref|XP_010923201.1|  PREDICTED: ras-related protein Rab2BV              204   1e-62   
ref|XP_010557233.1|  PREDICTED: ras-related protein RABA2b              204   1e-62   
ref|XP_009126715.1|  PREDICTED: ras-related protein RABA2d              204   1e-62   
gb|KHN25232.1|  Ras-related protein Rab11C                              204   1e-62   
ref|XP_003539528.1|  PREDICTED: ras-related protein Rab11C-like i...    204   1e-62   
ref|XP_007016291.1|  RAB GTPase A2B                                     204   1e-62   
gb|EMT00837.1|  Ras-related protein Rab11A                              205   1e-62   
ref|XP_007132033.1|  hypothetical protein PHAVU_011G061100g             204   1e-62   
ref|NP_001130075.1|  uncharacterized protein LOC100191168               204   1e-62   
emb|CDY15192.1|  BnaC05g00710D                                          205   2e-62   
ref|XP_008785489.1|  PREDICTED: ras-related protein Rab11C              204   2e-62   
gb|EEC76436.1|  hypothetical protein OsI_14124                          204   2e-62   
ref|XP_011036041.1|  PREDICTED: ras-related protein Rab2BV-like         204   2e-62   
ref|XP_010030204.1|  PREDICTED: ras-related protein RABA2a              204   2e-62   
ref|XP_004981229.1|  PREDICTED: ras-related protein Rab11C-like         204   2e-62   
gb|AGV54242.1|  Ras-related protein Rab11C                              204   2e-62   
ref|XP_006645011.1|  PREDICTED: ras-related protein Rab11C-like         204   2e-62   
gb|AFK46874.1|  unknown                                                 204   2e-62   
ref|XP_010043481.1|  PREDICTED: ras-related protein Rab2BV              204   2e-62   
ref|XP_002866318.1|  hypothetical protein ARALYDRAFT_919138             204   2e-62   
gb|KDO37351.1|  hypothetical protein CISIN_1g048709mg                   204   2e-62   
ref|XP_010108378.1|  Ras-related protein Rab2BV                         204   2e-62   
ref|XP_010503299.1|  PREDICTED: ras-related protein RABA2c              204   2e-62   
ref|XP_008441408.1|  PREDICTED: ras-related protein Rab2BV              204   2e-62   
ref|XP_004138445.1|  PREDICTED: ras-related protein Rab2BV-like         204   2e-62   
gb|EMS46168.1|  Ras-related protein Rab11C                              203   2e-62   
ref|NP_190267.1|  Ras-related protein RABA2c                            204   2e-62   
emb|CDP00152.1|  unnamed protein product                                204   2e-62   
gb|KJB74090.1|  hypothetical protein B456_011G271400                    204   2e-62   
ref|XP_010454720.1|  PREDICTED: ras-related protein RABA2d              204   2e-62   
ref|XP_007163484.1|  hypothetical protein PHAVU_001G238000g             204   2e-62   
ref|XP_011089516.1|  PREDICTED: ras-related protein Rab11C              204   2e-62   
ref|NP_001136551.1|  uncharacterized protein LOC100216670               204   2e-62   
ref|XP_006281080.1|  hypothetical protein CARUB_v10027110mg             204   2e-62   
ref|XP_007218372.1|  hypothetical protein PRUPE_ppa011294mg             204   2e-62   
ref|XP_010520249.1|  PREDICTED: ras-related protein RABA2d              204   2e-62   
ref|XP_006418853.1|  hypothetical protein EUTSA_v10002662mg             204   2e-62   
ref|XP_004490850.1|  PREDICTED: ras-related protein Rab11C-like         204   2e-62   
ref|XP_003552713.1|  PREDICTED: ras-related protein Rab11C-like         204   2e-62   
ref|XP_006477036.1|  PREDICTED: ras-related protein RABA3-like          204   3e-62   
ref|XP_004957418.1|  PREDICTED: ras-related protein RABA3-like          204   3e-62   
gb|KDP42194.1|  hypothetical protein JCGZ_02924                         204   3e-62   
ref|XP_002282136.1|  PREDICTED: ras-related protein Rab2BV              204   3e-62   
ref|XP_008233507.1|  PREDICTED: ras-related protein Rab2BV-like         204   3e-62   
ref|XP_010535441.1|  PREDICTED: ras-related protein RABA2d-like         204   3e-62   
emb|CDY33014.1|  BnaA10g12200D                                          204   3e-62   
ref|XP_011040076.1|  PREDICTED: ras-related protein Rab11C              203   3e-62   
ref|XP_010691645.1|  PREDICTED: ras-related protein Rab2BV-like         203   3e-62   
ref|XP_006373543.1|  hypothetical protein POPTR_0016s00240g             203   3e-62   
ref|XP_009120428.1|  PREDICTED: ras-related protein RABA2d-like         203   4e-62   
ref|XP_009161793.1|  Ras-like protein Rab-11B                           203   4e-62   
ref|XP_010262670.1|  PREDICTED: ras-related protein Rab2BV              203   4e-62   
ref|XP_009118440.1|  PREDICTED: ras-related protein RABA2b              203   4e-62   
ref|XP_008384909.1|  PREDICTED: ras-related protein Rab2BV              203   4e-62   
ref|XP_009795757.1|  PREDICTED: ras-related protein Rab11A              203   4e-62   
gb|EYU19954.1|  hypothetical protein MIMGU_mgv1a013564mg                203   4e-62   
ref|XP_004239919.1|  PREDICTED: ras-related protein RABA2b-like         203   4e-62   
ref|XP_006858606.1|  hypothetical protein AMTR_s00071p00201210          203   4e-62   
gb|KEH19056.1|  RAB GTPase-like protein A1D                             204   4e-62   
ref|XP_009603588.1|  PREDICTED: ras-related protein Rab11A              203   4e-62   
ref|XP_006355682.1|  PREDICTED: ras-related protein RABA2b-like         203   5e-62   
gb|ACJ83834.1|  unknown                                                 204   5e-62   
ref|XP_009774455.1|  PREDICTED: ras-related protein RABA2b-like         203   5e-62   
ref|XP_010487428.1|  PREDICTED: ras-related protein RABA2b-like         203   5e-62   
ref|NP_001044805.1|  Os01g0848700                                       203   5e-62   
ref|XP_002307838.2|  hypothetical protein POPTR_0006s00240g             203   5e-62   
ref|XP_010475498.1|  PREDICTED: ras-related protein RABA2b              203   5e-62   
emb|CDY06703.1|  BnaA10g04820D                                          203   5e-62   
gb|EMF15948.1|  ras GTPase Rab11                                        203   5e-62   
ref|XP_004291517.1|  PREDICTED: ras-related protein Rab11C              203   5e-62   
gb|KJB21647.1|  hypothetical protein B456_004G006300                    203   5e-62   
ref|NP_200723.1|  RAB GTPase homolog A2D                                203   5e-62   
ref|NP_172221.1|  RAB GTPase homolog A2B                                203   6e-62   
ref|XP_002282090.1|  PREDICTED: ras-related protein Rab2BV              203   6e-62   
ref|XP_006304197.1|  hypothetical protein CARUB_v10010276mg             203   6e-62   
ref|XP_008372177.1|  PREDICTED: ras-related protein Rab2BV-like         203   6e-62   
ref|NP_001051744.1|  Os03g0823700                                       203   6e-62   
gb|ACU24291.1|  unknown                                                 203   6e-62   
ref|XP_003592898.1|  Ras-related protein RABA2a                         203   6e-62   
ref|XP_009622621.1|  PREDICTED: ras-related protein RABA2b-like         202   6e-62   
ref|XP_002520494.1|  protein with unknown function                      202   6e-62   
gb|EYU45967.1|  hypothetical protein MIMGU_mgv1a013560mg                202   6e-62   
ref|XP_008452243.1|  PREDICTED: ras-related protein RABA2a              202   7e-62   
ref|XP_004133721.1|  PREDICTED: ras-related protein RABA2a-like         202   7e-62   
ref|XP_010457916.1|  PREDICTED: ras-related protein RABA2b-like         202   8e-62   
ref|XP_004503209.1|  PREDICTED: ras-related protein Rab11C-like i...    202   8e-62   
ref|XP_010483535.1|  PREDICTED: ras-related protein RABA2d-like         202   8e-62   
ref|XP_006417807.1|  hypothetical protein EUTSA_v10008748mg             202   8e-62   
ref|XP_011011334.1|  PREDICTED: ras-related protein RABA2a              202   8e-62   
ref|XP_011047877.1|  PREDICTED: ras-related protein RABA2a-like         202   8e-62   
ref|XP_007736612.1|  Ras-like protein Rab-11B                           202   9e-62   
gb|KHN39681.1|  Ras-related protein RABA2a                              202   9e-62   
ref|XP_006389492.1|  hypothetical protein POPTR_0022s00350g             202   9e-62   
emb|CDX80299.1|  BnaC09g34430D                                          204   1e-61   
ref|XP_009797654.1|  PREDICTED: ras-related protein Rab2BV-like         202   1e-61   
ref|XP_006358708.1|  PREDICTED: ras-related protein Rab11A-like         202   1e-61   
ref|XP_009629737.1|  PREDICTED: ras-related protein Rab2BV-like         202   1e-61   
ref|XP_007264419.1|  ras-domain-containing protein                      202   1e-61   
ref|XP_004240383.1|  PREDICTED: ras-related protein Rab2BV              202   1e-61   
emb|CDO97631.1|  unnamed protein product                                202   1e-61   
ref|XP_004155229.1|  PREDICTED: ras-related protein RABA2a-like         202   1e-61   
gb|KHG00809.1|  Ras-related Rab11C                                      202   1e-61   
emb|CDX93495.1|  BnaA06g05530D                                          202   1e-61   
ref|XP_009149960.1|  PREDICTED: ras-related protein RABA2c              202   1e-61   
ref|XP_010256763.1|  PREDICTED: ras-related protein Rab11C              202   1e-61   
ref|NP_001240030.1|  uncharacterized protein LOC100797258               202   1e-61   
gb|EMT13645.1|  Ras-related protein Rab11C                              201   1e-61   
emb|CDX86101.1|  BnaC03g56160D                                          203   1e-61   
ref|XP_010681762.1|  PREDICTED: ras-related protein RABA2a              202   1e-61   
ref|XP_006361966.1|  PREDICTED: ras-related protein RABA2b-like         202   1e-61   
ref|XP_004235050.1|  PREDICTED: ras-related protein RABA2b-like         202   1e-61   
ref|XP_002892514.1|  hypothetical protein ARALYDRAFT_888208             202   1e-61   
emb|CDY50888.1|  BnaCnng19800D                                          202   1e-61   
gb|EMT12722.1|  Ras-related protein RABA2a                              202   1e-61   
ref|XP_011028371.1|  PREDICTED: ras-related protein RABA2a-like         202   1e-61   
ref|XP_006417553.1|  hypothetical protein EUTSA_v10008742mg             202   1e-61   
ref|XP_009148263.1|  PREDICTED: ras-related protein RABA2a              202   2e-61   
emb|CBI31604.3|  unnamed protein product                                202   2e-61   
ref|NP_172434.1|  RAB GTPase 11C                                        202   2e-61   
gb|ABK94045.1|  unknown                                                 202   2e-61   
gb|EPS29596.1|  hypothetical protein PDE_04546                          201   2e-61   
ref|XP_007205884.1|  hypothetical protein PRUPE_ppa011297mg             202   2e-61   
ref|XP_009404554.1|  PREDICTED: ras-related protein Rab2BV-like         201   2e-61   
ref|XP_006305601.1|  hypothetical protein CARUB_v10010267mg             202   2e-61   
ref|XP_011087655.1|  PREDICTED: ras-related protein RABA2a-like         201   2e-61   
gb|ACN27780.1|  unknown                                                 201   2e-61   
ref|XP_010490210.1|  PREDICTED: ras-related protein RABA2a isofor...    201   2e-61   
ref|XP_010926662.1|  PREDICTED: ras-related protein RABA4d-like         201   2e-61   
ref|XP_010541416.1|  PREDICTED: ras-related protein RABA2c-like         201   2e-61   
ref|XP_009412583.1|  PREDICTED: ras-related protein Rab11C              201   2e-61   
ref|XP_004230439.1|  PREDICTED: ras-related protein RABA2a              201   2e-61   
ref|XP_010458259.1|  PREDICTED: ras-related protein RABA2a-like         201   2e-61   
ref|XP_007720828.1|  Ras-like protein Rab-11B                           202   2e-61   
ref|XP_010227468.1|  PREDICTED: ras-related protein RABA3-like          202   2e-61   
ref|XP_009416218.1|  PREDICTED: ras-related protein Rab11C              201   2e-61   
gb|EYU35014.1|  hypothetical protein MIMGU_mgv1a013570mg                201   2e-61   
ref|XP_006349310.1|  PREDICTED: ras-related protein RABA2a-like         201   2e-61   
ref|XP_010544112.1|  PREDICTED: ras-related protein RABA2a              201   2e-61   
gb|KIV92614.1|  hypothetical protein PV10_03888                         201   2e-61   
ref|XP_009404938.1|  PREDICTED: ras-related protein RABA2a-like         201   2e-61   
gb|KIW68004.1|  hypothetical protein PV04_03980                         201   2e-61   
ref|XP_008726025.1|  hypothetical protein G647_03458                    201   2e-61   
ref|XP_008781983.1|  PREDICTED: ras-related protein RABA2a-like         201   2e-61   
ref|XP_002146308.1|  Ras GTPase Rab11, putative                         201   3e-61   
ref|XP_009364340.1|  PREDICTED: ras-related protein Rab11C              201   3e-61   



>ref|XP_004250110.1| PREDICTED: ras-related protein Rab11D [Solanum lycopersicum]
Length=224

 Score =   269 bits (688),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 134/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIMLIGNKTDL
Sbjct  120  DKNIVIMLIGNKTDL  134



>ref|XP_009798472.1| PREDICTED: ras-related protein Rab11D-like [Nicotiana sylvestris]
Length=224

 Score =   269 bits (688),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 134/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIMLIGNKTDL
Sbjct  120  DKNIVIMLIGNKTDL  134



>ref|XP_009620681.1| PREDICTED: ras-related protein Rab11D-like [Nicotiana tomentosiformis]
Length=224

 Score =   268 bits (684),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M SGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIMLIGNKTDL
Sbjct  120  DKNIVIMLIGNKTDL  134



>emb|CDP01498.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   267 bits (683),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIV++LIGNKTDL
Sbjct  120  DKNIVVILIGNKTDL  134



>emb|CBI33135.3| unnamed protein product [Vitis vinifera]
Length=195

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD++ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDSS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNKTDL
Sbjct  120  DKNIVIILIGNKTDL  134



>ref|XP_006353216.1| PREDICTED: ras-related protein Rab11D-like [Solanum tuberosum]
Length=224

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQ KSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQRKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIMLIGNKTDL
Sbjct  120  DKNIVIMLIGNKTDL  134



>gb|KDP29718.1| hypothetical protein JCGZ_18653 [Jatropha curcas]
Length=225

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK DL
Sbjct  120  DKNIVIILIGNKCDL  134



>ref|XP_002273530.1| PREDICTED: ras-related protein Rab11D [Vitis vinifera]
 emb|CAN70163.1| hypothetical protein VITISV_039255 [Vitis vinifera]
Length=226

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD++ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDSS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNKTDL
Sbjct  120  DKNIVIILIGNKTDL  134



>ref|XP_008440577.1| PREDICTED: ras-related protein Rab11A [Cucumis melo]
 ref|XP_008440578.1| PREDICTED: ras-related protein Rab11A [Cucumis melo]
 ref|XP_008440579.1| PREDICTED: ras-related protein Rab11A [Cucumis melo]
Length=227

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGA+GAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGALGAMLVYDITKRQTFDHIPRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_011100043.1| PREDICTED: ras-related protein Rab11D [Sesamum indicum]
Length=225

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MAS GGYGDA+ QK+DYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRTM
Sbjct  1    MASSGGYGDAS-QKVDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTM  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWL+ELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLDELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNKTDL
Sbjct  120  DKNIVIILIGNKTDL  134



>ref|XP_004143457.1| PREDICTED: ras-related protein Rab11A-like [Cucumis sativus]
 ref|XP_004160129.1| PREDICTED: ras-related protein Rab11A-like [Cucumis sativus]
 gb|KGN48734.1| hypothetical protein Csa_6G499780 [Cucumis sativus]
Length=226

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGA+GAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGALGAMLVYDITKRQTFDHIPRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_007205846.1| hypothetical protein PRUPE_ppa011070mg [Prunus persica]
 gb|EMJ07045.1| hypothetical protein PRUPE_ppa011070mg [Prunus persica]
Length=225

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD+  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDS-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR+HA
Sbjct  60   IIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_002307071.1| GTP-BINDING protein 3 [Populus trichocarpa]
 gb|ABK93073.1| unknown [Populus trichocarpa]
 gb|EEE94067.1| GTP-BINDING protein 3 [Populus trichocarpa]
Length=223

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_008235004.1| PREDICTED: ras-related protein Rab11A [Prunus mume]
Length=225

 Score =   265 bits (676),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD+  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDS-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR+HA
Sbjct  60   IIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_011022819.1| PREDICTED: ras-related protein Rab11D [Populus euphratica]
Length=223

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>gb|KHN44351.1| Ras-related protein Rab11A [Glycine soja]
Length=223

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_007047879.1| RAB GTPase A4A [Theobroma cacao]
 gb|EOX92036.1| RAB GTPase A4A [Theobroma cacao]
Length=225

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_002310552.1| GTP-BINDING protein 3 [Populus trichocarpa]
 gb|EEE91002.1| GTP-BINDING protein 3 [Populus trichocarpa]
Length=223

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>gb|EPS65006.1| hypothetical protein M569_09770 [Genlisea aurea]
Length=228

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA+ QK+DYVFKVVLIGDSAVGKSQIL+RFARNEF+LDSKATIGVEFQTRTM
Sbjct  1    MASGGGYGDAS-QKVDYVFKVVLIGDSAVGKSQILSRFARNEFTLDSKATIGVEFQTRTM  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIQHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_002531672.1| protein with unknown function [Ricinus communis]
 gb|EEF30716.1| protein with unknown function [Ricinus communis]
Length=225

 Score =   262 bits (670),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDQS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAILVYDITKRQTFDHIPRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK DL
Sbjct  120  DKNIVIILVGNKCDL  134



>ref|XP_010027921.1| PREDICTED: ras-related protein Rab11A [Eucalyptus grandis]
 gb|KCW54570.1| hypothetical protein EUGRSUZ_I00531 [Eucalyptus grandis]
Length=225

 Score =   262 bits (669),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDG-NQKIDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQ+FDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQSFDHIPRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNKTDL
Sbjct  120  DKNIVIILVGNKTDL  134



>gb|KJB40355.1| hypothetical protein B456_007G060000 [Gossypium raimondii]
Length=225

 Score =   262 bits (669),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDI+KRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDISKRQTFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>gb|KJB44099.1| hypothetical protein B456_007G234300 [Gossypium raimondii]
Length=225

 Score =   262 bits (669),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILLGNKSDL  134



>ref|XP_010106271.1| Ras-related protein Rab11D [Morus notabilis]
 gb|EXC09688.1| Ras-related protein Rab11D [Morus notabilis]
Length=227

 Score =   262 bits (669),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 1/132 (1%)
 Frame = +1

Query  169  GGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQ  348
            GGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++IQ
Sbjct  6    GGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIQ  64

Query  349  HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKN  528
            HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKN
Sbjct  65   HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKN  124

Query  529  IVIMLIGNKTDL  564
            IVI+LIGNKTDL
Sbjct  125  IVIILIGNKTDL  136



>gb|KHG10894.1| Ras-related protein Rab11A [Gossypium arboreum]
Length=225

 Score =   262 bits (669),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILLGNKSDL  134



>gb|KHG10895.1| Ras-related protein Rab11A [Gossypium arboreum]
Length=238

 Score =   262 bits (670),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILLGNKSDL  134



>ref|NP_001237375.1| uncharacterized protein LOC100527786 [Glycine max]
 gb|ACU16959.1| unknown [Glycine max]
Length=223

 Score =   261 bits (668),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGG YGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGSYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_004502410.1| PREDICTED: ras-related protein Rab11A-like [Cicer arietinum]
Length=223

 Score =   261 bits (668),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARN+FSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNDFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>gb|KJB44100.1| hypothetical protein B456_007G234300 [Gossypium raimondii]
Length=233

 Score =   261 bits (668),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILLGNKSDL  134



>ref|XP_006426348.1| hypothetical protein CICLE_v10026427mg [Citrus clementina]
 gb|ESR39588.1| hypothetical protein CICLE_v10026427mg [Citrus clementina]
 gb|KDO60714.1| hypothetical protein CISIN_1g027292mg [Citrus sinensis]
Length=225

 Score =   261 bits (668),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDI++RQ+FDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDISRRQSFDHIPRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_006394054.1| hypothetical protein EUTSA_v10004873mg [Eutrema salsugineum]
 gb|ESQ31340.1| hypothetical protein EUTSA_v10004873mg [Eutrema salsugineum]
Length=226

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAM+VYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMMVYDITRRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_009802845.1| PREDICTED: ras-related protein Rab11D [Nicotiana sylvestris]
Length=222

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASG  YGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  520  DKNIVIMLIGNKTDL  564
            D+NIVIMLIGNKTDL
Sbjct  118  DRNIVIMLIGNKTDL  132



>ref|XP_009591756.1| PREDICTED: ras-related protein Rab11D [Nicotiana tomentosiformis]
 dbj|BAH37015.1| NtRab11D [Nicotiana tabacum]
Length=222

 Score =   260 bits (664),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASG  YGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  520  DKNIVIMLIGNKTDL  564
            D+NIVIMLIGNKTDL
Sbjct  118  DRNIVIMLIGNKTDL  132



>ref|XP_007163663.1| hypothetical protein PHAVU_001G253300g [Phaseolus vulgaris]
 gb|ESW35657.1| hypothetical protein PHAVU_001G253300g [Phaseolus vulgaris]
Length=223

 Score =   260 bits (664),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MAS GGYGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASAGGYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+F+HIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFNHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>sp|Q40522.1|RB11D_TOBAC RecName: Full=Ras-related protein Rab11D [Nicotiana tabacum]
 gb|AAA74114.1| putative [Nicotiana tabacum]
Length=222

 Score =   259 bits (663),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 131/135 (97%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASG  YGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   AIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  520  DKNIVIMLIGNKTDL  564
            D+NIVIMLIGNKTDL
Sbjct  118  DRNIVIMLIGNKTDL  132



>gb|KFK28209.1| hypothetical protein AALP_AA8G486600 [Arabis alpina]
Length=226

 Score =   259 bits (662),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>gb|KHG08307.1| Ras-related Rab11A [Gossypium arboreum]
Length=224

 Score =   259 bits (661),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGY D   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYCDP-NQKIDYVFKVVLIGDSAVGKSQVLARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDI+KRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDISKRQTFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIV++LIGNK+DL
Sbjct  120  DKNIVVILIGNKSDL  134



>ref|XP_010267206.1| PREDICTED: ras-related protein Rab11A [Nelumbo nucifera]
Length=225

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 131/135 (97%), Gaps = 2/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGG YGDA  QKIDYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGG-YGDA-NQKIDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTL  58

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  59   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHA  118

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK DL
Sbjct  119  DKNIVIILIGNKCDL  133



>ref|XP_003552040.1| PREDICTED: ras-related protein Rab11A-like [Glycine max]
 gb|KHN31388.1| Ras-related protein Rab11A [Glycine soja]
Length=223

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASG  YGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGRSYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKS+KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>gb|AFK49375.1| unknown [Medicago truncatula]
Length=225

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKSTIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>gb|KEH20797.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=225

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKSTIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>sp|Q40191.1|RB11A_LOTJA RecName: Full=Ras-related protein Rab11A; Flags: Precursor [Lotus 
japonicus]
 emb|CAA98177.1| RAB11A [Lotus japonicus]
Length=226

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA   KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NAKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK DL
Sbjct  120  DKNIVIILIGNKCDL  134



>sp|Q40520.1|RB11C_TOBAC RecName: Full=Ras-related protein Rab11C [Nicotiana tabacum]
 gb|AAA74112.1| putative [Nicotiana tabacum]
Length=222

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 131/135 (97%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASG  YGDA+ QKIDYVFKVVLIGDSAVGK+QILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDAS-QKIDYVFKVVLIGDSAVGKTQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  520  DKNIVIMLIGNKTDL  564
            D+NIVIML GNKTDL
Sbjct  118  DRNIVIMLTGNKTDL  132



>ref|XP_006346741.1| PREDICTED: ras-related protein Rab11D-like [Solanum tuberosum]
Length=222

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASG  YGD++ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDSS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  520  DKNIVIMLIGNKTDL  564
            D+NIVI+LIGNKTDL
Sbjct  118  DRNIVIILIGNKTDL  132



>ref|XP_006281052.1| hypothetical protein CARUB_v10027070mg [Capsella rubella]
 ref|XP_010444544.1| PREDICTED: ras-related protein RABA4a [Camelina sativa]
 gb|EOA13950.1| hypothetical protein CARUB_v10027070mg [Capsella rubella]
Length=226

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|NP_201330.1| RAB GTPase homolog A4A [Arabidopsis thaliana]
 sp|Q9FJN8.1|RAA4A_ARATH RecName: Full=Ras-related protein RABA4a; Short=AtRABA4a [Arabidopsis 
thaliana]
 dbj|BAB11663.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AAK76621.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAL85040.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAM64565.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AED98031.1| RAB GTPase homolog A4A [Arabidopsis thaliana]
Length=226

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_002864949.1| hypothetical protein ARALYDRAFT_919858 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41208.1| hypothetical protein ARALYDRAFT_919858 [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_010484385.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=226

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_006466254.1| PREDICTED: ras-related protein Rab11A-like [Citrus sinensis]
Length=225

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDI++RQ+FDHI RWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDISRRQSFDHITRWLEELRSHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  120  DKNIVIILIGNKSDL  134



>ref|XP_011097540.1| PREDICTED: ras-related protein Rab11D-like [Sesamum indicum]
Length=225

 Score =   257 bits (656),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 2/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGG YGDA+ QKIDYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGG-YGDAS-QKIDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTL  58

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKR TFDHIPRWL+ELRAHA
Sbjct  59   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRTTFDHIPRWLDELRAHA  118

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNKTDL
Sbjct  119  DKNIVIILIGNKTDL  133



>ref|XP_010319241.1| PREDICTED: ras-related protein Rab11D-like [Solanum lycopersicum]
Length=222

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 132/135 (98%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASG  YGD++ QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDSS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  57

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  520  DKNIVIMLIGNKTDL  564
            D+NIVI+LIGNKTDL
Sbjct  118  DRNIVIILIGNKTDL  132



>ref|XP_009344449.1| PREDICTED: ras-related protein Rab11D [Pyrus x bretschneideri]
Length=222

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 1/131 (1%)
 Frame = +1

Query  172  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  351
              YGDA+ QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+LI+H
Sbjct  2    ASYGDAS-QKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLLIEH  60

Query  352  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  531
            KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNI
Sbjct  61   KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNI  120

Query  532  VIMLIGNKTDL  564
            VI+LIGNK+DL
Sbjct  121  VIILIGNKSDL  131



>dbj|BAA02110.1| GTP-binding protein [Pisum sativum]
 prf||2001457C GTP-binding protein
Length=225

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MA+ GGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MANSGGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKSTIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>gb|ACJ84079.1| unknown [Medicago truncatula]
Length=225

 Score =   254 bits (650),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARF+ NEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFSGNEFSLDSKSTIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>ref|XP_010926325.1| PREDICTED: ras-related protein Rab11D-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926326.1| PREDICTED: ras-related protein Rab11D-like isoform X2 [Elaeis 
guineensis]
Length=218

 Score =   254 bits (649),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 125/126 (99%), Gaps = 0/126 (0%)
 Frame = +1

Query  187  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  366
            A G+KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++IQHKSVKA
Sbjct  3    AGGEKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIQHKSVKA  62

Query  367  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  546
            QIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELR+HADKNIVIML+
Sbjct  63   QIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRSHADKNIVIMLV  122

Query  547  GNKTDL  564
            GNKTDL
Sbjct  123  GNKTDL  128



>ref|XP_004288173.1| PREDICTED: ras-related protein Rab11D [Fragaria vesca subsp. 
vesca]
Length=222

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 128/131 (98%), Gaps = 1/131 (1%)
 Frame = +1

Query  172  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  351
              YGD++ QKIDYVFK+VLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I+H
Sbjct  2    ASYGDSS-QKIDYVFKIVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIEH  60

Query  352  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  531
            KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNI
Sbjct  61   KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNI  120

Query  532  VIMLIGNKTDL  564
            VI+LIGNK+DL
Sbjct  121  VIILIGNKSDL  131



>ref|XP_010273010.1| PREDICTED: ras-related protein Rab11A-like [Nelumbo nucifera]
Length=225

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 129/135 (96%), Gaps = 2/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGG YGD + QKIDYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGG-YGDTS-QKIDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTL  58

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAML YDITKRQ+FDHIPRWLEELR HA
Sbjct  59   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLAYDITKRQSFDHIPRWLEELRGHA  118

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK DL
Sbjct  119  DKNIVIILIGNKCDL  133



>ref|XP_010463230.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=228

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +1

Query  163  ASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTML  342
            + GGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT++
Sbjct  3    SGGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLV  61

Query  343  IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHAD  522
            I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHAD
Sbjct  62   IDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHAD  121

Query  523  KNIVIMLIGNKTDL  564
            KNIVI+LIGNK+DL
Sbjct  122  KNIVIILIGNKSDL  135



>ref|XP_008381984.1| PREDICTED: ras-related protein Rab11D [Malus domestica]
Length=222

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 1/131 (1%)
 Frame = +1

Query  172  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  351
              YGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+LI+ 
Sbjct  2    ASYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLLIEX  60

Query  352  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  531
            KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNI
Sbjct  61   KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNI  120

Query  532  VIMLIGNKTDL  564
            VI+LIGNK+DL
Sbjct  121  VIILIGNKSDL  131



>gb|KJB40356.1| hypothetical protein B456_007G060000 [Gossypium raimondii]
Length=223

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 129/135 (96%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQE  RAVTSAYYRGAVGAMLVYDI+KRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQE--RAVTSAYYRGAVGAMLVYDISKRQTFDHIPRWLEELRGHA  117

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  118  DKNIVIILIGNKSDL  132



>gb|KFK25337.1| hypothetical protein AALP_AA8G099600 [Arabis alpina]
Length=222

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M SGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HA
Sbjct  60   VLDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>ref|XP_010680988.1| PREDICTED: ras-related protein Rab11D [Beta vulgaris subsp. vulgaris]
Length=222

 Score =   251 bits (642),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 128/131 (98%), Gaps = 1/131 (1%)
 Frame = +1

Query  172  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  351
             GYGDA+ QK+DYVFKVVLIGDSAVGKSQILARFAR+EFSLDSKATIGVEFQTRT++IQH
Sbjct  2    AGYGDAS-QKVDYVFKVVLIGDSAVGKSQILARFARDEFSLDSKATIGVEFQTRTLVIQH  60

Query  352  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  531
            KS+KAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTF+HIPRWLEELR HADKNI
Sbjct  61   KSIKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFEHIPRWLEELRGHADKNI  120

Query  532  VIMLIGNKTDL  564
            +IMLIGNK+DL
Sbjct  121  IIMLIGNKSDL  131



>ref|XP_002871417.1| hypothetical protein ARALYDRAFT_325580 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47676.1| hypothetical protein ARALYDRAFT_325580 [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR +A
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRNNA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>ref|XP_010519373.1| PREDICTED: ras-related protein RABA4a [Tarenaya hassleriana]
Length=225

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 1/133 (1%)
 Frame = +1

Query  166  SGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLI  345
            + GGYGD++  KIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT++I
Sbjct  2    TSGGYGDSSA-KIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLVI  60

Query  346  QHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADK  525
             HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADK
Sbjct  61   DHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADK  120

Query  526  NIVIMLIGNKTDL  564
            NIVI+LIGNK+DL
Sbjct  121  NIVIILIGNKSDL  133



>ref|XP_010453062.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=229

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>ref|XP_010422850.1| PREDICTED: ras-related protein RABA4a-like isoform X1 [Camelina 
sativa]
Length=228

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>gb|AAB97114.1| small GTP-binding protein, partial [Glycine max]
Length=222

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +1

Query  172  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  351
            GGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I H
Sbjct  1    GGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDH  59

Query  352  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  531
            K+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNI
Sbjct  60   KTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNI  119

Query  532  VIMLIGNKTDL  564
            VI+L GNK DL
Sbjct  120  VIILTGNKCDL  130



>ref|XP_003601931.1| GTP-binding protein [Medicago truncatula]
 gb|AES72182.1| RAB GTPase-like protein A1D [Medicago truncatula]
 gb|AFK47317.1| unknown [Medicago truncatula]
Length=222

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 129/135 (96%), Gaps = 2/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MAS G YGDA  QKIDYVFKVVLIGDSAVGKSQILARFARN+FS+DSKATIGVEFQTRT+
Sbjct  1    MASAG-YGDA-NQKIDYVFKVVLIGDSAVGKSQILARFARNDFSMDSKATIGVEFQTRTL  58

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKR +FDHIPRWLEELR HA
Sbjct  59   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRPSFDHIPRWLEELRNHA  118

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  119  DKNIVIILIGNKSDL  133



>ref|XP_010917311.1| PREDICTED: ras-related protein Rab11D-like [Elaeis guineensis]
Length=218

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 125/126 (99%), Gaps = 0/126 (0%)
 Frame = +1

Query  187  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  366
            A G+KIDYVFKVVLIGDSAVGKSQILARFAR+EFSLDSKATIGVEFQTRT++IQHKSVKA
Sbjct  3    AVGEKIDYVFKVVLIGDSAVGKSQILARFARDEFSLDSKATIGVEFQTRTLVIQHKSVKA  62

Query  367  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  546
            QIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQ+FDHIPRWLEELR+HADKNIVIML+
Sbjct  63   QIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQSFDHIPRWLEELRSHADKNIVIMLV  122

Query  547  GNKTDL  564
            GNK+DL
Sbjct  123  GNKSDL  128



>ref|XP_006290108.1| hypothetical protein CARUB_v10003752mg [Capsella rubella]
 gb|EOA23006.1| hypothetical protein CARUB_v10003752mg [Capsella rubella]
Length=226

 Score =   249 bits (637),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T++QTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRQQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>ref|XP_010491702.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=228

 Score =   249 bits (636),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M SGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  120  DKNIVIILVGNKSDL  134



>ref|XP_008782165.1| PREDICTED: ras-related protein Rab11D-like [Phoenix dactylifera]
Length=218

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = +1

Query  187  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  366
            A G+KIDYVFKVVLIGDSAVGKSQILARFARNEFS+DSKATIGVEFQTRT++IQHKSVKA
Sbjct  3    AGGEKIDYVFKVVLIGDSAVGKSQILARFARNEFSIDSKATIGVEFQTRTLVIQHKSVKA  62

Query  367  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  546
            QIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKR +FDHIPRWLEELR+HADKNIVIML+
Sbjct  63   QIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRPSFDHIPRWLEELRSHADKNIVIMLV  122

Query  547  GNKTDL  564
            GNK+DL
Sbjct  123  GNKSDL  128



>ref|XP_006404694.1| hypothetical protein EUTSA_v10000314mg [Eutrema salsugineum]
 gb|ESQ46147.1| hypothetical protein EUTSA_v10000314mg [Eutrema salsugineum]
Length=227

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MA GGGY  A+  K+DYVFKVVLIGDSAVGKSQ+LARF R+EFS+DSKATIGVEFQTRT+
Sbjct  1    MAGGGGYNGASPGKVDYVFKVVLIGDSAVGKSQLLARFTRDEFSMDSKATIGVEFQTRTL  60

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I  KS+KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKR++FDHIPRWLEELRAHA
Sbjct  61   VIDEKSIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRESFDHIPRWLEELRAHA  120

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  121  DKNIVIILIGNKSDL  135



>ref|XP_006404948.1| hypothetical protein EUTSA_v10000315mg [Eutrema salsugineum]
 gb|ESQ46401.1| hypothetical protein EUTSA_v10000315mg [Eutrema salsugineum]
Length=225

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 1/131 (1%)
 Frame = +1

Query  172  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  351
            GGYG A G K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ 
Sbjct  3    GGYGGATG-KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEE  61

Query  352  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  531
            KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNI
Sbjct  62   KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNI  121

Query  532  VIMLIGNKTDL  564
            VI+LIGNK+DL
Sbjct  122  VIILIGNKSDL  132



>ref|XP_003573862.1| PREDICTED: ras-related protein Rab11D-like [Brachypodium distachyon]
Length=216

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  187  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  366
            A G K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+LI HKSVKA
Sbjct  2    AGGDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLLIDHKSVKA  61

Query  367  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  546
            QIWDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+
Sbjct  62   QIWDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLV  121

Query  547  GNKTDL  564
            GNK+DL
Sbjct  122  GNKSDL  127



>ref|XP_009393549.1| PREDICTED: ras-related protein Rab11D-like [Musa acuminata subsp. 
malaccensis]
Length=219

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 125/135 (93%), Gaps = 6/135 (4%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MA GG        KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MAGGGS------DKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  54

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA++VYDIT+RQ FDHIPRWLEELR+HA
Sbjct  55   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALIVYDITRRQCFDHIPRWLEELRSHA  114

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIML+GNKTDL
Sbjct  115  DKNIVIMLVGNKTDL  129



>ref|XP_009390909.1| PREDICTED: ras-related protein Rab11D-like [Musa acuminata subsp. 
malaccensis]
Length=219

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 127/135 (94%), Gaps = 6/135 (4%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MA GG       +KIDYVFKVVLIGDSAVGKSQILARFAR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MAGGGS------EKIDYVFKVVLIGDSAVGKSQILARFARDEFSLDSKATIGVEFQTRTL  54

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYD+TKRQ+FDHIPRWLEELR+HA
Sbjct  55   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDVTKRQSFDHIPRWLEELRSHA  114

Query  520  DKNIVIMLIGNKTDL  564
            D+NIVIML+GNKTDL
Sbjct  115  DRNIVIMLVGNKTDL  129



>ref|XP_010523299.1| PREDICTED: ras-related protein RABA4a-like [Tarenaya hassleriana]
Length=227

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 2/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGG YGD +  KIDYVFK+VLIGDSAVGKSQILAR+ARNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGG-YGDPSA-KIDYVFKMVLIGDSAVGKSQILARYARNEFSLDSKSTIGVEFQTRTL  58

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTF+HIPRWLEELRAHA
Sbjct  59   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFEHIPRWLEELRAHA  118

Query  520  DKNIVIMLIGNKTDL  564
            D+NIVI+LIGNK+DL
Sbjct  119  DENIVIILIGNKSDL  133



>ref|NP_001064476.1| Os10g0377400 [Oryza sativa Japonica Group]
 gb|ABB47387.1| Ras-related protein Rab11D, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26390.1| Os10g0377400 [Oryza sativa Japonica Group]
 dbj|BAG99455.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC66844.1| hypothetical protein OsI_33317 [Oryza sativa Indica Group]
 gb|EEE50861.1| hypothetical protein OsJ_31310 [Oryza sativa Japonica Group]
Length=216

 Score =   247 bits (631),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +1

Query  187  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  366
            A G+K+DYVFKVVLIGDSAVGKSQILARFARNEFS+DSKATIGVEFQTRT+LI HKSVKA
Sbjct  2    AGGEKVDYVFKVVLIGDSAVGKSQILARFARNEFSIDSKATIGVEFQTRTLLIDHKSVKA  61

Query  367  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  546
            QIWDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+
Sbjct  62   QIWDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLV  121

Query  547  GNKTDL  564
            GNK+DL
Sbjct  122  GNKSDL  127



>ref|XP_006827843.1| hypothetical protein AMTR_s00008p00026380 [Amborella trichopoda]
 gb|ERM95259.1| hypothetical protein AMTR_s00008p00026380 [Amborella trichopoda]
Length=221

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  369
              QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++IQHK+VKAQ
Sbjct  5    PSQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIQHKTVKAQ  64

Query  370  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  549
            IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+PRWLEELR HADKNIVI+LIG
Sbjct  65   IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVPRWLEELRGHADKNIVIILIG  124

Query  550  NKTDL  564
            NK+DL
Sbjct  125  NKSDL  129



>ref|XP_009122063.1| PREDICTED: ras-related protein RABA4a-like [Brassica rapa]
 gb|AAZ67615.1| 80A08_30 [Brassica rapa subsp. pekinensis]
 emb|CDX96994.1| BnaC09g46310D [Brassica napus]
Length=223

 Score =   246 bits (629),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 1/133 (1%)
 Frame = +1

Query  166  SGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLI  345
            S GGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+++
Sbjct  2    SSGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTLVM  60

Query  346  QHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADK  525
             HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HADK
Sbjct  61   DHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHADK  120

Query  526  NIVIMLIGNKTDL  564
            NIVI+L+GNK+DL
Sbjct  121  NIVIILVGNKSDL  133



>emb|CDX69843.1| BnaA10g21920D [Brassica napus]
Length=223

 Score =   246 bits (629),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 1/133 (1%)
 Frame = +1

Query  166  SGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLI  345
            S GGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+++
Sbjct  2    SSGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTLVM  60

Query  346  QHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADK  525
             HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HADK
Sbjct  61   DHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHADK  120

Query  526  NIVIMLIGNKTDL  564
            NIVI+L+GNK+DL
Sbjct  121  NIVIILVGNKSDL  133



>ref|XP_003577923.1| PREDICTED: ras-related protein RGP1 [Brachypodium distachyon]
 ref|XP_010238009.1| PREDICTED: ras-related protein RGP1 [Brachypodium distachyon]
Length=226

 Score =   246 bits (628),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M+ GGGYG+  GQ+IDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MSRGGGYGEV-GQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             +  +++KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELRAHA
Sbjct  60   QVDQRTIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHMARWLEELRAHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKN+VIMLIGNK+DL
Sbjct  120  DKNLVIMLIGNKSDL  134



>ref|XP_006399529.1| hypothetical protein EUTSA_v10014596mg [Eutrema salsugineum]
 gb|ESQ40982.1| hypothetical protein EUTSA_v10014596mg [Eutrema salsugineum]
Length=225

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 129/135 (96%), Gaps = 2/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGG YGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFS+DSKATIGVEFQTRT+
Sbjct  1    MASGG-YGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSMDSKATIGVEFQTRTL  58

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HA
Sbjct  59   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHA  118

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+LIGNK+DL
Sbjct  119  DKNIVIILIGNKSDL  133



>ref|XP_004985399.1| PREDICTED: ras-related protein Rab11D-like [Setaria italica]
Length=217

 Score =   245 bits (626),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  369
            AG+K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I H+SVKAQ
Sbjct  4    AGEKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHRSVKAQ  63

Query  370  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  549
            IWDTAGQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+G
Sbjct  64   IWDTAGQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVG  123

Query  550  NKTDL  564
            NK+DL
Sbjct  124  NKSDL  128



>ref|NP_001149604.1| LOC100283230 [Zea mays]
 ref|XP_008643733.1| PREDICTED: LOC100283230 isoform X1 [Zea mays]
 gb|ACG36036.1| ras-related protein Rab11D [Zea mays]
 gb|ACN35232.1| unknown [Zea mays]
 gb|AFW68869.1| Ras protein Rab11D [Zea mays]
Length=217

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
            G K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I+HKSVKAQI
Sbjct  5    GDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIEHKSVKAQI  64

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GN
Sbjct  65   WDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGN  124

Query  553  KTDL  564
            K+DL
Sbjct  125  KSDL  128



>ref|XP_007159716.1| hypothetical protein PHAVU_002G261400g [Phaseolus vulgaris]
 gb|ESW31710.1| hypothetical protein PHAVU_002G261400g [Phaseolus vulgaris]
Length=229

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT+LI HK+VKAQI
Sbjct  14   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLLIDHKTVKAQI  73

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGN
Sbjct  74   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGN  133

Query  553  KTDL  564
            K DL
Sbjct  134  KCDL  137



>ref|XP_006662306.1| PREDICTED: ras-related protein Rab11D-like [Oryza brachyantha]
Length=214

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
            G+K+DYVFKVVLIGDSAVGKSQILARFARNEFS+DSKATIGVEFQTRT++I HKSVKAQI
Sbjct  2    GKKVDYVFKVVLIGDSAVGKSQILARFARNEFSIDSKATIGVEFQTRTLIIDHKSVKAQI  61

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GN
Sbjct  62   WDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGN  121

Query  553  KTDL  564
            K+DL
Sbjct  122  KSDL  125



>ref|XP_002489255.1| hypothetical protein SORBIDRAFT_0012s021070 [Sorghum bicolor]
 gb|EES20260.1| hypothetical protein SORBIDRAFT_0012s021070 [Sorghum bicolor]
Length=217

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
            G K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I HKSVKAQI
Sbjct  5    GDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHKSVKAQI  64

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GN
Sbjct  65   WDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGN  124

Query  553  KTDL  564
            K+DL
Sbjct  125  KSDL  128



>ref|NP_001151068.1| ras-related protein Rab11D [Zea mays]
 ref|NP_001152898.1| uncharacterized protein LOC100272235 [Zea mays]
 gb|ACF82205.1| unknown [Zea mays]
 gb|ACG41502.1| ras-related protein Rab11D [Zea mays]
 gb|AFW89417.1| Ras protein Rab11D [Zea mays]
Length=217

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  369
            AG K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I H+SVKAQ
Sbjct  4    AGDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHRSVKAQ  63

Query  370  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  549
            IWDTAGQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+G
Sbjct  64   IWDTAGQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVG  123

Query  550  NKTDL  564
            NK+DL
Sbjct  124  NKSDL  128



>ref|NP_001151560.1| ras-related protein Rab11D [Zea mays]
 gb|ACF88435.1| unknown [Zea mays]
 gb|ACG43327.1| ras-related protein Rab11D [Zea mays]
 tpg|DAA43812.1| TPA: Ras protein Rab11D [Zea mays]
Length=217

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  369
            AG K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I H+SVKAQ
Sbjct  4    AGDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHRSVKAQ  63

Query  370  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  549
            IWDTAGQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+G
Sbjct  64   IWDTAGQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVG  123

Query  550  NKTDL  564
            NK+DL
Sbjct  124  NKSDL  128



>emb|CDX81274.1| BnaC09g06850D [Brassica napus]
Length=227

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  369
              QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT++I HKSVKAQ
Sbjct  14   PSQKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLVIDHKSVKAQ  73

Query  370  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  549
            IWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIG
Sbjct  74   IWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIG  133

Query  550  NKTDL  564
            NK+DL
Sbjct  134  NKSDL  138



>ref|XP_002465727.1| hypothetical protein SORBIDRAFT_01g044550 [Sorghum bicolor]
 gb|EER92725.1| hypothetical protein SORBIDRAFT_01g044550 [Sorghum bicolor]
Length=217

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  369
            AG K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I H+SVKAQ
Sbjct  4    AGDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHRSVKAQ  63

Query  370  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  549
            IWDTAGQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+G
Sbjct  64   IWDTAGQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVG  123

Query  550  NKTDL  564
            NK+DL
Sbjct  124  NKSDL  128



>ref|XP_009112174.1| PREDICTED: ras-related protein RABA4a [Brassica rapa]
 emb|CDY18682.1| BnaA09g07130D [Brassica napus]
Length=225

 Score =   244 bits (623),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  369
              QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT++I HKSVKAQ
Sbjct  12   PSQKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLVIDHKSVKAQ  71

Query  370  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  549
            IWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIG
Sbjct  72   IWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIG  131

Query  550  NKTDL  564
            NK+DL
Sbjct  132  NKSDL  136



>emb|CDP07731.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   244 bits (623),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  169  GGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQ  348
            GGG G    QKIDYVFK+VLIGDS+VGKSQ+LARF+RNEFSLDSKATIGVEFQTRT++I 
Sbjct  6    GGGGGANLNQKIDYVFKIVLIGDSSVGKSQLLARFSRNEFSLDSKATIGVEFQTRTVVID  65

Query  349  HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKN  528
            HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKN
Sbjct  66   HKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKN  125

Query  529  IVIMLIGNKTDL  564
            IVIML+GNKTDL
Sbjct  126  IVIMLVGNKTDL  137



>ref|XP_006660497.1| PREDICTED: ras-related protein RGP1-like [Oryza brachyantha]
Length=226

 Score =   244 bits (622),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M+ GG YG+  GQKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGSYGEV-GQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  60   QIDARTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVTRWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIMLIGNK+DL
Sbjct  120  DKNIVIMLIGNKSDL  134



>gb|KHN29041.1| Ras-related protein Rab11A [Glycine soja]
Length=227

 Score =   244 bits (622),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I HK+VKAQI
Sbjct  12   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQI  71

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGN
Sbjct  72   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGN  131

Query  553  KTDL  564
            K DL
Sbjct  132  KCDL  135



>ref|XP_003532818.1| PREDICTED: ras-related protein Rab11A-like [Glycine max]
Length=209

 Score =   243 bits (620),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I HK+VKAQI
Sbjct  12   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQI  71

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGN
Sbjct  72   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGN  131

Query  553  KTDL  564
            K DL
Sbjct  132  KCDL  135



>dbj|BAJ93377.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            +K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I HKSVKAQIW
Sbjct  5    EKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHKSVKAQIW  64

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNI+IML+GNK
Sbjct  65   DTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIIIMLVGNK  124

Query  556  TDL  564
            +DL
Sbjct  125  SDL  127



>ref|XP_004983071.1| PREDICTED: ras-related protein Rab11D-like [Setaria italica]
Length=217

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I HKSVKAQIWD
Sbjct  7    KVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHKSVKAQIWD  66

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+
Sbjct  67   TAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKS  126

Query  559  DL  564
            DL
Sbjct  127  DL  128



>ref|XP_004504100.1| PREDICTED: ras-related protein Rab11A-like [Cicer arietinum]
Length=227

 Score =   242 bits (618),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  369
            A Q+IDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSK+TIGVEFQTRT++I HK+VKAQ
Sbjct  11   ANQRIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQ  70

Query  370  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  549
            IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L G
Sbjct  71   IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILAG  130

Query  550  NKTDL  564
            NK+DL
Sbjct  131  NKSDL  135



>ref|XP_009413627.1| PREDICTED: ras-related protein Rab11D-like [Musa acuminata subsp. 
malaccensis]
Length=218

 Score =   242 bits (617),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++IQHKSVKAQIWD
Sbjct  7    KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIQHKSVKAQIWD  66

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGA++VYDIT+RQ+FDHI RWLEELR+HAD+NIVIML+GNKT
Sbjct  67   TAGQERYRAVTSAYYRGAVGALMVYDITRRQSFDHISRWLEELRSHADRNIVIMLVGNKT  126

Query  559  DL  564
            DL
Sbjct  127  DL  128



>ref|XP_003525046.1| PREDICTED: ras-related protein Rab11A [Glycine max]
 gb|KHN06562.1| Ras-related protein Rab11A [Glycine soja]
Length=229

 Score =   242 bits (617),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I HK+VKAQI
Sbjct  14   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQI  73

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L GN
Sbjct  74   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILTGN  133

Query  553  KTDL  564
            K DL
Sbjct  134  KCDL  137



>gb|ABK22282.1| unknown [Picea sitchensis]
Length=219

 Score =   241 bits (615),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            KIDYVFKVVLIGDSAVGKSQIL+RFAR+EFSLDSKATIGVEFQTRT++I+HKSVKAQIWD
Sbjct  6    KIDYVFKVVLIGDSAVGKSQILSRFARDEFSLDSKATIGVEFQTRTVVIEHKSVKAQIWD  65

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+PRWLEELR HAD NIVIML+GNK 
Sbjct  66   TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVPRWLEELRNHADNNIVIMLVGNKC  125

Query  559  DL  564
            DL
Sbjct  126  DL  127



>gb|ACU16457.1| unknown [Glycine max]
Length=229

 Score =   241 bits (616),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I HK+VKAQI
Sbjct  14   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQI  73

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L GN
Sbjct  74   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILTGN  133

Query  553  KTDL  564
            K DL
Sbjct  134  KCDL  137



>ref|XP_009799541.1| PREDICTED: ras-related protein RGP1-like [Nicotiana sylvestris]
 ref|XP_009799542.1| PREDICTED: ras-related protein RGP1-like [Nicotiana sylvestris]
Length=225

 Score =   241 bits (615),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG    QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGGDFNQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSLDSKATIGVEFQTRTLDIDHKT  64

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVI  124

Query  538  MLIGNKTDL  564
            ML+GNKTDL
Sbjct  125  MLVGNKTDL  133



>sp|P25766.2|RLGP1_ORYSJ RecName: Full=Ras-related protein RGP1; AltName: Full=GTP-binding 
regulatory protein RGP1 [Oryza sativa Japonica Group]
 dbj|BAD29646.1| putative ras-related GTP-binding protein [Oryza sativa Japonica 
Group]
 gb|EEE69346.1| hypothetical protein OsJ_28668 [Oryza sativa Japonica Group]
Length=226

 Score =   241 bits (615),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M+ GGG     GQKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGGSYGEVGQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTL  60

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  61   HIDARTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  120

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIMLIGNK+DL
Sbjct  121  DKNIVIMLIGNKSDL  135



>gb|ABK25126.1| unknown [Picea sitchensis]
Length=224

 Score =   241 bits (615),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +1

Query  172  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  351
            G YGD  G +IDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT++I H
Sbjct  3    GSYGDY-GPRIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTLVIDH  61

Query  352  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  531
            K+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWLEELR HAD NI
Sbjct  62   KTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVARWLEELRGHADNNI  121

Query  532  VIMLIGNKTDL  564
            VIMLIGNK DL
Sbjct  122  VIMLIGNKCDL  132



>ref|XP_010422851.1| PREDICTED: ras-related protein RABA4a-like isoform X2 [Camelina 
sativa]
Length=226

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 128/135 (95%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            ++ HKSVKAQIWDTAGQE  RAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQE--RAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  117

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  118  DKNIVIILVGNKSDL  132



>gb|EYU27083.1| hypothetical protein MIMGU_mgv1a013266mg [Erythranthe guttata]
Length=225

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG   G KIDYVFK+VLIGDSAVGKSQ+LARF+RNEFSLDSKATIGVEFQTRT  I HK+
Sbjct  5    YGGDFGNKIDYVFKIVLIGDSAVGKSQLLARFSRNEFSLDSKATIGVEFQTRTTTIDHKT  64

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR+HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRSHADKNIVI  124

Query  538  MLIGNKTDL  564
            ML+GNK+DL
Sbjct  125  MLVGNKSDL  133



>ref|XP_010555372.1| PREDICTED: ras-related protein RABA4b [Tarenaya hassleriana]
Length=224

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I HKSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIDHKSVKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYDITKR+TF+HIPRWLEELRAHADKNIVI+L+GNKT
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDITKRETFEHIPRWLEELRAHADKNIVIILVGNKT  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>ref|XP_009129562.1| PREDICTED: ras-related protein RABA4b [Brassica rapa]
 ref|XP_009129608.1| PREDICTED: ras-related protein RABA4b [Brassica rapa]
Length=223

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFSLDSKATIGVEFQTRT+ I+ KSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSLDSKATIGVEFQTRTLTIEEKSVKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>ref|XP_002459958.1| hypothetical protein SORBIDRAFT_02g018890 [Sorghum bicolor]
 gb|EER96479.1| hypothetical protein SORBIDRAFT_02g018890 [Sorghum bicolor]
Length=226

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M+ GG +G+  GQ+IDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGSHGEL-GQRIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  60   NIDARTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIMLIGNK+DL
Sbjct  120  DKNIVIMLIGNKSDL  134



>gb|KFK30576.1| hypothetical protein AALP_AA7G279800 [Arabis alpina]
Length=223

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIESKSVKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>ref|XP_009612391.1| PREDICTED: ras-related protein RGP1-like [Nicotiana tomentosiformis]
Length=225

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG    QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEF+LDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGGDFNQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFNLDSKATIGVEFQTRTLDIDHKT  64

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVI  124

Query  538  MLIGNKTDL  564
            ML+GNKTDL
Sbjct  125  MLVGNKTDL  133



>ref|XP_006366509.1| PREDICTED: ras-related protein RGP1-like [Solanum tuberosum]
Length=226

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG    QKIDYVFK VLIGDSAVGKSQ+LARF+RNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGGDFNQKIDYVFKAVLIGDSAVGKSQLLARFSRNEFSLDSKATIGVEFQTRTLEIDHKT  64

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HADKNIVI
Sbjct  65   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELRGHADKNIVI  124

Query  538  MLIGNKTDL  564
            ML+GNKTDL
Sbjct  125  MLVGNKTDL  133



>ref|XP_010102630.1| Ras-related protein RGP1 [Morus notabilis]
 gb|EXB93780.1| Ras-related protein RGP1 [Morus notabilis]
Length=224

 Score =   239 bits (611),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T+LI HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTLLIDHKTIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>gb|EYU39898.1| hypothetical protein MIMGU_mgv1a020125mg [Erythranthe guttata]
Length=225

 Score =   239 bits (610),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG    QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T+LI HK+
Sbjct  5    YGGDFNQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLLIDHKT  64

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  124

Query  538  MLIGNKTDL  564
            MLIGNK+DL
Sbjct  125  MLIGNKSDL  133



>gb|KJB18227.1| hypothetical protein B456_003G040900 [Gossypium raimondii]
Length=223

 Score =   238 bits (608),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QK+DYVFKVVLIGDS VGKSQILARFARN+FSLDSK+TIGVEFQTRT+LI+HKSVKAQIW
Sbjct  8    QKVDYVFKVVLIGDSGVGKSQILARFARNDFSLDSKSTIGVEFQTRTLLIEHKSVKAQIW  67

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGA GAMLVYD+TKRQTF+HI RWLEELR HADKNIVIML+GNK
Sbjct  68   DTAGQERYRAVTSAYYRGAAGAMLVYDVTKRQTFNHIARWLEELRGHADKNIVIMLVGNK  127

Query  556  TDL  564
            +DL
Sbjct  128  SDL  130



>ref|XP_010067891.1| PREDICTED: ras-related protein RABA4c-like [Eucalyptus grandis]
 gb|KCW66128.1| hypothetical protein EUGRSUZ_G03398 [Eucalyptus grandis]
Length=224

 Score =   238 bits (608),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             Q IDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+LI HK++KAQI
Sbjct  9    NQNIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLLIDHKTIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HADKNIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELRGHADKNIVIMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_010928849.1| PREDICTED: ras-related protein RGP1 [Elaeis guineensis]
Length=225

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG+   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGEF-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTLTIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            +KAQIWDTAGQERYRAVTSAYYRGAVGA+LVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDMTKRQSFDHVTRWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK+DL
Sbjct  124  MLIGNKSDL  132



>ref|XP_008787280.1| PREDICTED: ras-related protein RGP1 [Phoenix dactylifera]
Length=224

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG+   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGEF-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTLTIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK+DL
Sbjct  124  MLIGNKSDL  132



>ref|XP_010265793.1| PREDICTED: ras-related protein RGP1-like [Nelumbo nucifera]
Length=223

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG+   QKIDYVFKVVLIGDSAVGKSQ+LAR+ARNEFSLDSKATIGVEFQTRT++I HK+
Sbjct  5    YGEF-NQKIDYVFKVVLIGDSAVGKSQLLARYARNEFSLDSKATIGVEFQTRTLVIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVTRWLDELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK+DL
Sbjct  124  MLIGNKSDL  132



>gb|KHG00253.1| Ras-related Rab11A [Gossypium arboreum]
Length=223

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QK+DYVFKVVLIGDS VGKSQILARFARN+FSLDSK+TIGVEFQTRT+LI+HKSVKAQIW
Sbjct  8    QKVDYVFKVVLIGDSGVGKSQILARFARNDFSLDSKSTIGVEFQTRTLLIEHKSVKAQIW  67

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGA GAMLVYD+TKRQTF+HI RWLEELR HADKNIVIML+GNK
Sbjct  68   DTAGQERYRAVTSAYYRGAAGAMLVYDVTKRQTFNHIARWLEELRGHADKNIVIMLVGNK  127

Query  556  TDL  564
            +DL
Sbjct  128  SDL  130



>ref|XP_004229604.1| PREDICTED: ras-related protein RGP1 [Solanum lycopersicum]
Length=225

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG    QKIDYVFK VLIGDSAVGKSQ+LARF+RNEFSLDSKATIGVEFQTRT+ I +K+
Sbjct  5    YGGDFNQKIDYVFKAVLIGDSAVGKSQLLARFSRNEFSLDSKATIGVEFQTRTLEIDNKT  64

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HADKNIVI
Sbjct  65   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELRGHADKNIVI  124

Query  538  MLIGNKTDL  564
            ML+GNKTDL
Sbjct  125  MLVGNKTDL  133



>ref|XP_011087327.1| PREDICTED: ras-related protein RGP1 [Sesamum indicum]
Length=224

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            +G     KIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDS++TIGVEFQTRT++I HKS
Sbjct  5    HGGDFSNKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSRSTIGVEFQTRTLMIDHKS  64

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVI  124

Query  538  MLIGNKTDL  564
            ML+GNK+DL
Sbjct  125  MLVGNKSDL  133



>ref|XP_010913931.1| PREDICTED: ras-related protein RGP1-like [Elaeis guineensis]
Length=224

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG+   Q+IDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGEF-NQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTLAIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVARWLDELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK+DL
Sbjct  124  MLIGNKSDL  132



>tpg|DAA39806.1| TPA: ras protein RGP1 [Zea mays]
Length=226

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M+ GG +G+  GQ+IDYVFKVVLIGDSAVGKSQ+LARFARN+F+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGSHGEL-GQRIDYVFKVVLIGDSAVGKSQLLARFARNQFNLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  60   NIDARNVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIML+GNK+DL
Sbjct  120  DKNIVIMLMGNKSDL  134



>ref|XP_010446581.1| PREDICTED: ras-related protein RABA4b-like [Camelina sativa]
Length=227

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEQKSIKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>gb|EMT23732.1| Ras-related protein RGP1 [Aegilops tauschii]
Length=217

 Score =   236 bits (603),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
            GQKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+ I +++VKAQI
Sbjct  2    GQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLQIDNRTVKAQI  61

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR+HADKNIVIMLIGN
Sbjct  62   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRSHADKNIVIMLIGN  121

Query  553  KTDL  564
            K+DL
Sbjct  122  KSDL  125



>ref|XP_009590361.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana tomentosiformis]
Length=224

 Score =   237 bits (604),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I HK+
Sbjct  5    YGDY-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLIIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLI NK DL
Sbjct  124  MLIANKCDL  132



>ref|XP_002863846.1| small molecular weight G-protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40105.1| small molecular weight G-protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=223

 Score =   237 bits (604),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNK  129

Query  556  TDL  564
            TDL
Sbjct  130  TDL  132



>ref|XP_010437126.1| PREDICTED: ras-related protein RABA4b [Camelina sativa]
Length=227

 Score =   237 bits (604),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEQKSIKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>ref|XP_002298447.1| GTP-binding family protein [Populus trichocarpa]
 gb|EEE83252.1| GTP-binding family protein [Populus trichocarpa]
Length=225

 Score =   237 bits (604),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I HK+VKAQI
Sbjct  10   NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLVIDHKTVKAQI  69

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HAD NIVIMLIGN
Sbjct  70   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELRDHADNNIVIMLIGN  129

Query  553  KTDL  564
            K+DL
Sbjct  130  KSDL  133



>ref|XP_002264293.1| PREDICTED: ras-related protein RGP1 [Vitis vinifera]
 emb|CBI24856.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   237 bits (604),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T++I HK+VKAQIW
Sbjct  11   QKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTLVIDHKTVKAQIW  70

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWL+ELR HADKNIVIML+GNK
Sbjct  71   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLQELRGHADKNIVIMLVGNK  130

Query  556  TDL  564
            +DL
Sbjct  131  SDL  133



>ref|XP_004956465.1| PREDICTED: ras-related protein RGP1-like [Setaria italica]
Length=222

 Score =   236 bits (603),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
            GQKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQTRT+ I  ++VKAQI
Sbjct  7    GQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTLTIDKRTVKAQI  66

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGN
Sbjct  67   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVVRWLEELRGHADKNIVIMLIGN  126

Query  553  KTDL  564
            K+DL
Sbjct  127  KSDL  130



>ref|XP_006284416.1| hypothetical protein CARUB_v10005586mg, partial [Capsella rubella]
 gb|EOA17314.1| hypothetical protein CARUB_v10005586mg, partial [Capsella rubella]
Length=250

 Score =   238 bits (606),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KS+KAQIWD
Sbjct  36   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEQKSIKAQIWD  95

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  96   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  155

Query  559  DL  564
            DL
Sbjct  156  DL  157



>ref|XP_011025048.1| PREDICTED: ras-related protein RABA4d [Populus euphratica]
Length=225

 Score =   236 bits (603),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I HK+VKAQI
Sbjct  10   NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLVIDHKTVKAQI  69

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HAD NIVIMLIGN
Sbjct  70   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELRDHADNNIVIMLIGN  129

Query  553  KTDL  564
            K+DL
Sbjct  130  KSDL  133



>ref|XP_007028923.1| RAB GTPase A4D [Theobroma cacao]
 gb|EOY09425.1| RAB GTPase A4D [Theobroma cacao]
Length=222

 Score =   236 bits (602),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T+ I HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLAIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_010257365.1| PREDICTED: ras-related protein RABA4d [Nelumbo nucifera]
 ref|XP_010257366.1| PREDICTED: ras-related protein RABA4d [Nelumbo nucifera]
 ref|XP_010257367.1| PREDICTED: ras-related protein RABA4d [Nelumbo nucifera]
Length=223

 Score =   236 bits (602),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 124/129 (96%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG+   QKIDYVFKVVLIGDSAVGKSQ+LAR+ARNEFSLDSKATIGVEFQTRT++I HK+
Sbjct  5    YGEF-NQKIDYVFKVVLIGDSAVGKSQLLARYARNEFSLDSKATIGVEFQTRTLVIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WL+ELR+HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVAKWLDELRSHADKNIVI  123

Query  538  MLIGNKTDL  564
            ML+GNK+DL
Sbjct  124  MLVGNKSDL  132



>emb|CDY69836.1| BnaAnng31680D [Brassica napus]
Length=224

 Score =   236 bits (602),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 120/123 (98%), Gaps = 1/123 (1%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFSLDSKATIGVEFQTRT+ I+ KSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSLDSKATIGVEFQTRTLTIEEKSVKAQIWD  72

Query  379  TAGQE-RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            TAGQE RYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK
Sbjct  73   TAGQESRYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNK  132

Query  556  TDL  564
            +DL
Sbjct  133  SDL  135



>ref|XP_006395225.1| hypothetical protein EUTSA_v10004881mg [Eutrema salsugineum]
 gb|ESQ32511.1| hypothetical protein EUTSA_v10004881mg [Eutrema salsugineum]
Length=223

 Score =   236 bits (602),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I  K+VKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDKKTVKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWLEELR HADKNIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVARWLEELRGHADKNIVIMLIGNK  129

Query  556  TDL  564
            TDL
Sbjct  130  TDL  132



>ref|XP_004249189.1| PREDICTED: ras-related protein RABA4d-like [Solanum lycopersicum]
Length=226

 Score =   236 bits (602),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            Y D   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+L+ +K+
Sbjct  6    YADHYNQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLLVDNKT  65

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  66   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  125

Query  538  MLIGNKTDL  564
            MLI NK DL
Sbjct  126  MLIANKCDL  134



>ref|XP_010695403.1| PREDICTED: ras-related protein RABA4d [Beta vulgaris subsp. vulgaris]
Length=229

 Score =   236 bits (602),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS+DSKATIGVEFQTRT++I +K+VK+QIW
Sbjct  14   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIDSKATIGVEFQTRTLVIDNKTVKSQIW  73

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWLEELR HADKNIVI+LIGNK
Sbjct  74   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVSRWLEELRGHADKNIVIILIGNK  133

Query  556  TDL  564
            TDL
Sbjct  134  TDL  136



>ref|XP_006351381.1| PREDICTED: ras-related protein RABA4d-like [Solanum tuberosum]
Length=226

 Score =   236 bits (602),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            Y D   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+L+ +K+
Sbjct  6    YADHYNQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLLVDNKT  65

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  66   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  125

Query  538  MLIGNKTDL  564
            MLI NK DL
Sbjct  126  MLIANKCDL  134



>gb|AAM66946.1| GTP-binding protein GB3 [Arabidopsis thaliana]
Length=224

 Score =   236 bits (602),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT+ I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>gb|AAA87884.1| ATGB3 [Arabidopsis thaliana]
Length=224

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT+ I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>gb|KHG15141.1| Ras-related RABA4c -like protein [Gossypium arboreum]
 gb|KJB25042.1| hypothetical protein B456_004G174200 [Gossypium raimondii]
Length=229

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+L+RF RNEF++DSKATIGVEFQT+T+LI HKSVKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLSRFTRNEFNIDSKATIGVEFQTKTLLIDHKSVKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HADKNIVIML+GNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELRGHADKNIVIMLVGNK  129

Query  556  TDL  564
            +DL
Sbjct  130  SDL  132



>ref|XP_010431983.1| PREDICTED: ras-related protein RABA4b-like [Camelina sativa]
Length=227

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDS+VGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSSVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEQKSIKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>ref|NP_195709.1| GTP-binding protein ATGB3 [Arabidopsis thaliana]
 sp|Q9SMQ6.1|RAA4B_ARATH RecName: Full=Ras-related protein RABA4b; Short=AtRABA4b; AltName: 
Full=Ras-related protein GB3; Short=AtGB3; AltName: Full=Ras-related 
protein Rab11G; Short=AtRab11G [Arabidopsis thaliana]
 emb|CAB38912.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 emb|CAB80662.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 gb|AAL62440.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 gb|AAM91314.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 gb|AEE87150.1| GTP-binding protein ATGB3 [Arabidopsis thaliana]
Length=224

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT+ I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>emb|CDX69369.1| BnaC01g00840D [Brassica napus]
Length=408

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFSLDSKATIGVEFQTRT+ I+ KSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSLDSKATIGVEFQTRTLTIEEKSVKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>emb|CDP10094.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+++  K+
Sbjct  5    YGDF-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLIVDQKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_008240816.1| PREDICTED: ras-related protein RABA4d [Prunus mume]
Length=222

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_007204003.1| hypothetical protein PRUPE_ppa025526mg [Prunus persica]
 gb|EMJ05202.1| hypothetical protein PRUPE_ppa025526mg [Prunus persica]
Length=222

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_002866902.1| hypothetical protein ARALYDRAFT_490786 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43161.1| hypothetical protein ARALYDRAFT_490786 [Arabidopsis lyrata subsp. 
lyrata]
Length=227

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT+ I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWD  72

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  559  DL  564
            DL
Sbjct  133  DL  134



>ref|XP_004172276.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein RABA4c-like 
[Cucumis sativus]
Length=222

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+L+RFARNEFSLDSKATIGVEFQT+T+ I  K++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLSRFARNEFSLDSKATIGVEFQTKTLNIDQKAIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQTFDHI RWLEELR HADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQTFDHIARWLEELRGHADKNIVIMLIGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_006850119.1| hypothetical protein AMTR_s00022p00227570 [Amborella trichopoda]
 gb|ERN11700.1| hypothetical protein AMTR_s00022p00227570 [Amborella trichopoda]
Length=223

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I HK+
Sbjct  5    YGDF-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTIVIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIV+
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVARWLDELRGHADKNIVV  123

Query  538  MLIGNKTDL  564
            ML+GNK+DL
Sbjct  124  MLVGNKSDL  132



>ref|XP_004149604.1| PREDICTED: ras-related protein RABA4c-like [Cucumis sativus]
 gb|KGN58606.1| hypothetical protein Csa_3G698470 [Cucumis sativus]
Length=222

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+L+RFARNEFSLDSKATIGVEFQT+T+ I  K++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLSRFARNEFSLDSKATIGVEFQTKTLNIDQKAIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQTFDHI RWLEELR HADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQTFDHIARWLEELRGHADKNIVIMLIGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_007052583.1| RAB GTPase A4C [Theobroma cacao]
 gb|EOX96740.1| RAB GTPase A4C [Theobroma cacao]
Length=225

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQTRT LI HK+VKAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNIDSKATIGVEFQTRTQLIDHKTVKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKR +FDH+ +WLEELR HADKNIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRPSFDHVAKWLEELRGHADKNIVIMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_006421492.1| hypothetical protein CICLE_v10005824mg [Citrus clementina]
 ref|XP_006490035.1| PREDICTED: ras-related protein RABA4d-like [Citrus sinensis]
 gb|ESR34732.1| hypothetical protein CICLE_v10005824mg [Citrus clementina]
 gb|KDO57267.1| hypothetical protein CISIN_1g027382mg [Citrus sinensis]
Length=224

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T+ I HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLSIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLDELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_006281058.1| hypothetical protein CARUB_v10027077mg [Capsella rubella]
 gb|EOA13956.1| hypothetical protein CARUB_v10027077mg [Capsella rubella]
Length=224

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQI
Sbjct  10   NQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQI  69

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEEL+ HADKNIVIMLIGN
Sbjct  70   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELKGHADKNIVIMLIGN  129

Query  553  KTDL  564
            KTDL
Sbjct  130  KTDL  133



>ref|XP_010442212.1| PREDICTED: ras-related protein RABA4c-like [Camelina sativa]
Length=223

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI IMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIAIMLIGNK  129

Query  556  TDL  564
            TDL
Sbjct  130  TDL  132



>ref|XP_010439146.1| PREDICTED: ras-related protein RABA4c [Camelina sativa]
Length=223

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI IMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIAIMLIGNK  129

Query  556  TDL  564
            TDL
Sbjct  130  TDL  132



>ref|XP_009399667.1| PREDICTED: ras-related protein RGP1-like [Musa acuminata subsp. 
malaccensis]
Length=228

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = +1

Query  160  MASGG-GYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT  336
            M+SG   Y     QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS+DSKATIGVEFQTRT
Sbjct  1    MSSGSRNYYGEFNQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSVDSKATIGVEFQTRT  60

Query  337  MLIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAH  516
            + I  K++KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR H
Sbjct  61   LTIDSKTIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGH  120

Query  517  ADKNIVIMLIGNKTDL  564
            AD+NIVIMLIGNK+DL
Sbjct  121  ADRNIVIMLIGNKSDL  136



>ref|XP_011078858.1| PREDICTED: ras-related protein RABA4d [Sesamum indicum]
Length=220

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG    QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+L+SKATIGVEFQT+T++I  K+
Sbjct  5    YGGDFSQKIDYVFKVVLIGDSAVGKSQLLARFARNEFTLESKATIGVEFQTKTLIIDQKT  64

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD++KRQ+FDHI RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMSKRQSFDHIARWLEELRGHADKNIVI  124

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  125  MLIGNKCDL  133



>ref|XP_010057727.1| PREDICTED: ras-related protein RABA4d [Eucalyptus grandis]
 gb|KCW90273.1| hypothetical protein EUGRSUZ_A02418 [Eucalyptus grandis]
Length=221

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFS++SKATIGVEFQT+T++I HK+
Sbjct  5    YGDY-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSVESKATIGVEFQTKTLVIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMTRWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            ML+GNK+DL
Sbjct  124  MLVGNKSDL  132



>ref|XP_009151604.1| PREDICTED: ras-related protein RABA4c [Brassica rapa]
Length=223

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I +K+VKAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDNKTVKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGN  128

Query  553  KTDL  564
            KTDL
Sbjct  129  KTDL  132



>ref|XP_002513185.1| protein with unknown function [Ricinus communis]
 gb|EEF49176.1| protein with unknown function [Ricinus communis]
Length=223

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T+++ HK+VKAQI
Sbjct  9    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTIVVDHKTVKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HAD NIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELREHADNNIVIMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_009804804.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana sylvestris]
Length=224

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+L+ +++
Sbjct  5    YGDY-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLLVDNRT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            M+IGNK DL
Sbjct  124  MIIGNKCDL  132



>ref|XP_010482045.1| PREDICTED: ras-related protein RABA4c-like [Camelina sativa]
 ref|XP_010482047.1| PREDICTED: ras-related protein RABA4c-like [Camelina sativa]
Length=223

 Score =   234 bits (597),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI +MLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIALMLIGNK  129

Query  556  TDL  564
            TDL
Sbjct  130  TDL  132



>emb|CDX86332.1| BnaA06g30490D [Brassica napus]
Length=223

 Score =   234 bits (597),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I +K+VKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDNKTVKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNK  129

Query  556  TDL  564
            TDL
Sbjct  130  TDL  132



>gb|EYU20715.1| hypothetical protein MIMGU_mgv1a013518mg [Erythranthe guttata]
Length=218

 Score =   234 bits (596),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+L+SKATIGVEFQT+T++I HKSVK+QI
Sbjct  10   NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLESKATIGVEFQTKTLVIDHKSVKSQI  69

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIML+GN
Sbjct  70   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLVGN  129

Query  553  KTDL  564
            K DL
Sbjct  130  KCDL  133



>ref|XP_009411810.1| PREDICTED: ras-related protein RGP1-like [Musa acuminata subsp. 
malaccensis]
Length=231

 Score =   234 bits (597),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = +1

Query  163  ASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTML  342
            +S   YG+   QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS+DSKATIGVEFQTRT+ 
Sbjct  7    SSRNHYGEF-NQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIDSKATIGVEFQTRTIT  65

Query  343  IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHAD  522
            I HK++KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR H D
Sbjct  66   IDHKTIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHMTRWLEELRGHTD  125

Query  523  KNIVIMLIGNKTDL  564
            +NIVIMLIGNK+DL
Sbjct  126  RNIVIMLIGNKSDL  139



>ref|NP_001146862.1| LOC100280470 [Zea mays]
 gb|ACG24025.1| ras-related protein RGP1 [Zea mays]
Length=226

 Score =   234 bits (597),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M+ GG +G+  GQ+IDYVFKVVLIGDSA GKSQ+LARFARN+F+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGSHGEL-GQRIDYVFKVVLIGDSAGGKSQLLARFARNQFNLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  60   NIDARNVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  119

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIML+GNK+DL
Sbjct  120  DKNIVIMLMGNKSDL  134



>emb|CDY54519.1| BnaC07g49230D [Brassica napus]
Length=223

 Score =   234 bits (596),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I +K++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDNKTIKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNK  129

Query  556  TDL  564
            TDL
Sbjct  130  TDL  132



>ref|XP_008461787.1| PREDICTED: ras-related protein RABA4c [Cucumis melo]
Length=222

 Score =   234 bits (596),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+L+RFARNEFSLDSKATIGVEFQT+T+ I  K++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLSRFARNEFSLDSKATIGVEFQTKTLNIDQKAIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDHI RWLEELR HADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHIARWLEELRGHADKNIVIMLIGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_009763158.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana sylvestris]
Length=224

 Score =   234 bits (596),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I  K+
Sbjct  5    YGDY-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLIIDQKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLI NK DL
Sbjct  124  MLIANKCDL  132



>ref|XP_009391884.1| PREDICTED: ras-related protein RGP1-like [Musa acuminata subsp. 
malaccensis]
Length=225

 Score =   233 bits (595),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M+SG        Q+IDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQTRT+
Sbjct  1    MSSGNSRYGEFNQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTRTL  60

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             I  K++KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWL+ELR HA
Sbjct  61   NIDDKTIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVARWLDELRGHA  120

Query  520  DKNIVIMLIGNKTDL  564
            D+NIVIMLIGNK+DL
Sbjct  121  DRNIVIMLIGNKSDL  135



>ref|NP_199607.1| RAB GTPase homolog A4C [Arabidopsis thaliana]
 sp|Q9FE79.1|RAA4C_ARATH RecName: Full=Ras-related protein RABA4c; Short=AtRABA4c; AltName: 
Full=Ras-related protein SMG1 [Arabidopsis thaliana]
 gb|AAG44121.1|AF218121_1 small molecular weight g-protein [Arabidopsis thaliana]
 dbj|BAB09048.1| RAS superfamily GTP-binding protein-like [Arabidopsis thaliana]
 gb|ABD60725.1| At5g47960 [Arabidopsis thaliana]
 gb|AED95599.1| RAB GTPase homolog A4C [Arabidopsis thaliana]
Length=223

 Score =   233 bits (595),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I  K++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDRKTIKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNK  129

Query  556  TDL  564
            TDL
Sbjct  130  TDL  132



>ref|XP_010534274.1| PREDICTED: ras-related protein RABA4c [Tarenaya hassleriana]
Length=223

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I  K+VKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDSKTVKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI IMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIAIMLIGNK  129

Query  556  TDL  564
            TDL
Sbjct  130  TDL  132



>ref|XP_009345104.1| PREDICTED: ras-related protein RABA4d-like [Pyrus x bretschneideri]
Length=259

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  41   YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  99

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  100  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  159

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  160  MLIGNKCDL  168



>ref|XP_001775770.1| predicted protein [Physcomitrella patens]
 gb|EDQ59453.1| predicted protein [Physcomitrella patens]
Length=221

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
             KIDYVFKVVLIGDSAVGKSQ+LARF+RNEFSL+SKATIGVEFQTRT+++ HK++KAQIW
Sbjct  10   NKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSLESKATIGVEFQTRTVVVDHKTIKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITK+Q+FDH+ RWLEELRAHAD NIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKQQSFDHVQRWLEELRAHADANIVIMLIGNK  129

Query  556  TDL  564
            +DL
Sbjct  130  SDL  132



>ref|XP_008375145.1| PREDICTED: ras-related protein RABA4c-like [Malus domestica]
Length=222

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELRAHAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRAHADNNIVVMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_009354700.1| PREDICTED: ras-related protein RABA4c-like [Pyrus x bretschneideri]
Length=222

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELRAHAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRAHADNNIVVMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_002282798.1| PREDICTED: ras-related protein RABA4d [Vitis vinifera]
 emb|CAN62934.1| hypothetical protein VITISV_008844 [Vitis vinifera]
 emb|CBI29902.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQT+T+ I  K+
Sbjct  5    YGDF-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNVDSKATIGVEFQTKTLAIDQKA  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK+DL
Sbjct  124  MLIGNKSDL  132



>ref|XP_009347482.1| PREDICTED: ras-related protein RABA4d-like [Pyrus x bretschneideri]
Length=259

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  41   YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  99

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  100  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  159

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  160  MLIGNKCDL  168



>ref|XP_008392105.1| PREDICTED: ras-related protein RABA4d-like [Malus domestica]
Length=259

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  41   YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  99

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  100  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  159

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  160  MLIGNKCDL  168



>emb|CDY00758.1| BnaC03g37420D [Brassica napus]
Length=221

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_009135214.1| PREDICTED: ras-related protein RABA4d-like [Brassica rapa]
 ref|XP_009135215.1| PREDICTED: ras-related protein RABA4d-like [Brassica rapa]
 emb|CDX73833.1| BnaA03g32140D [Brassica napus]
Length=221

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>gb|KDP43443.1| hypothetical protein JCGZ_16730 [Jatropha curcas]
Length=226

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            Q+IDYVFKVVLIGDSAVGKSQ+LARF RNEFSL+SKATIGVEFQT+T++I HK+VKAQIW
Sbjct  10   QQIDYVFKVVLIGDSAVGKSQLLARFTRNEFSLESKATIGVEFQTKTIVIDHKTVKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HAD NIVIML+GNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELREHADSNIVIMLVGNK  129

Query  556  TDL  564
            +DL
Sbjct  130  SDL  132



>ref|XP_008460801.1| PREDICTED: ras-related protein RABA4d [Cucumis melo]
Length=223

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RNEFS+DSKATIGVEFQT+T++I  K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNEFSVDSKATIGVEFQTKTLVIDQKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_009120881.1| PREDICTED: ras-related protein RABA4d [Brassica rapa]
 emb|CDY52622.1| BnaCnng23010D [Brassica napus]
 emb|CDY50568.1| BnaA01g30820D [Brassica napus]
Length=222

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|NP_187823.1| RAB GTPase-like protein A4D [Arabidopsis thaliana]
 ref|XP_002884891.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006298501.1| hypothetical protein CARUB_v10014578mg [Capsella rubella]
 ref|XP_006407359.1| hypothetical protein EUTSA_v10022384mg [Eutrema salsugineum]
 ref|XP_010498677.1| PREDICTED: ras-related protein RABA4d [Camelina sativa]
 ref|XP_010464965.1| PREDICTED: ras-related protein RABA4d [Camelina sativa]
 sp|Q9LH50.1|RAA4D_ARATH RecName: Full=Ras-related protein RABA4d; Short=AtRABA4d [Arabidopsis 
thaliana]
 gb|AAG51065.1|AC069472_5 ras-related GTP-binding protein; 5118-4176 [Arabidopsis thaliana]
 dbj|BAB01966.1| GTP-binding protein-like [Arabidopsis thaliana]
 gb|AAY78738.1| Ras-related GTP-binding family protein [Arabidopsis thaliana]
 gb|EFH61150.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEE75160.1| RAB GTPase-like protein A4D [Arabidopsis thaliana]
 gb|EOA31399.1| hypothetical protein CARUB_v10014578mg [Capsella rubella]
 gb|ESQ48812.1| hypothetical protein EUTSA_v10022384mg [Eutrema salsugineum]
 gb|KFK38580.1| hypothetical protein AALP_AA3G132100 [Arabis alpina]
Length=222

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_010557931.1| PREDICTED: ras-related protein RABA4d-like [Tarenaya hassleriana]
Length=224

 Score =   232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSIDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_004150166.1| PREDICTED: ras-related protein RABA4d-like [Cucumis sativus]
 ref|XP_004154754.1| PREDICTED: ras-related protein RABA4d-like [Cucumis sativus]
 gb|KGN53823.1| hypothetical protein Csa_4G152280 [Cucumis sativus]
Length=223

 Score =   232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RNEFS+DSKATIGVEFQT+T++I  K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNEFSVDSKATIGVEFQTKTLVIDQKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_010520062.1| PREDICTED: ras-related protein RABA4d [Tarenaya hassleriana]
Length=223

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_011075182.1| PREDICTED: ras-related protein RABA4d-like [Sesamum indicum]
Length=224

 Score =   232 bits (591),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I  K+VKAQIW
Sbjct  11   QKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLIIDQKTVKAQIW  70

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYD++KRQ+FDH+ RWLEELR HADKNIVIMLIGNK
Sbjct  71   DTAGQERYRAVTSAYYRGAVGAMLVYDMSKRQSFDHMARWLEELRGHADKNIVIMLIGNK  130

Query  556  TDL  564
             DL
Sbjct  131  CDL  133



>ref|XP_009591241.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana tomentosiformis]
Length=224

 Score =   232 bits (591),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   +KIDYVFK+VLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T+L+ +++
Sbjct  5    YGDY-NRKIDYVFKIVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTLLVDNRT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMVRWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_008344636.1| PREDICTED: ras-related protein RABA4d, partial [Malus domestica]
Length=175

 Score =   230 bits (586),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRXHADNNIVVMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>emb|CAA41966.1| GTP-binding protein [Oryza sativa]
 prf||1718315A GTP-binding protein
Length=226

 Score =   231 bits (590),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            M+ GGG     GQKIDYVFKVVLIGDSAVGKSQ+LA FARNEF+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGGSYGEVGQKIDYVFKVVLIGDSAVGKSQLLAGFARNEFNLDSKATIGVEFQTRTL  60

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             I  ++VKAQ  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  61   HIDARTVKAQTRDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  120

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVIMLIGNK+DL
Sbjct  121  DKNIVIMLIGNKSDL  135



>ref|XP_008373738.1| PREDICTED: ras-related protein RABA4d [Malus domestica]
Length=223

 Score =   231 bits (590),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++  K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDQKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_004234844.1| PREDICTED: ras-related protein RABA4d-like [Solanum lycopersicum]
Length=224

 Score =   231 bits (590),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFK+VL GDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T++I +++
Sbjct  5    YGDY-NQKIDYVFKIVLTGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTLIIDNRT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_008350827.1| PREDICTED: ras-related protein RABA4d, partial [Malus domestica]
Length=179

 Score =   229 bits (585),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRXHADNNIVVMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_006438973.1| hypothetical protein CICLE_v10032676mg [Citrus clementina]
 ref|XP_006482913.1| PREDICTED: ras-related protein RABA4c-like [Citrus sinensis]
 gb|ESR52213.1| hypothetical protein CICLE_v10032676mg [Citrus clementina]
Length=226

 Score =   231 bits (589),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
              KIDYVFK+VLIGDSAVGKSQ+LARFAR+EFSLDSKATIGVEFQT+T++I HK+VKAQI
Sbjct  10   NNKIDYVFKIVLIGDSAVGKSQLLARFARDEFSLDSKATIGVEFQTKTVVIHHKNVKAQI  69

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FD++ RWLEELR HADKNI+IML+GN
Sbjct  70   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDNVARWLEELRGHADKNIIIMLVGN  129

Query  553  KTDL  564
            K+DL
Sbjct  130  KSDL  133



>ref|XP_007140805.1| hypothetical protein PHAVU_008G143600g [Phaseolus vulgaris]
 gb|ESW12799.1| hypothetical protein PHAVU_008G143600g [Phaseolus vulgaris]
Length=223

 Score =   231 bits (589),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 124/129 (96%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD + QKIDYVFKVVLIGDSAVGK+Q+LARFARN+FSLDSKATIGVEFQT+T++I +K+
Sbjct  5    YGDYS-QKIDYVFKVVLIGDSAVGKTQLLARFARNQFSLDSKATIGVEFQTKTLIIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VK+QIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD+NIVI
Sbjct  64   VKSQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMVRWLEELRGHADQNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK+DL
Sbjct  124  MLIGNKSDL  132



>ref|XP_001753670.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ81422.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=221

 Score =   231 bits (589),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
             KIDYVFKVVLIGDSAVGKSQ+L+RF+RNEFSL+SKATIGVEFQTRT+++ HK++KAQIW
Sbjct  10   NKIDYVFKVVLIGDSAVGKSQLLSRFSRNEFSLESKATIGVEFQTRTIVVDHKTIKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYDITK+Q+FDH+ RWLEELRAHAD NIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKQQSFDHVQRWLEELRAHADANIVIMLIGNK  129

Query  556  TDL  564
            +DL
Sbjct  130  SDL  132



>emb|CDY42133.1| BnaC05g40860D [Brassica napus]
 emb|CDY08447.1| BnaA05g26830D [Brassica napus]
Length=222

 Score =   231 bits (588),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+VKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKTVKAQIW  69

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNK  129

Query  556  TDL  564
             DL
Sbjct  130  CDL  132



>ref|XP_003516822.1| PREDICTED: ras-related protein RABA4d-like [Glycine max]
Length=223

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSLDSKATIGVEFQT+T++I +K+
Sbjct  5    YGDYH-QKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLDSKATIGVEFQTKTLIIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD+NIVI
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMVRWLEELRGHADQNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_010672725.1| PREDICTED: ras-related protein RABA4d [Beta vulgaris subsp. vulgaris]
Length=222

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T++I  K VKAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLVIDKKIVKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDHI RWL+ELR HADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHIARWLDELRGHADKNIVIMLIGN  128

Query  553  KTDL  564
            K DL
Sbjct  129  KCDL  132



>ref|XP_010489789.1| PREDICTED: ras-related protein RABA4d-like [Camelina sativa]
Length=222

 Score =   230 bits (587),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++  +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVTDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_007218358.1| hypothetical protein PRUPE_ppa011105mg [Prunus persica]
 gb|EMJ19557.1| hypothetical protein PRUPE_ppa011105mg [Prunus persica]
Length=223

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKHQSFDHVTKWLEELRGHADSNIVVMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_002532404.1| protein with unknown function [Ricinus communis]
 gb|EEF29989.1| protein with unknown function [Ricinus communis]
Length=223

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF +DSKATIGVEFQT+T+ I +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFCVDSKATIGVEFQTKTLSIDNKTVKAQI  67

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGN  127

Query  553  KTDL  564
            K DL
Sbjct  128  KCDL  131



>ref|XP_008231353.1| PREDICTED: ras-related protein RABA4c [Prunus mume]
 ref|XP_008231354.1| PREDICTED: ras-related protein RABA4c [Prunus mume]
 ref|XP_008231355.1| PREDICTED: ras-related protein RABA4c [Prunus mume]
Length=223

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKHQSFDHVTKWLEELRGHADNNIVVMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_004494010.1| PREDICTED: ras-related protein RABA4d-like [Cicer arietinum]
Length=225

 Score =   229 bits (585),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD    KIDYVFKVVLIGDSAVGK+Q+LARFARNEF++DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NLKIDYVFKVVLIGDSAVGKTQLLARFARNEFNVDSKATIGVEFQTKTLIIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>gb|EPS73160.1| hypothetical protein M569_01593, partial [Genlisea aurea]
Length=220

 Score =   229 bits (584),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
            G +IDYVFKVVLIGDSAVGKSQIL+RFARNEF+L+SKATIGVEFQTRT++I  K+VKAQI
Sbjct  6    GGQIDYVFKVVLIGDSAVGKSQILSRFARNEFNLESKATIGVEFQTRTLIIDQKTVKAQI  65

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYR+VTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGN
Sbjct  66   WDTAGQERYRSVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGN  125

Query  553  KTDL  564
            K DL
Sbjct  126  KCDL  129



>gb|KHN07997.1| Ras-related protein RABA4d [Glycine soja]
Length=279

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSLDSKATIGVEFQT+T++I +K+
Sbjct  61   YGDYH-QKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLDSKATIGVEFQTKTLIIDNKT  119

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD+NIVI
Sbjct  120  IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMVRWLEELRGHADQNIVI  179

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  180  MLIGNKCDL  188



>ref|XP_003539132.1| PREDICTED: ras-related protein RABA4d-like [Glycine max]
 gb|KHN46958.1| Ras-related protein RABA4d [Glycine soja]
Length=223

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSLDSKATIGVEFQT+T++I +K 
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLDSKATIGVEFQTKTLIIDNKI  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HAD+NIVI
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMVKWLEELRGHADQNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_001760654.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ74393.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=221

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MA+G    D    KIDYVFKVVLIGDSAVGKSQ+L+RF+RNEFSL+SKATIGVEFQTRT+
Sbjct  1    MANGYNEYD---NKIDYVFKVVLIGDSAVGKSQLLSRFSRNEFSLESKATIGVEFQTRTI  57

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            ++ HK++KAQIWDTAGQERYRAVTSAYYRGAVGAM+VYDITK Q+FDH+ RWLEELRAHA
Sbjct  58   VVDHKTIKAQIWDTAGQERYRAVTSAYYRGAVGAMVVYDITKEQSFDHVLRWLEELRAHA  117

Query  520  DKNIVIMLIGNKTDL  564
            D NIVIMLIGNK+DL
Sbjct  118  DANIVIMLIGNKSDL  132



>ref|XP_007145654.1| hypothetical protein PHAVU_007G257200g [Phaseolus vulgaris]
 gb|ESW17648.1| hypothetical protein PHAVU_007G257200g [Phaseolus vulgaris]
Length=222

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD + QKIDYVFKVVLIGDSAVGK+Q+LARFARN+FS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDFS-QKIDYVFKVVLIGDSAVGKTQLLARFARNQFSVDSKATIGVEFQTKTLIIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ +WLEELR HADKNIV+
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMAKWLEELRGHADKNIVV  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_004309478.1| PREDICTED: ras-related protein RABA4d isoform X1 [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSL+SKATIGVEFQT+T+++  K+VKAQI
Sbjct  9    SQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLESKATIGVEFQTKTLVLDQKTVKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR +ADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGYADKNIVIMLIGN  128

Query  553  KTDL  564
            K DL
Sbjct  129  KCDL  132



>gb|KHG02480.1| Ras-related RABA4d -like protein [Gossypium arboreum]
 gb|KJB15040.1| hypothetical protein B456_002G157000 [Gossypium raimondii]
Length=225

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RN+FSLDSKATIGVEFQT+T++I +K+VKAQIW
Sbjct  11   QKIDYVFKVVLIGDSAVGKSQLLARFSRNQFSLDSKATIGVEFQTKTLVIDNKTVKAQIW  70

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ RWLEELR HADKNIV+MLIGNK
Sbjct  71   DTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMARWLEELRGHADKNIVVMLIGNK  130

Query  556  TDL  564
             DL
Sbjct  131  CDL  133



>gb|KEH16247.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=222

 Score =   228 bits (582),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD    KIDYVFKVVLIGDSAVGK+Q+L RFARNEF +DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NTKIDYVFKVVLIGDSAVGKTQLLGRFARNEFKVDSKATIGVEFQTKTLIIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR+HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRSHADKNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_009146635.1| PREDICTED: ras-related protein RABA4d-like [Brassica rapa]
Length=263

 Score =   229 bits (585),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+VKAQI
Sbjct  50   NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKTVKAQI  109

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGN
Sbjct  110  WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGN  169

Query  553  KTDL  564
            K DL
Sbjct  170  KCDL  173



>ref|XP_009365017.1| PREDICTED: ras-related protein RABA4c-like [Pyrus x bretschneideri]
Length=222

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SK+TIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKSTIGVEFQTKTLVIDHKTIKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+F+H+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFEHVTKWLEELRGHADNNIVVMLVGN  128

Query  553  KTDL  564
            K+DL
Sbjct  129  KSDL  132



>ref|XP_002972485.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ26571.1| rab family GTPase [Selaginella moellendorffii]
Length=214

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEF+L+SKATIGVEFQTRTM++ HK++KAQI
Sbjct  8    NQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFTLESKATIGVEFQTRTMVVDHKTIKAQI  67

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRA+TSAYYRGAVGA++VYDITKR TF+H+ RWLEEL+ HAD NIV+ML+GN
Sbjct  68   WDTAGQERYRAITSAYYRGAVGALVVYDITKRPTFEHVTRWLEELKVHADNNIVVMLVGN  127

Query  553  KTDL  564
            K+DL
Sbjct  128  KSDL  131



>ref|XP_002984315.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ14825.1| rab family GTPase [Selaginella moellendorffii]
Length=214

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEF+L+SKATIGVEFQTRTM++ HK++KAQI
Sbjct  8    NQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFTLESKATIGVEFQTRTMVVDHKTIKAQI  67

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRA+TSAYYRGAVGA++VYDITKR TF+H+ RWLEEL+ HAD NIV+ML+GN
Sbjct  68   WDTAGQERYRAITSAYYRGAVGALVVYDITKRPTFEHVTRWLEELKVHADNNIVVMLVGN  127

Query  553  KTDL  564
            K+DL
Sbjct  128  KSDL  131



>ref|XP_004497938.1| PREDICTED: ras-related protein RABA4d-like [Cicer arietinum]
Length=223

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RN+F++DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNQFNVDSKATIGVEFQTKTLIIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD NIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADANIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_002323298.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 gb|EEF05059.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=218

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFTVDSKATIGVEFQTKTLAMHNKTVKAQI  67

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK+I+IMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKSIIIMLIGN  127

Query  553  KTDL  564
            K DL
Sbjct  128  KCDL  131



>gb|KJB36087.1| hypothetical protein B456_006G140300 [Gossypium raimondii]
Length=222

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   Q+IDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VK+QIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ RWLEELR HAD+N+VI
Sbjct  64   VKSQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMARWLEELRGHADQNLVI  123

Query  538  MLIGNKTDL  564
            ML+GNK DL
Sbjct  124  MLVGNKCDL  132



>gb|AFK37481.1| unknown [Medicago truncatula]
 gb|KEH41577.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=223

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RN+F++DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNQFNVDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD NIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADTNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>gb|KHG20755.1| Ras-related RABA4d -like protein [Gossypium arboreum]
Length=222

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   Q+IDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VK+QIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ RWLEELR HAD+N+VI
Sbjct  64   VKSQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMARWLEELRGHADQNLVI  123

Query  538  MLIGNKTDL  564
            ML+GNK DL
Sbjct  124  MLVGNKCDL  132



>ref|XP_011016542.1| PREDICTED: ras-related protein RABA4d-like [Populus euphratica]
Length=218

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFTVDSKATIGVEFQTKTLAMHNKTVKAQI  67

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK I+IMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKRIIIMLIGN  127

Query  553  KTDL  564
            K DL
Sbjct  128  KCDL  131



>ref|XP_010111429.1| Ras-related protein RABA4d [Morus notabilis]
 gb|EXC30907.1| Ras-related protein RABA4d [Morus notabilis]
Length=224

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLIIDHKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQE  RAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQE--RAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  121

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  122  MLIGNKCDL  130



>gb|AFK40086.1| unknown [Lotus japonicus]
Length=199

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RN+F++DSKATIGVEFQT+T++I  K+
Sbjct  5    YGDF-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNQFNVDSKATIGVEFQTKTLVIDSKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HAD NIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMAKWLEELRGHADTNIVI  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_011033268.1| PREDICTED: ras-related protein RABA4d-like isoform X2 [Populus 
euphratica]
Length=218

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFTVDSKATIGVEFQTKTLAMHNKTVKAQI  67

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK I+IMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMTRWLEELRGHADKRIIIMLIGN  127

Query  553  KTDL  564
            K DL
Sbjct  128  KCDL  131



>gb|ABK23331.1| unknown [Picea sitchensis]
Length=222

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 3/135 (2%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MAS   YGD   Q+IDY+FKVV+IGDSAVGKSQIL+RFA+NEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASP--YGDY-DQRIDYMFKVVVIGDSAVGKSQILSRFAKNEFSLDSKSTIGVEFQTRTI  57

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
             I +K++K QIWDTAGQERYRAVTSAYYRGA+GAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  58   AIDNKTIKTQIWDTAGQERYRAVTSAYYRGALGAMLVYDITKRQSFDHVARWLEELRGHA  117

Query  520  DKNIVIMLIGNKTDL  564
            D NIVIMLIGNK DL
Sbjct  118  DNNIVIMLIGNKCDL  132



>gb|ACU18500.1| unknown [Glycine max]
Length=209

 Score =   226 bits (575),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG+   QKIDYVFKVVLIGDSAVGK+Q+LARFA+N+FS+DSKATIGVEFQT+T++I +K+
Sbjct  6    YGEY-NQKIDYVFKVVLIGDSAVGKTQLLARFAKNQFSVDSKATIGVEFQTKTLIIDNKT  64

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ +WLEELR HADKNIV+
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMAKWLEELRGHADKNIVV  124

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  125  MLIGNKCDL  133



>ref|XP_004306514.1| PREDICTED: ras-related protein RABA4c [Fragaria vesca subsp. 
vesca]
Length=252

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T+ I  K++KAQI
Sbjct  37   NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLSIDQKTIKAQI  96

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ RWLEELR HAD NIV+ML+GN
Sbjct  97   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTRWLEELRGHADSNIVVMLVGN  156

Query  553  KTDL  564
            K+DL
Sbjct  157  KSDL  160



>gb|KHN09949.1| Ras-related protein RABA4d [Glycine soja]
Length=224

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YG+   QKIDYVFKVVLIGDSAVGK+Q+LARFA+N+FS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGEY-NQKIDYVFKVVLIGDSAVGKTQLLARFAKNQFSVDSKATIGVEFQTKTLIIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ +WLEELR HADKNIV+
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMAKWLEELRGHADKNIVV  123

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  124  MLIGNKCDL  132



>ref|XP_006381042.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 gb|ERP58839.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=218

 Score =   224 bits (571),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFK+VLIGDSAVGKSQ LARFARNEF+ DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQFLARFARNEFNADSKATIGVEFQTKTLAMDNKTVKAQI  67

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK+I+IMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHLARWLEELRGHADKSIIIMLIGN  127

Query  553  KTDL  564
            K DL
Sbjct  128  KCDL  131



>gb|AAG51053.1|AC069473_15 ras-related GTP-binding protein, putative; 1694-2636 [Arabidopsis 
thaliana]
Length=220

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 120/129 (93%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  357
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  358  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  537
            VKAQIWDTAGQE  RAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQE--RAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  121

Query  538  MLIGNKTDL  564
            MLIGNK DL
Sbjct  122  MLIGNKCDL  130



>ref|XP_010422852.1| PREDICTED: ras-related protein RABA4a-like isoform X3 [Camelina 
sativa]
Length=218

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 120/135 (89%), Gaps = 11/135 (8%)
 Frame = +1

Query  160  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  339
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  340  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  519
            ++ HKSVKAQIWDTAGQE          RGAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQE----------RGAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  109

Query  520  DKNIVIMLIGNKTDL  564
            DKNIVI+L+GNK+DL
Sbjct  110  DKNIVIILVGNKSDL  124



>gb|EPS69801.1| hypothetical protein M569_04963, partial [Genlisea aurea]
Length=208

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  175  GYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHK  354
             Y      K+DYVFK+VLIGDSAVGKSQ+L+R+ +NEF LDS+ATIGVEFQTRT+ I HK
Sbjct  2    NYAGDFSSKVDYVFKIVLIGDSAVGKSQLLSRYTKNEFLLDSRATIGVEFQTRTLSIDHK  61

Query  355  SVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIV  534
            +VKAQIWDTAGQERYRAVT+AYYRGA+GAMLVYDITKRQ+FDH+PRWLEELR+ ADK+I 
Sbjct  62   TVKAQIWDTAGQERYRAVTTAYYRGALGAMLVYDITKRQSFDHVPRWLEELRSSADKHIA  121

Query  535  IMLIGNKTDL  564
            +MLIGNK+DL
Sbjct  122  VMLIGNKSDL  131



>ref|XP_009375439.1| PREDICTED: ras-related protein RABA3 [Pyrus x bretschneideri]
Length=248

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            +KIDYVFKVV+IGDSAVGK+QIL+RF +NEF LDSK+TIGVEFQTRT+ IQ K +KAQIW
Sbjct  34   EKIDYVFKVVVIGDSAVGKTQILSRFTKNEFCLDSKSTIGVEFQTRTLTIQGKLIKAQIW  93

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGA+GAMLVYDITKRQTFDH+ RW+EELRAHAD +IVIMLIGNK
Sbjct  94   DTAGQERYRAVTSAYYRGALGAMLVYDITKRQTFDHVARWVEELRAHADSSIVIMLIGNK  153

Query  556  TDL  564
             DL
Sbjct  154  ADL  156



>ref|XP_011020284.1| PREDICTED: ras-related protein RABA4d-like [Populus euphratica]
Length=218

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFK+VLIGDSAVGKSQ LARFARNEF+ DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQFLARFARNEFNADSKATIGVEFQTKTLAMDNKTVKAQI  67

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQE YRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK+I+IMLIGN
Sbjct  68   WDTAGQESYRAVTSAYYRGAVGAMLVYDMTKRQSFDHLARWLEELRGHADKSIIIMLIGN  127

Query  553  KTDL  564
            K DL
Sbjct  128  KCDL  131



>ref|XP_002262618.3| PREDICTED: ras-related protein RABA3 [Vitis vinifera]
 emb|CBI38679.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   222 bits (565),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 7/142 (5%)
 Frame = +1

Query  160  MASGGGYGDAAGQ-------KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGV  318
            M   G +GD + Q       KIDYVFKVV+IGDSAVGK+QIL+RF +NEF  DSK+TIGV
Sbjct  5    MNGAGSHGDQSHQNQENGHEKIDYVFKVVVIGDSAVGKTQILSRFTKNEFCFDSKSTIGV  64

Query  319  EFQTRTMLIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWL  498
            EFQTRT+ I+ K +KAQIWDTAGQERYRAVTSAYYRGA+GAMLVYDITKRQTFDH+ RW+
Sbjct  65   EFQTRTVTIKSKVIKAQIWDTAGQERYRAVTSAYYRGALGAMLVYDITKRQTFDHVARWV  124

Query  499  EELRAHADKNIVIMLIGNKTDL  564
            EELRAHAD +IVIML+GNK DL
Sbjct  125  EELRAHADTSIVIMLVGNKADL  146



>ref|XP_007135286.1| hypothetical protein PHAVU_010G116500g [Phaseolus vulgaris]
 gb|ESW07280.1| hypothetical protein PHAVU_010G116500g [Phaseolus vulgaris]
Length=240

 Score =   221 bits (564),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  196  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  375
            +KIDYVFKVV+IGDSAVGK+QIL+RFA+NEF LDSK+TIGVEFQTRT+ I  K +KAQIW
Sbjct  23   EKIDYVFKVVVIGDSAVGKTQILSRFAKNEFCLDSKSTIGVEFQTRTVTINAKLIKAQIW  82

Query  376  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  555
            DTAGQERYRAVTSAYYRGA+GAMLVYDITKRQ+FDH+ RW+EELRAHAD +IVIML+GNK
Sbjct  83   DTAGQERYRAVTSAYYRGALGAMLVYDITKRQSFDHVARWVEELRAHADSSIVIMLVGNK  142

Query  556  TDL  564
             DL
Sbjct  143  ADL  145



>ref|XP_006339750.1| PREDICTED: ras-related protein RABA3-like [Solanum tuberosum]
Length=245

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  378
            KIDYVFKVV+IGDSAVGK+Q+L+RFA+NEF  DSK+TIGVEFQTRT+ IQ K +KAQIWD
Sbjct  29   KIDYVFKVVVIGDSAVGKTQVLSRFAKNEFCFDSKSTIGVEFQTRTVSIQSKVIKAQIWD  88

Query  379  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  558
            TAGQERYRAVTSAYYRGA+GAMLVYDITKRQTFDH+ RW+EELRAHAD +IVIMLIGNK 
Sbjct  89   TAGQERYRAVTSAYYRGALGAMLVYDITKRQTFDHVARWVEELRAHADSSIVIMLIGNKA  148

Query  559  DL  564
            DL
Sbjct  149  DL  150



>gb|KHF99482.1| Ras-related RABA3 -like protein [Gossypium arboreum]
Length=236

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  369
            A +KIDYVFKVV+IGDSAVGK+QIL+RF +NEF  DSK+TIGVEFQTRT+ I++K +KAQ
Sbjct  17   APEKIDYVFKVVVIGDSAVGKTQILSRFTKNEFCFDSKSTIGVEFQTRTVTIKNKVIKAQ  76

Query  370  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  549
            IWDTAGQERYRAVTSAYYRGA+GAMLVYDITKRQ+FDH+ RW+EELRAHAD +IVIMLIG
Sbjct  77   IWDTAGQERYRAVTSAYYRGALGAMLVYDITKRQSFDHVARWVEELRAHADNSIVIMLIG  136

Query  550  NKTDL  564
            NK DL
Sbjct  137  NKADL  141



>ref|XP_011470829.1| PREDICTED: ras-related protein RABA4d isoform X2 [Fragaria vesca 
subsp. vesca]
Length=221

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 2/124 (2%)
 Frame = +1

Query  193  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  372
             QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSL+SKATIGVEFQT+T+++  K+VKAQI
Sbjct  9    SQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLESKATIGVEFQTKTLVLDQKTVKAQI  68

Query  373  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  552
            WDTAGQE  RAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR +ADKNIVIMLIGN
Sbjct  69   WDTAGQE--RAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGYADKNIVIMLIGN  126

Query  553  KTDL  564
            K DL
Sbjct  127  KCDL  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920