BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G20

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006358433.1|  PREDICTED: uncharacterized protein LOC102603657    353   9e-116   Solanum tuberosum [potatoes]
ref|XP_009599211.1|  PREDICTED: uncharacterized protein LOC104094898    351   3e-115   Nicotiana tomentosiformis
ref|XP_004247488.1|  PREDICTED: uncharacterized protein LOC101267646    345   8e-113   Solanum lycopersicum
ref|XP_009769229.1|  PREDICTED: uncharacterized protein LOC104220112    345   9e-113   Nicotiana sylvestris
ref|XP_009607167.1|  PREDICTED: uncharacterized protein LOC104101431    340   6e-111   Nicotiana tomentosiformis
ref|XP_009774650.1|  PREDICTED: uncharacterized protein LOC104224666    340   6e-111   Nicotiana sylvestris
ref|XP_010323031.1|  PREDICTED: uncharacterized protein LOC101258968    333   1e-108   Solanum lycopersicum
ref|XP_006352790.1|  PREDICTED: uncharacterized protein LOC102602285    330   2e-107   Solanum tuberosum [potatoes]
ref|XP_011079798.1|  PREDICTED: uncharacterized protein LOC105163227    312   5e-100   Sesamum indicum [beniseed]
ref|XP_002524804.1|  conserved hypothetical protein                     312   5e-100   
ref|XP_011082539.1|  PREDICTED: uncharacterized protein LOC105165276    309   1e-98    Sesamum indicum [beniseed]
emb|CDP03590.1|  unnamed protein product                                309   1e-98    Coffea canephora [robusta coffee]
gb|KHN03771.1|  hypothetical protein glysoja_011000                     303   2e-98    Glycine soja [wild soybean]
ref|XP_006588616.1|  PREDICTED: uncharacterized protein LOC100802371    304   2e-97    Glycine max [soybeans]
gb|KJB23151.1|  hypothetical protein B456_004G083800                    304   6e-97    Gossypium raimondii
ref|XP_002271361.1|  PREDICTED: uncharacterized protein LOC100256341    304   1e-96    Vitis vinifera
gb|KHN18902.1|  hypothetical protein glysoja_028271                     301   2e-96    Glycine soja [wild soybean]
ref|XP_003520217.1|  PREDICTED: uncharacterized protein LOC100791586    301   3e-96    Glycine max [soybeans]
gb|EYU46628.1|  hypothetical protein MIMGU_mgv1a003933mg                302   4e-96    Erythranthe guttata [common monkey flower]
ref|XP_011033673.1|  PREDICTED: uncharacterized protein LOC105132083    300   1e-95    Populus euphratica
ref|XP_007144596.1|  hypothetical protein PHAVU_007G168900g             299   2e-95    Phaseolus vulgaris [French bean]
ref|XP_003591621.1|  hypothetical protein MTR_1g089860                  298   5e-95    
gb|KEH43288.1|  2OG-Fe(II) oxygenase family oxidoreductase              298   9e-95    Medicago truncatula
ref|XP_007050695.1|  Oxidoreductase, 2OG-Fe(II) oxygenase family ...    295   2e-94    
ref|XP_010279049.1|  PREDICTED: uncharacterized protein LOC104613055    297   5e-94    Nelumbo nucifera [Indian lotus]
gb|EPS57869.1|  hypothetical protein M569_16948                         289   1e-93    Genlisea aurea
ref|XP_007162387.1|  hypothetical protein PHAVU_001G147800g             293   3e-93    Phaseolus vulgaris [French bean]
ref|XP_004496294.1|  PREDICTED: uncharacterized protein LOC101493086    293   4e-93    
gb|KDP21510.1|  hypothetical protein JCGZ_21981                         294   6e-93    Jatropha curcas
gb|KHF97715.1|  putative alpha-ketoglutarate-dependent dioxygenas...    294   7e-93    Gossypium arboreum [tree cotton]
ref|XP_004290685.2|  PREDICTED: uncharacterized protein LOC101299256    293   7e-93    Fragaria vesca subsp. vesca
ref|XP_007050694.1|  Transport protein sec31 isoform 1                  295   8e-93    
ref|XP_010255802.1|  PREDICTED: uncharacterized protein LOC104596...    292   5e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010255801.1|  PREDICTED: uncharacterized protein LOC104596...    291   6e-92    Nelumbo nucifera [Indian lotus]
ref|XP_006444148.1|  hypothetical protein CICLE_v10019581mg             291   7e-92    Citrus clementina [clementine]
ref|XP_008234920.1|  PREDICTED: uncharacterized protein LOC103333806    291   1e-91    Prunus mume [ume]
ref|XP_007201711.1|  hypothetical protein PRUPE_ppa003815mg             290   2e-91    Prunus persica
ref|XP_008386575.1|  PREDICTED: uncharacterized protein LOC103449078    286   4e-90    Malus domestica [apple tree]
ref|XP_008775273.1|  PREDICTED: uncharacterized protein LOC103695673    278   7e-90    Phoenix dactylifera
ref|XP_009356724.1|  PREDICTED: uncharacterized protein LOC103947542    286   8e-90    Pyrus x bretschneideri [bai li]
emb|CBI32322.3|  unnamed protein product                                278   2e-89    Vitis vinifera
ref|XP_010696340.1|  PREDICTED: uncharacterized protein LOC104908870    285   2e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004493638.1|  PREDICTED: uncharacterized protein LOC101495753    283   4e-89    Cicer arietinum [garbanzo]
ref|XP_010938799.1|  PREDICTED: uncharacterized protein LOC105057798    283   5e-89    Elaeis guineensis
gb|KHN45381.1|  hypothetical protein glysoja_028388                     277   1e-88    Glycine soja [wild soybean]
gb|KJB42033.1|  hypothetical protein B456_007G133500                    283   1e-88    Gossypium raimondii
gb|KHN19859.1|  hypothetical protein glysoja_033491                     277   1e-88    Glycine soja [wild soybean]
gb|KCW58911.1|  hypothetical protein EUGRSUZ_H01531                     279   1e-88    Eucalyptus grandis [rose gum]
gb|KCW58910.1|  hypothetical protein EUGRSUZ_H01531                     277   4e-88    Eucalyptus grandis [rose gum]
gb|KEH23703.1|  2OG-Fe(II) oxygenase family oxidoreductase              280   7e-88    Medicago truncatula
ref|XP_010905740.1|  PREDICTED: uncharacterized protein LOC105032859    280   7e-88    Elaeis guineensis
ref|XP_006576883.1|  PREDICTED: uncharacterized protein LOC100796344    280   8e-88    
ref|XP_008809229.1|  PREDICTED: uncharacterized protein LOC103721...    280   1e-87    Phoenix dactylifera
ref|XP_008809230.1|  PREDICTED: uncharacterized protein LOC103721...    280   1e-87    Phoenix dactylifera
ref|XP_006604415.1|  PREDICTED: uncharacterized protein LOC100776...    279   2e-87    Glycine max [soybeans]
ref|XP_010070256.1|  PREDICTED: uncharacterized protein LOC104457...    279   2e-87    Eucalyptus grandis [rose gum]
gb|KHG19647.1|  putative alpha-ketoglutarate-dependent dioxygenas...    279   3e-87    Gossypium arboreum [tree cotton]
ref|XP_010070257.1|  PREDICTED: uncharacterized protein LOC104457...    278   7e-87    
ref|XP_010422515.1|  PREDICTED: uncharacterized protein LOC104707789    279   7e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010090348.1|  hypothetical protein L484_025013                   280   2e-86    
ref|XP_006287389.1|  hypothetical protein CARUB_v10000595mg             277   3e-86    Capsella rubella
ref|XP_002321056.1|  oxidoreductase family protein                      276   6e-86    
ref|NP_192203.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    276   6e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874886.1|  oxidoreductase                                     276   7e-86    
ref|XP_006296016.1|  hypothetical protein CARUB_v10025161mg             272   1e-85    Capsella rubella
ref|XP_010430544.1|  PREDICTED: uncharacterized protein LOC104714781    275   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010455955.1|  PREDICTED: uncharacterized protein LOC104737461    274   4e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010506854.1|  PREDICTED: uncharacterized protein LOC104783394    269   3e-84    Camelina sativa [gold-of-pleasure]
ref|XP_004148896.1|  PREDICTED: uncharacterized protein LOC101203670    271   5e-84    
ref|XP_004158952.1|  PREDICTED: uncharacterized LOC101203670            271   5e-84    
gb|KGN44860.1|  hypothetical protein Csa_7G392330                       271   7e-84    Cucumis sativus [cucumbers]
emb|CDY21925.1|  BnaC09g00310D                                          265   1e-83    Brassica napus [oilseed rape]
gb|AFW77933.1|  hypothetical protein ZEAMMB73_473012                    262   2e-83    
ref|NP_182329.2|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    266   2e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AAD13711.1|  unknown protein                                         266   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882147.1|  hypothetical protein ARALYDRAFT_322448             266   2e-83    
ref|XP_008451400.1|  PREDICTED: uncharacterized protein LOC103492703    270   3e-83    Cucumis melo [Oriental melon]
gb|AFW77935.1|  hypothetical protein ZEAMMB73_473012                    263   3e-83    
emb|CDY22086.1|  BnaA09g01150D                                          270   3e-83    Brassica napus [oilseed rape]
ref|NP_001147582.1|  oxidoreductase, 2OG-Fe oxygenase family protein    262   4e-83    
ref|XP_010542876.1|  PREDICTED: uncharacterized protein LOC104815949    268   4e-83    Tarenaya hassleriana [spider flower]
ref|XP_009111249.1|  PREDICTED: uncharacterized protein LOC103836707    269   5e-83    Brassica rapa
ref|XP_006396520.1|  hypothetical protein EUTSA_v10028541mg             266   5e-82    Eutrema salsugineum [saltwater cress]
gb|AFW81533.1|  hypothetical protein ZEAMMB73_697460                    258   5e-82    
dbj|BAJ97023.1|  predicted protein                                      265   1e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009393115.1|  PREDICTED: uncharacterized protein LOC103978888    265   1e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412173.1|  PREDICTED: uncharacterized protein LOC103993726    265   1e-81    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK30895.1|  hypothetical protein AALP_AA6G039900                    264   2e-81    Arabis alpina [alpine rockcress]
gb|KFK37557.1|  hypothetical protein AALP_AA4G272300                    261   4e-81    Arabis alpina [alpine rockcress]
ref|XP_003568474.1|  PREDICTED: uncharacterized protein LOC100841...    263   7e-81    Brachypodium distachyon [annual false brome]
ref|XP_010231391.1|  PREDICTED: uncharacterized protein LOC100841...    263   8e-81    Brachypodium distachyon [annual false brome]
gb|EEE63665.1|  hypothetical protein OsJ_18483                          256   1e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008647787.1|  PREDICTED: oxidoreductase, 2OG-Fe oxygenase ...    261   3e-80    
ref|XP_004962145.1|  PREDICTED: uncharacterized protein LOC101766885    261   6e-80    Setaria italica
ref|XP_009142483.1|  PREDICTED: uncharacterized protein LOC103866...    257   1e-79    Brassica rapa
ref|XP_009142484.1|  PREDICTED: uncharacterized protein LOC103866...    257   2e-79    
ref|XP_002441065.1|  hypothetical protein SORBIDRAFT_09g019740          259   3e-79    Sorghum bicolor [broomcorn]
gb|KCW49947.1|  hypothetical protein EUGRSUZ_K03407                     258   5e-79    Eucalyptus grandis [rose gum]
ref|XP_010038135.1|  PREDICTED: uncharacterized protein LOC104426697    258   8e-79    Eucalyptus grandis [rose gum]
ref|XP_008656187.1|  PREDICTED: uncharacterized protein LOC103635534    258   1e-78    Zea mays [maize]
ref|XP_010524003.1|  PREDICTED: uncharacterized protein LOC104802219    253   4e-78    Tarenaya hassleriana [spider flower]
ref|XP_009402473.1|  PREDICTED: uncharacterized protein LOC103986253    253   1e-77    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT23125.1|  hypothetical protein F775_27644                         248   7e-77    
gb|EEC79195.1|  hypothetical protein OsI_19903                          254   1e-76    Oryza sativa Indica Group [Indian rice]
emb|CDY55191.1|  BnaCnng28350D                                          247   1e-75    Brassica napus [oilseed rape]
ref|XP_006398000.1|  hypothetical protein EUTSA_v10001455mg             244   5e-75    Eutrema salsugineum [saltwater cress]
emb|CDX80147.1|  BnaA05g00090D                                          239   4e-73    
ref|XP_006850838.1|  hypothetical protein AMTR_s00025p00132640          225   9e-69    
ref|XP_007144595.1|  hypothetical protein PHAVU_007G168900g             226   1e-68    Phaseolus vulgaris [French bean]
ref|XP_006655303.1|  PREDICTED: uncharacterized protein LOC102710594    218   2e-67    
gb|KEH43287.1|  2OG-Fe(II) oxygenase family oxidoreductase              221   1e-66    Medicago truncatula
gb|EYU20291.1|  hypothetical protein MIMGU_mgv1a026021mg                201   6e-61    Erythranthe guttata [common monkey flower]
gb|AAT85147.1|  hypothetical protein                                    198   2e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010507817.1|  PREDICTED: uncharacterized protein LOC104784...    191   2e-55    Camelina sativa [gold-of-pleasure]
ref|XP_010507816.1|  PREDICTED: uncharacterized protein LOC104784...    189   6e-55    
ref|XP_010497172.1|  PREDICTED: uncharacterized protein LOC104774212    174   1e-50    Camelina sativa [gold-of-pleasure]
gb|EYU20290.1|  hypothetical protein MIMGU_mgv1a0197391mg               164   1e-46    Erythranthe guttata [common monkey flower]
ref|XP_010241461.1|  PREDICTED: uncharacterized protein LOC104586031    159   2e-41    Nelumbo nucifera [Indian lotus]
ref|XP_010271173.1|  PREDICTED: uncharacterized protein LOC104607267    158   3e-41    Nelumbo nucifera [Indian lotus]
ref|XP_006849434.1|  hypothetical protein AMTR_s00024p00040890          157   6e-41    Amborella trichopoda
ref|XP_006448090.1|  hypothetical protein CICLE_v10014588mg             155   1e-40    
gb|KDO60857.1|  hypothetical protein CISIN_1g006789mg                   154   2e-40    Citrus sinensis [apfelsine]
ref|XP_010648423.1|  PREDICTED: uncharacterized protein LOC100252...    155   4e-40    Vitis vinifera
ref|XP_006448091.1|  hypothetical protein CICLE_v10014588mg             154   4e-40    Citrus clementina [clementine]
ref|XP_006469304.1|  PREDICTED: uncharacterized protein LOC102618872    154   4e-40    Citrus sinensis [apfelsine]
gb|KDO60856.1|  hypothetical protein CISIN_1g006789mg                   154   5e-40    Citrus sinensis [apfelsine]
gb|KDO60855.1|  hypothetical protein CISIN_1g006789mg                   154   6e-40    Citrus sinensis [apfelsine]
ref|XP_004297399.1|  PREDICTED: uncharacterized protein LOC101309147    153   2e-39    Fragaria vesca subsp. vesca
ref|XP_011070538.1|  PREDICTED: uncharacterized protein LOC105156...    151   5e-39    Sesamum indicum [beniseed]
ref|XP_011070539.1|  PREDICTED: uncharacterized protein LOC105156...    151   6e-39    Sesamum indicum [beniseed]
emb|CBI26785.3|  unnamed protein product                                151   8e-39    Vitis vinifera
ref|XP_010648465.1|  PREDICTED: uncharacterized protein LOC100252...    151   8e-39    Vitis vinifera
ref|XP_010648352.1|  PREDICTED: uncharacterized protein LOC100252...    151   8e-39    
ref|XP_008220943.1|  PREDICTED: uncharacterized protein LOC103320980    148   1e-37    Prunus mume [ume]
ref|XP_009351588.1|  PREDICTED: uncharacterized protein LOC103943111    148   1e-37    Pyrus x bretschneideri [bai li]
ref|XP_008365818.1|  PREDICTED: uncharacterized protein LOC103429447    147   2e-37    
emb|CAN65462.1|  hypothetical protein VITISV_002198                     149   2e-37    Vitis vinifera
ref|XP_008381778.1|  PREDICTED: uncharacterized protein LOC103444603    147   3e-37    Malus domestica [apple tree]
ref|XP_010906320.1|  PREDICTED: uncharacterized protein LOC105033...    146   4e-37    Elaeis guineensis
ref|XP_010906319.1|  PREDICTED: uncharacterized protein LOC105033...    146   7e-37    Elaeis guineensis
ref|XP_009390868.1|  PREDICTED: uncharacterized protein LOC103977...    145   9e-37    
ref|XP_009390867.1|  PREDICTED: uncharacterized protein LOC103977...    145   1e-36    
ref|XP_009390865.1|  PREDICTED: uncharacterized protein LOC103977...    145   1e-36    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002527549.1|  conserved hypothetical protein                     145   1e-36    Ricinus communis
ref|XP_009148855.1|  PREDICTED: uncharacterized protein LOC103872267    144   1e-36    
ref|XP_009390866.1|  PREDICTED: uncharacterized protein LOC103977...    145   1e-36    
ref|XP_010553484.1|  PREDICTED: uncharacterized protein LOC104823...    144   1e-36    Tarenaya hassleriana [spider flower]
ref|XP_007225122.1|  hypothetical protein PRUPE_ppa002630mg             145   1e-36    
ref|XP_010553471.1|  PREDICTED: uncharacterized protein LOC104823...    144   2e-36    Tarenaya hassleriana [spider flower]
ref|XP_010553493.1|  PREDICTED: uncharacterized protein LOC104823...    144   2e-36    Tarenaya hassleriana [spider flower]
gb|KDP38170.1|  hypothetical protein JCGZ_04813                         145   2e-36    Jatropha curcas
gb|KJB30648.1|  hypothetical protein B456_005G153400                    144   2e-36    Gossypium raimondii
gb|KJB30646.1|  hypothetical protein B456_005G153400                    144   2e-36    Gossypium raimondii
ref|XP_002311547.2|  hydroxyproline-rich glycoprotein                   144   2e-36    
ref|XP_008795329.1|  PREDICTED: uncharacterized protein LOC103711107    144   2e-36    Phoenix dactylifera
ref|XP_009117880.1|  PREDICTED: uncharacterized protein LOC103842949    142   5e-36    Brassica rapa
ref|XP_008789249.1|  PREDICTED: uncharacterized protein LOC103706...    143   6e-36    Phoenix dactylifera
ref|XP_004142291.1|  PREDICTED: uncharacterized protein LOC101210274    143   9e-36    Cucumis sativus [cucumbers]
gb|ABK95394.1|  unknown                                                 143   9e-36    Populus trichocarpa [western balsam poplar]
ref|XP_006379789.1|  hypothetical protein POPTR_0008s13830g             143   1e-35    
ref|XP_007153188.1|  hypothetical protein PHAVU_003G014200g             142   1e-35    Phaseolus vulgaris [French bean]
ref|XP_008454723.1|  PREDICTED: uncharacterized protein LOC103495...    142   1e-35    
ref|XP_008360022.1|  PREDICTED: uncharacterized protein LOC103423718    142   2e-35    
ref|XP_010476539.1|  PREDICTED: uncharacterized protein LOC104755...    141   2e-35    Camelina sativa [gold-of-pleasure]
ref|XP_010476540.1|  PREDICTED: uncharacterized protein LOC104755...    141   2e-35    Camelina sativa [gold-of-pleasure]
ref|XP_009607025.1|  PREDICTED: uncharacterized protein LOC104101279    141   3e-35    Nicotiana tomentosiformis
ref|XP_010939980.1|  PREDICTED: uncharacterized protein LOC105058678    141   3e-35    Elaeis guineensis
ref|XP_009772695.1|  PREDICTED: uncharacterized protein LOC104223045    140   4e-35    Nicotiana sylvestris
ref|XP_008798368.1|  PREDICTED: uncharacterized protein LOC103713273    141   4e-35    Phoenix dactylifera
emb|CDY45282.1|  BnaA06g09520D                                          140   4e-35    Brassica napus [oilseed rape]
ref|XP_006583757.1|  PREDICTED: uncharacterized protein LOC100781773    140   6e-35    Glycine max [soybeans]
gb|KJB30647.1|  hypothetical protein B456_005G153400                    140   6e-35    Gossypium raimondii
ref|XP_009110517.1|  PREDICTED: uncharacterized protein LOC103836054    139   6e-35    Brassica rapa
ref|XP_006307004.1|  hypothetical protein CARUB_v10008596mg             140   6e-35    Capsella rubella
ref|XP_010458983.1|  PREDICTED: uncharacterized protein LOC104740153    140   7e-35    Camelina sativa [gold-of-pleasure]
emb|CDY41098.1|  BnaC05g10890D                                          139   8e-35    Brassica napus [oilseed rape]
ref|XP_011021727.1|  PREDICTED: uncharacterized protein LOC105123...    139   1e-34    Populus euphratica
ref|XP_011021728.1|  PREDICTED: uncharacterized protein LOC105123...    139   1e-34    Populus euphratica
ref|XP_008454722.1|  PREDICTED: uncharacterized protein LOC103495...    139   2e-34    Cucumis melo [Oriental melon]
ref|XP_011021729.1|  PREDICTED: uncharacterized protein LOC105123...    139   2e-34    Populus euphratica
ref|XP_011021730.1|  PREDICTED: uncharacterized protein LOC105123...    139   2e-34    Populus euphratica
ref|XP_010105545.1|  hypothetical protein L484_019288                   138   4e-34    Morus notabilis
ref|XP_009380066.1|  PREDICTED: uncharacterized protein LOC103968538    138   6e-34    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007158786.1|  hypothetical protein PHAVU_002G181800g             137   8e-34    Phaseolus vulgaris [French bean]
ref|XP_007045468.1|  Hydroxyproline-rich glycoprotein family prot...    137   9e-34    
ref|XP_006355042.1|  PREDICTED: uncharacterized protein LOC102600383    137   1e-33    Solanum tuberosum [potatoes]
ref|XP_007158785.1|  hypothetical protein PHAVU_002G181800g             137   1e-33    Phaseolus vulgaris [French bean]
ref|XP_004236917.1|  PREDICTED: uncharacterized protein LOC101261013    136   2e-33    Solanum lycopersicum
ref|XP_006662146.1|  PREDICTED: uncharacterized protein LOC102714587    135   2e-33    Oryza brachyantha
emb|CDY33746.1|  BnaA09g45520D                                          135   2e-33    Brassica napus [oilseed rape]
emb|CDX81664.1|  BnaC08g39370D                                          135   2e-33    
ref|XP_008787901.1|  PREDICTED: uncharacterized protein LOC103705814    136   3e-33    Phoenix dactylifera
ref|XP_011024628.1|  PREDICTED: uncharacterized protein LOC105125...    136   3e-33    Populus euphratica
ref|XP_011024645.1|  PREDICTED: uncharacterized protein LOC105125...    135   3e-33    Populus euphratica
ref|XP_010936869.1|  PREDICTED: uncharacterized protein LOC105056...    135   3e-33    Elaeis guineensis
ref|XP_010936866.1|  PREDICTED: uncharacterized protein LOC105056...    136   4e-33    Elaeis guineensis
ref|NP_563957.1|  hydroxyproline-rich glycoprotein-like protein         134   4e-33    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19958.1|  AT1G14710                                              134   5e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007045471.1|  Hydroxyproline-rich glycoprotein family prot...    134   7e-33    
ref|XP_006580091.1|  PREDICTED: uncharacterized protein LOC100809...    134   8e-33    Glycine max [soybeans]
ref|XP_009404147.1|  PREDICTED: uncharacterized protein LOC103987...    134   1e-32    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404146.1|  PREDICTED: uncharacterized protein LOC103987...    134   1e-32    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404148.1|  PREDICTED: uncharacterized protein LOC103987...    134   1e-32    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003524142.1|  PREDICTED: uncharacterized protein LOC100809...    134   1e-32    Glycine max [soybeans]
dbj|BAK00235.1|  predicted protein                                      127   2e-32    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010032034.1|  PREDICTED: uncharacterized protein LOC104421...    133   2e-32    Eucalyptus grandis [rose gum]
ref|XP_007045467.1|  Hydroxyproline-rich glycoprotein family prot...    133   2e-32    
ref|XP_010032033.1|  PREDICTED: uncharacterized protein LOC104421...    133   2e-32    Eucalyptus grandis [rose gum]
ref|XP_010032035.1|  PREDICTED: uncharacterized protein LOC104421...    133   3e-32    Eucalyptus grandis [rose gum]
ref|XP_010032032.1|  PREDICTED: uncharacterized protein LOC104421...    133   3e-32    Eucalyptus grandis [rose gum]
ref|XP_010032031.1|  PREDICTED: uncharacterized protein LOC104421...    133   3e-32    Eucalyptus grandis [rose gum]
ref|XP_010032030.1|  PREDICTED: uncharacterized protein LOC104421...    133   3e-32    Eucalyptus grandis [rose gum]
gb|KHN25979.1|  hypothetical protein glysoja_018833                     132   4e-32    Glycine soja [wild soybean]
ref|XP_006605475.1|  PREDICTED: uncharacterized protein LOC100814525    132   5e-32    
gb|KEH40698.1|  hydroxyproline-rich glycoprotein family protein         132   9e-32    Medicago truncatula
ref|XP_006604416.1|  PREDICTED: uncharacterized protein LOC100776...    128   9e-32    
ref|XP_011024636.1|  PREDICTED: uncharacterized protein LOC105125...    132   9e-32    Populus euphratica
ref|XP_011024620.1|  PREDICTED: uncharacterized protein LOC105125...    132   9e-32    Populus euphratica
emb|CDY52029.1|  BnaA08g31420D                                          130   9e-32    Brassica napus [oilseed rape]
ref|XP_006585073.1|  PREDICTED: uncharacterized protein LOC100794176    131   1e-31    Glycine max [soybeans]
gb|KJB60863.1|  hypothetical protein B456_009G328700                    131   1e-31    Gossypium raimondii
gb|KHN28877.1|  hypothetical protein glysoja_025671                     131   1e-31    Glycine soja [wild soybean]
gb|KJB60862.1|  hypothetical protein B456_009G328700                    131   1e-31    Gossypium raimondii
gb|KJB60864.1|  hypothetical protein B456_009G328700                    131   1e-31    Gossypium raimondii
gb|KJB60865.1|  hypothetical protein B456_009G328700                    130   2e-31    Gossypium raimondii
ref|XP_004513244.1|  PREDICTED: uncharacterized protein LOC101507475    130   3e-31    Cicer arietinum [garbanzo]
ref|XP_004513243.1|  PREDICTED: uncharacterized protein LOC101506...    130   3e-31    Cicer arietinum [garbanzo]
ref|XP_004513242.1|  PREDICTED: uncharacterized protein LOC101506...    130   3e-31    Cicer arietinum [garbanzo]
emb|CDX84011.1|  BnaC08g16340D                                          127   1e-30    
gb|KJB60866.1|  hypothetical protein B456_009G328700                    128   2e-30    Gossypium raimondii
ref|XP_006380086.1|  hypothetical protein POPTR_0008s21780g             120   2e-30    
ref|XP_002892824.1|  hypothetical protein ARALYDRAFT_471658             127   3e-30    
gb|EAY77528.1|  hypothetical protein OsI_32569                          127   3e-30    Oryza sativa Indica Group [Indian rice]
ref|NP_001064055.1|  Os10g0116900                                       126   3e-30    
gb|KGN49670.1|  hypothetical protein Csa_5G056090                       124   5e-30    Cucumis sativus [cucumbers]
gb|AAP51882.2|  hydroxyproline-rich glycoprotein family protein, ...    125   1e-29    Oryza sativa Japonica Group [Japonica rice]
gb|EPS61205.1|  hypothetical protein M569_13593                         121   2e-29    Genlisea aurea
gb|KCW51418.1|  hypothetical protein EUGRSUZ_J00953                     124   8e-29    Eucalyptus grandis [rose gum]
gb|AAF79247.1|AC006917_32  F10B6.11                                     123   1e-28    Arabidopsis thaliana [mouse-ear cress]
gb|KEH40700.1|  hydroxyproline-rich glycoprotein family protein         122   3e-28    Medicago truncatula
emb|CDP05487.1|  unnamed protein product                                118   4e-28    Coffea canephora [robusta coffee]
gb|EEC79196.1|  hypothetical protein OsI_19904                          116   7e-28    Oryza sativa Indica Group [Indian rice]
ref|XP_006649704.1|  PREDICTED: uncharacterized protein LOC102720214    120   8e-28    
gb|KJB60867.1|  hypothetical protein B456_009G328700                    116   3e-27    Gossypium raimondii
ref|NP_001049502.1|  Os03g0238800                                       118   3e-27    
gb|EEE58665.1|  hypothetical protein OsJ_10079                          119   3e-27    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74839.1|  hypothetical protein OsI_10686                          118   5e-27    Oryza sativa Indica Group [Indian rice]
gb|ABF94870.1|  hydroxyproline-rich glycoprotein family protein, ...    118   5e-27    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468197.1|  hypothetical protein SORBIDRAFT_01g041520          117   1e-26    
ref|XP_003558397.1|  PREDICTED: uncharacterized protein LOC100828230    117   1e-26    Brachypodium distachyon [annual false brome]
gb|AAT08731.1|  unknown                                                 113   1e-26    Hyacinthus orientalis [common hyacinth]
gb|AGT17402.1|  hypothetical protein SHCRBa_230_N09_F_20                116   2e-26    Saccharum hybrid cultivar R570
gb|AAO72586.1|  unknown                                                 115   2e-26    Oryza sativa Japonica Group [Japonica rice]
emb|CDX69197.1|  BnaC01g02560D                                          112   3e-25    
ref|NP_001077911.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    111   3e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551623.1|  PREDICTED: uncharacterized protein LOC104822175    110   3e-25    Tarenaya hassleriana [spider flower]
ref|NP_179387.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    111   4e-25    Arabidopsis thaliana [mouse-ear cress]
emb|CDX75551.1|  BnaA01g01510D                                          111   5e-25    
ref|NP_001145739.1|  uncharacterized protein LOC100279246               112   7e-25    Zea mays [maize]
ref|XP_002315841.2|  hydroxyproline-rich glycoprotein                   112   1e-24    
emb|CDY43115.1|  BnaC05g36620D                                          110   1e-24    Brassica napus [oilseed rape]
ref|XP_009147305.1|  PREDICTED: RNA demethylase ALKBH5                  109   1e-24    Brassica rapa
ref|XP_006300108.1|  hypothetical protein CARUB_v10016336mg             109   2e-24    Capsella rubella
ref|XP_009119420.1|  PREDICTED: uncharacterized protein LOC103844373    109   2e-24    Brassica rapa
emb|CDY38145.1|  BnaA07g02380D                                          109   2e-24    Brassica napus [oilseed rape]
ref|XP_002867035.1|  oxidoreductase                                     109   2e-24    
gb|KFK30240.1|  hypothetical protein AALP_AA7G235700                    109   3e-24    Arabis alpina [alpine rockcress]
gb|KDP46735.1|  hypothetical protein JCGZ_06523                         109   3e-24    Jatropha curcas
emb|CDY47804.1|  BnaC07g06970D                                          108   5e-24    Brassica napus [oilseed rape]
ref|XP_002886139.1|  oxidoreductase                                     108   7e-24    
ref|XP_006409216.1|  hypothetical protein EUTSA_v10022661mg             107   9e-24    Eutrema salsugineum [saltwater cress]
ref|XP_010489437.1|  PREDICTED: uncharacterized protein LOC104767102    107   1e-23    Camelina sativa [gold-of-pleasure]
ref|XP_006836010.1|  hypothetical protein AMTR_s00220p00028550          105   2e-23    
ref|XP_002530736.1|  conserved hypothetical protein                     107   2e-23    
dbj|BAJ92146.1|  predicted protein                                      108   2e-23    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94215.1|  predicted protein                                      107   2e-23    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25807.1|  hypothetical protein F775_27849                         107   3e-23    
ref|XP_007161116.1|  hypothetical protein PHAVU_001G044000g             107   3e-23    Phaseolus vulgaris [French bean]
gb|KFK40171.1|  hypothetical protein AALP_AA3G339700                    106   3e-23    Arabis alpina [alpine rockcress]
ref|XP_007161115.1|  hypothetical protein PHAVU_001G044000g             106   3e-23    
ref|XP_010679868.1|  PREDICTED: uncharacterized protein LOC104895...    105   4e-23    
ref|XP_010679867.1|  PREDICTED: uncharacterized protein LOC104895...    105   5e-23    
ref|NP_001031793.1|  oxidoreductase, 2OG-Fe(II) oxygenase family ...    103   2e-22    
ref|XP_009614836.1|  PREDICTED: RNA demethylase ALKBH5-like             102   2e-22    
ref|XP_006655769.1|  PREDICTED: RNA demethylase ALKBH5-like             104   3e-22    
ref|XP_004498830.1|  PREDICTED: RNA demethylase ALKBH5-like             103   4e-22    
ref|NP_001031794.1|  oxidoreductase, 2OG-Fe(II) oxygenase family ...    103   4e-22    
ref|XP_009378176.1|  PREDICTED: RNA demethylase ALKBH5                  103   5e-22    
ref|XP_003544576.1|  PREDICTED: uncharacterized protein LOC100797...    103   7e-22    
gb|KEH39890.1|  2OG-Fe(II) oxygenase family oxidoreductase              103   7e-22    
ref|XP_010467592.1|  PREDICTED: uncharacterized protein LOC104747627    102   7e-22    
ref|XP_008337601.1|  PREDICTED: RNA demethylase ALKBH5-like             102   9e-22    
ref|XP_002864601.1|  predicted protein                                  100   1e-21    
gb|KDO71165.1|  hypothetical protein CISIN_1g014257mg                   101   1e-21    
emb|CDP01909.1|  unnamed protein product                                102   1e-21    
ref|XP_006596060.1|  PREDICTED: uncharacterized protein LOC100797...    102   1e-21    
ref|XP_009624002.1|  PREDICTED: uncharacterized protein LOC104115130    102   1e-21    
gb|KDO71166.1|  hypothetical protein CISIN_1g014257mg                   101   1e-21    
ref|XP_008344233.1|  PREDICTED: RNA demethylase ALKBH5-like             102   1e-21    
ref|XP_002970980.1|  hypothetical protein SELMODRAFT_94921              100   1e-21    
ref|XP_011462338.1|  PREDICTED: RNA demethylase ALKBH5                  102   1e-21    
gb|EEC79953.1|  hypothetical protein OsI_21553                          102   2e-21    
ref|NP_001056738.1|  Os06g0138200                                       102   2e-21    
gb|EEE65054.1|  hypothetical protein OsJ_20056                          102   2e-21    
ref|XP_006340730.1|  PREDICTED: uncharacterized protein LOC102587862    102   2e-21    
ref|XP_002962106.1|  hypothetical protein SELMODRAFT_64626            99.4    2e-21    
ref|XP_006425503.1|  hypothetical protein CICLE_v10025381mg             101   2e-21    
ref|XP_006466940.1|  PREDICTED: uncharacterized protein LOC102616828    101   3e-21    
ref|XP_002268446.1|  PREDICTED: uncharacterized protein LOC100250563    100   4e-21    
ref|XP_004134867.1|  PREDICTED: uncharacterized protein LOC101203292    100   4e-21    
emb|CBI17383.3|  unnamed protein product                                101   4e-21    
ref|XP_008440812.1|  PREDICTED: uncharacterized protein LOC103485120    100   4e-21    
ref|XP_004232485.1|  PREDICTED: uncharacterized protein LOC101258324    100   4e-21    
ref|XP_011043204.1|  PREDICTED: uncharacterized protein LOC105138728    100   4e-21    
ref|XP_010548289.1|  PREDICTED: uncharacterized protein LOC104819751    100   4e-21    
ref|XP_009782458.1|  PREDICTED: uncharacterized protein LOC104231202    101   4e-21    
ref|XP_010268476.1|  PREDICTED: uncharacterized protein LOC104605415    100   5e-21    
ref|XP_003549324.1|  PREDICTED: uncharacterized protein LOC100787321    100   6e-21    
ref|XP_011025958.1|  PREDICTED: uncharacterized protein LOC105126709    100   6e-21    
gb|EMS46531.1|  putative alpha-ketoglutarate-dependent dioxygenas...  99.8    6e-21    
emb|CAN80815.1|  hypothetical protein VITISV_020466                     101   7e-21    
ref|XP_006383115.1|  hypothetical protein POPTR_0005s11690g           99.8    9e-21    
ref|XP_010243859.1|  PREDICTED: uncharacterized protein LOC104587820  99.0    1e-20    
gb|KHF97981.1|  putative alpha-ketoglutarate-dependent dioxygenas...  99.8    1e-20    
ref|XP_007046709.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  99.4    2e-20    
ref|XP_003561203.1|  PREDICTED: uncharacterized protein LOC100826719  99.8    2e-20    
ref|XP_007201945.1|  hypothetical protein PRUPE_ppa004512mg           99.0    2e-20    
ref|XP_010033483.1|  PREDICTED: uncharacterized protein LOC104422...  99.0    2e-20    
ref|XP_010242777.1|  PREDICTED: uncharacterized protein LOC104587...  98.2    2e-20    
ref|XP_010033484.1|  PREDICTED: uncharacterized protein LOC104422...  99.0    2e-20    
ref|XP_011099832.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  98.6    2e-20    
gb|KJB43348.1|  hypothetical protein B456_007G195400                  98.6    2e-20    
gb|KJB43349.1|  hypothetical protein B456_007G195400                  98.6    2e-20    
ref|XP_010242775.1|  PREDICTED: uncharacterized protein LOC104587...  98.2    3e-20    
ref|XP_010113359.1|  putative alpha-ketoglutarate-dependent dioxy...  98.6    3e-20    
gb|ABL85031.1|  oxidoreductase                                        99.0    3e-20    
ref|XP_009601424.1|  PREDICTED: uncharacterized protein LOC104096717  97.4    3e-20    
ref|XP_006283482.1|  hypothetical protein CARUB_v10004530mg           98.6    4e-20    
ref|XP_008241812.1|  PREDICTED: uncharacterized protein LOC103340199  98.2    4e-20    
ref|XP_010934517.1|  PREDICTED: uncharacterized protein LOC105054646  97.8    6e-20    
ref|XP_009384228.1|  PREDICTED: RNA demethylase ALKBH5-like           95.9    8e-20    
ref|XP_006847052.1|  hypothetical protein AMTR_s00017p00191520        96.3    9e-20    
ref|XP_006431884.1|  hypothetical protein CICLE_v10001432mg           95.5    9e-20    
ref|XP_010437382.1|  PREDICTED: uncharacterized protein LOC104721166  96.7    1e-19    
ref|XP_009786421.1|  PREDICTED: uncharacterized protein LOC104234545  97.1    1e-19    
emb|CBI23813.3|  unnamed protein product                              95.9    1e-19    
ref|XP_010671371.1|  PREDICTED: RNA demethylase ALKBH5-like           95.9    1e-19    
ref|XP_002270229.1|  PREDICTED: RNA demethylase ALKBH5-like           95.9    1e-19    
gb|KDP38875.1|  hypothetical protein JCGZ_05032                       95.9    2e-19    
ref|XP_004233982.2|  PREDICTED: uncharacterized protein LOC101253354  97.1    2e-19    
ref|XP_010446824.1|  PREDICTED: uncharacterized protein LOC104729570  95.9    2e-19    
ref|XP_010912045.1|  PREDICTED: RNA demethylase ALKBH5-like           95.1    2e-19    
gb|EMS64043.1|  hypothetical protein TRIUR3_22731                     94.0    3e-19    
ref|XP_008352856.1|  PREDICTED: RNA demethylase ALKBH5-like           94.0    3e-19    
ref|XP_002891469.1|  hypothetical protein ARALYDRAFT_314327           93.6    3e-19    
ref|XP_008659316.1|  PREDICTED: uncharacterized protein LOC103638...  95.5    4e-19    
ref|XP_008659315.1|  PREDICTED: uncharacterized protein LOC103638...  95.5    4e-19    
ref|NP_175328.2|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  93.2    4e-19    
ref|XP_006416980.1|  hypothetical protein EUTSA_v10007113mg           95.5    5e-19    
ref|NP_001031159.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  92.8    5e-19    
gb|KHG21069.1|  putative alpha-ketoglutarate-dependent dioxygenas...  94.0    6e-19    
gb|KHG27343.1|  putative alpha-ketoglutarate-dependent dioxygenas...  94.0    6e-19    
ref|XP_007225739.1|  hypothetical protein PRUPE_ppa007067mg           93.2    6e-19    
ref|XP_009800011.1|  PREDICTED: uncharacterized protein LOC104245...  94.0    7e-19    
ref|XP_006833362.1|  hypothetical protein AMTR_s00109p00099300        92.0    9e-19    
ref|XP_006349376.1|  PREDICTED: RNA demethylase ALKBH5-like           93.6    1e-18    
ref|XP_004964485.1|  PREDICTED: uncharacterized protein LOC101778515  94.4    1e-18    
ref|XP_009800010.1|  PREDICTED: uncharacterized protein LOC104245...  93.6    1e-18    
ref|XP_009382648.1|  PREDICTED: uncharacterized protein LOC103970557  94.4    1e-18    
ref|XP_007041489.1|  Oxidoreductase, putative                         93.2    1e-18    
ref|XP_004963362.1|  PREDICTED: RNA demethylase ALKBH5-like           92.0    1e-18    
ref|XP_008339354.1|  PREDICTED: LOW QUALITY PROTEIN: RNA demethyl...  92.0    1e-18    
gb|EMT02466.1|  Alkylated DNA repair alkB-5-like protein              93.2    1e-18    
ref|XP_004230494.1|  PREDICTED: uncharacterized protein LOC101254...  92.4    2e-18    
ref|XP_008779445.1|  PREDICTED: uncharacterized protein LOC103699169  92.8    2e-18    
ref|XP_008366483.1|  PREDICTED: RNA demethylase ALKBH5-like           91.7    2e-18    
ref|XP_002310305.2|  hypothetical protein POPTR_0007s14120g           93.2    2e-18    
ref|XP_009147926.1|  PREDICTED: uncharacterized protein LOC103871...  91.3    2e-18    
ref|XP_009147925.1|  PREDICTED: uncharacterized protein LOC103871...  91.3    2e-18    
gb|EYU30802.1|  hypothetical protein MIMGU_mgv1a012173mg              90.5    2e-18    
ref|XP_004230493.1|  PREDICTED: uncharacterized protein LOC101254...  92.4    2e-18    
ref|XP_008218793.1|  PREDICTED: uncharacterized protein LOC103319079  92.8    3e-18    
gb|KJB77860.1|  hypothetical protein B456_012G161400                  91.3    4e-18    
ref|XP_006471082.1|  PREDICTED: uncharacterized protein LOC102630212  91.7    4e-18    
ref|XP_006361929.1|  PREDICTED: uncharacterized protein LOC102582149  92.8    5e-18    
gb|KDO40724.1|  hypothetical protein CISIN_1g025324mg                 89.4    5e-18    
ref|XP_008790040.1|  PREDICTED: RNA demethylase ALKBH5-like           92.0    7e-18    
ref|XP_007148511.1|  hypothetical protein PHAVU_006G214800g           90.5    9e-18    
gb|ABR16610.1|  unknown                                               91.3    9e-18    
emb|CDY62847.1|  BnaA06g03370D                                        91.3    1e-17    
emb|CDY51173.1|  BnaC06g02430D                                        91.3    1e-17    
ref|XP_010432201.1|  PREDICTED: uncharacterized protein LOC104716518  90.9    1e-17    
gb|KJB77859.1|  hypothetical protein B456_012G161400                  90.5    1e-17    
ref|XP_002447374.1|  hypothetical protein SORBIDRAFT_06g033940        88.2    2e-17    
ref|XP_010240660.1|  PREDICTED: RNA demethylase ALKBH5-like           88.2    3e-17    
ref|XP_003593039.1|  Alkylated DNA repair protein alkB-like protein   88.2    1e-16    
ref|XP_006585483.1|  PREDICTED: RNA demethylase ALKBH5 isoform X2     87.0    1e-16    
ref|XP_005643412.1|  hypothetical protein COCSUDRAFT_20284            84.7    2e-16    
ref|XP_003531587.1|  PREDICTED: RNA demethylase ALKBH5 isoform X1     86.3    3e-16    
ref|XP_004485500.1|  PREDICTED: RNA demethylase ALKBH5-like           86.7    3e-16    
gb|KHN01749.1|  hypothetical protein glysoja_047936                   87.0    4e-16    
ref|XP_003593035.1|  Alkylated DNA repair protein alkB-like protein   84.7    8e-16    
ref|XP_002985931.1|  hypothetical protein SELMODRAFT_446423           85.9    9e-16    
gb|KJB77862.1|  hypothetical protein B456_012G161400                  84.3    9e-16    
ref|NP_001117455.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  83.2    1e-15    
ref|XP_002984873.1|  hypothetical protein SELMODRAFT_446040           85.1    2e-15    
gb|EPS59397.1|  hypothetical protein M569_15411                       83.6    2e-15    
ref|XP_006839089.1|  hypothetical protein AMTR_s00090p00120450        82.0    4e-15    
emb|CAA18503.1|  hypothetical protein                                 83.6    4e-15    
gb|KFK36051.1|  hypothetical protein AALP_AA4G071500                  81.6    2e-14    
ref|XP_002990560.1|  hypothetical protein SELMODRAFT_428958           79.3    1e-13    
ref|XP_006828361.1|  hypothetical protein AMTR_s00023p00252870        75.1    2e-13    
gb|KJB43347.1|  hypothetical protein B456_007G195400                  77.8    3e-13    
ref|XP_002507938.1|  predicted protein                                78.2    3e-13    
ref|XP_002983652.1|  hypothetical protein SELMODRAFT_422939           77.8    4e-13    
gb|KJB42034.1|  hypothetical protein B456_007G133500                  75.1    1e-12    
gb|EJK62658.1|  hypothetical protein THAOC_16720                      72.4    1e-11    
gb|EMS54128.1|  putative alpha-ketoglutarate-dependent dioxygenas...  68.9    3e-11    
ref|NP_195332.2|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...  67.8    5e-10    
gb|KDO71167.1|  hypothetical protein CISIN_1g014257mg                 65.9    2e-09    
ref|XP_006425502.1|  hypothetical protein CICLE_v10025381mg           65.9    3e-09    
ref|XP_007046710.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  65.5    3e-09    
ref|XP_008789251.1|  PREDICTED: uncharacterized protein LOC103706...  65.5    3e-09    
gb|KJB43346.1|  hypothetical protein B456_007G195400                  65.1    4e-09    
gb|KCW53142.1|  hypothetical protein EUGRSUZ_J02428                   64.3    8e-09    
ref|XP_003082714.1|  unnamed protein product                          62.8    3e-08    
ref|XP_009147927.1|  PREDICTED: uncharacterized protein LOC103871...  60.5    8e-08    
ref|XP_009147928.1|  PREDICTED: uncharacterized protein LOC103871...  60.1    8e-08    
gb|AAF69711.1|AC016041_16  F27J15.23                                  60.5    9e-08    
ref|XP_006380085.1|  hypothetical protein POPTR_0008s21770g           55.8    4e-07    
ref|XP_010088512.1|  hypothetical protein L484_009996                 58.9    5e-07    
ref|XP_006393323.1|  hypothetical protein EUTSA_v10012104mg           58.5    8e-07    
gb|KJB77861.1|  hypothetical protein B456_012G161400                  57.4    2e-06    
emb|CDX69196.1|  BnaC01g02570D                                        50.8    3e-05    



>ref|XP_006358433.1| PREDICTED: uncharacterized protein LOC102603657 [Solanum tuberosum]
Length=548

 Score =   353 bits (905),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 185/201 (92%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELRV GQNGELSGETFILYNQQ+KG+KRELIQLG PIF +VKED ACQKS NEPIP +L
Sbjct  246  NELRVAGQNGELSGETFILYNQQVKGSKRELIQLGAPIFEHVKEDAACQKSHNEPIPALL  305

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+HLIQWHLISENRRPN CIINFFDEGEYSQPFLKPPHLEQPVSTL+L++S MAFGR
Sbjct  306  QGVINHLIQWHLISENRRPNSCIINFFDEGEYSQPFLKPPHLEQPVSTLVLADSMMAFGR  365

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL CDS+GNY+GSL+LSLKEGSLLVMRGNSADMARHAMCSSPN+RV+ITFFK+RT + NN
Sbjct  366  TLVCDSEGNYKGSLMLSLKEGSLLVMRGNSADMARHAMCSSPNKRVTITFFKVRTEMGNN  425

Query  543  SAEVVPPLTRAMTLWQPGIPS  605
             +E   PLTRAMT+WQPG+P+
Sbjct  426  FSEAA-PLTRAMTIWQPGVPT  445



>ref|XP_009599211.1| PREDICTED: uncharacterized protein LOC104094898 [Nicotiana tomentosiformis]
Length=548

 Score =   351 bits (901),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 184/201 (92%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELRV GQNGELSGETFILYNQQ+KG+KRELIQLG PIFG+VKED   QKS+NEPIP +L
Sbjct  246  NELRVAGQNGELSGETFILYNQQVKGSKRELIQLGAPIFGHVKEDTTYQKSNNEPIPALL  305

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            E VIDHLIQWHLISE+RRPN CIINFFDEGEYSQPFLKPPHLEQPVSTLLL+ES MAFGR
Sbjct  306  EGVIDHLIQWHLISESRRPNSCIINFFDEGEYSQPFLKPPHLEQPVSTLLLAESMMAFGR  365

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+GSL+LSLKEGSLLVMRGNSADMARHAMCSSPN+RV+ITFFK+RT + NN
Sbjct  366  SLVSDSEGNYKGSLMLSLKEGSLLVMRGNSADMARHAMCSSPNKRVTITFFKVRTEIGNN  425

Query  543  SAEVVPPLTRAMTLWQPGIPS  605
              EV  PLTRAMTLWQPG+P+
Sbjct  426  FPEVA-PLTRAMTLWQPGVPT  445



>ref|XP_004247488.1| PREDICTED: uncharacterized protein LOC101267646 [Solanum lycopersicum]
Length=549

 Score =   345 bits (885),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELRV GQNGELSGETFILYNQQ+KG+KRELIQLG PIF +VKED  CQKS NEPIP +L
Sbjct  247  NELRVAGQNGELSGETFILYNQQVKGSKRELIQLGAPIFEHVKEDATCQKSHNEPIPALL  306

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+HLIQWHLISE+RRPN CIINFFDEGE+SQPFLKPPHLEQPVSTL+L++S MAFGR
Sbjct  307  QGVINHLIQWHLISESRRPNSCIINFFDEGEFSQPFLKPPHLEQPVSTLVLADSMMAFGR  366

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL CDS+GNY+GSL+LSLKEGSLLVMRGNSADMARHAMCSSPN+RV+ITFFK+RT +  N
Sbjct  367  TLVCDSEGNYKGSLMLSLKEGSLLVMRGNSADMARHAMCSSPNKRVTITFFKVRTEMGTN  426

Query  543  SAEVVPPLTRAMTLWQPGIPS  605
             +E   PLTRAMT+WQPG+P+
Sbjct  427  FSEAA-PLTRAMTIWQPGVPT  446



>ref|XP_009769229.1| PREDICTED: uncharacterized protein LOC104220112 [Nicotiana sylvestris]
Length=544

 Score =   345 bits (884),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 182/201 (91%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELRV GQNGELSGETFILYNQQ+KG+KRELIQLG PIFG+VKED   QKS+NEPIP +L
Sbjct  242  NELRVAGQNGELSGETFILYNQQVKGSKRELIQLGAPIFGHVKEDATNQKSNNEPIPALL  301

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            E VIDHLIQWHLISE+RRPN CIIN FDEGEYSQPFLKPPHLEQPVSTL+L+ES MAFGR
Sbjct  302  EGVIDHLIQWHLISESRRPNSCIINLFDEGEYSQPFLKPPHLEQPVSTLILAESMMAFGR  361

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+GSL+LSLKEGSLLVMRGNSADMARHAMCSSPN+RV+ITFFK+R  + NN
Sbjct  362  SLVSDSEGNYKGSLMLSLKEGSLLVMRGNSADMARHAMCSSPNKRVTITFFKVRIEIGNN  421

Query  543  SAEVVPPLTRAMTLWQPGIPS  605
              EV  PLTRAMTLWQPG+P+
Sbjct  422  FPEVS-PLTRAMTLWQPGVPT  441



>ref|XP_009607167.1| PREDICTED: uncharacterized protein LOC104101431 [Nicotiana tomentosiformis]
Length=540

 Score =   340 bits (872),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR  GQNG+LSGETF+L+NQQ+KGNKRELIQ GTPIF ++KE+   QKS+ EPIP +L
Sbjct  247  NELRAAGQNGDLSGETFVLFNQQVKGNKRELIQFGTPIFRHIKEEATYQKSNIEPIPALL  306

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQWHLIS++RRPN CIINFFDEGEYSQPFLKPPHL+QPVSTLLLSES MAFGR
Sbjct  307  QGVIDHLIQWHLISDSRRPNSCIINFFDEGEYSQPFLKPPHLDQPVSTLLLSESMMAFGR  366

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL CDSDGNY+GS +LSLKEGSLLVMRGNSADMARHA+CSS ++RV+ITFFK+RT +++ 
Sbjct  367  TLVCDSDGNYKGSFMLSLKEGSLLVMRGNSADMARHALCSSASKRVAITFFKVRTKMDSF  426

Query  543  SAEVVPPLTRAMTLWQPGIPS  605
            S+E VPPLTRAMTLWQPG+P+
Sbjct  427  SSE-VPPLTRAMTLWQPGVPT  446



>ref|XP_009774650.1| PREDICTED: uncharacterized protein LOC104224666 [Nicotiana sylvestris]
Length=540

 Score =   340 bits (872),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR  GQNG+LSGETF+L+NQQ+KGNKRELIQLGTPIF ++KE+  CQKS+ EPIP +L
Sbjct  247  NELRAAGQNGDLSGETFVLFNQQVKGNKRELIQLGTPIFRHIKEEATCQKSNIEPIPALL  306

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQWHLIS+ RRPN CIINFFDEGEYSQPFLKPPHL+QPVSTLLLSES MAFGR
Sbjct  307  QGVIDHLIQWHLISDTRRPNSCIINFFDEGEYSQPFLKPPHLDQPVSTLLLSESMMAFGR  366

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL CDSDGNY+GS +LSLKEGSLLVMRGNSADMARHA+CSS ++RV+ITFFK+RT +++ 
Sbjct  367  TLVCDSDGNYKGSCMLSLKEGSLLVMRGNSADMARHALCSSASKRVAITFFKVRTEMDSF  426

Query  543  SAEVVPPLTRAMTLWQPGIPS  605
             +E VPPLTRAMTLWQPG+P+
Sbjct  427  FSE-VPPLTRAMTLWQPGVPT  446



>ref|XP_010323031.1| PREDICTED: uncharacterized protein LOC101258968 [Solanum lycopersicum]
Length=510

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 187/212 (88%), Gaps = 3/212 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +ELRV GQNG+LSGETFIL+NQQ+KGNKRE+IQLGTPIFG++KE+  CQKS+ EPIP +L
Sbjct  215  DELRVAGQNGDLSGETFILFNQQVKGNKREMIQLGTPIFGHIKEEAMCQKSNIEPIPALL  274

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW+LISE+RRPN C+IN+FDEGEYSQPF+KPPHL+QPVSTLLLSES MAFGR
Sbjct  275  QGVIDHLIQWNLISESRRPNSCVINYFDEGEYSQPFMKPPHLDQPVSTLLLSESMMAFGR  334

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVEN-  539
             L  DSDGNY+GS +LSLK+GSLLVMRGNSADMARHA+CSS ++RV+ITFFK+RT + N 
Sbjct  335  ALVSDSDGNYKGSFMLSLKQGSLLVMRGNSADMARHALCSSASKRVAITFFKVRTEMNNF  394

Query  540  NSAEVVPPLTRAMTLWQPGIPS--SPYNGTPD  629
             S + +PPLT+AMTLWQPG+P+  S  NG  +
Sbjct  395  VSDQKIPPLTKAMTLWQPGVPTHYSTANGAAN  426



>ref|XP_006352790.1| PREDICTED: uncharacterized protein LOC102602285 [Solanum tuberosum]
Length=514

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 186/212 (88%), Gaps = 3/212 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR  GQNG+LSGETFIL+NQQ+KGNKRE+IQLGTPIFG++KE+  CQKS+ EPIP +L
Sbjct  219  NELRFAGQNGDLSGETFILFNQQVKGNKREMIQLGTPIFGHIKEEAMCQKSNIEPIPALL  278

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW+LISE+RRPN C+IN+FDEGEYSQPF+KPPHL+QPVSTLLLSES MAFGR
Sbjct  279  QGVIDHLIQWNLISESRRPNSCVINYFDEGEYSQPFMKPPHLDQPVSTLLLSESMMAFGR  338

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVEN-  539
             L  DSDGNY+GS +LSLK+GSLL+MRGNSADMARHA+CSS ++RV+ITFFK+RT + N 
Sbjct  339  ALVSDSDGNYKGSFMLSLKQGSLLIMRGNSADMARHALCSSASKRVAITFFKVRTEMNNF  398

Query  540  NSAEVVPPLTRAMTLWQPGIPS--SPYNGTPD  629
             S + +PPLT+AMTLWQPG+P+  S  NG  +
Sbjct  399  VSDQQIPPLTKAMTLWQPGVPTHYSTANGAAN  430



>ref|XP_011079798.1| PREDICTED: uncharacterized protein LOC105163227 [Sesamum indicum]
Length=544

 Score =   312 bits (799),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 175/203 (86%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLA--CQKSSNEPIPT  176
            NEL+V G+NGELSGETFILYNQQ KGN+REL+QLG PIFG++KED     QKS  EPIP 
Sbjct  250  NELQVAGRNGELSGETFILYNQQTKGNRRELVQLGVPIFGHIKEDETNKFQKSYIEPIPA  309

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L  VIDHLIQW LI E+R+PN CIINFFDEGEYSQPFLKPPHLEQP+STLLLSESTMAF
Sbjct  310  LLRGVIDHLIQWRLIPESRKPNSCIINFFDEGEYSQPFLKPPHLEQPLSTLLLSESTMAF  369

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L  D +GNYRG L+LSLKEGSLLVMRGNS+D ARH MCSS N+RVSITFF++RT V+
Sbjct  370  GRMLVSDGEGNYRGPLMLSLKEGSLLVMRGNSSDTARHVMCSSLNKRVSITFFRVRT-VD  428

Query  537  NNSAEVVPPLTRAMTLWQPGIPS  605
            +N +E+  PL++AMTLWQPG+PS
Sbjct  429  SNPSEIT-PLSKAMTLWQPGVPS  450



>ref|XP_002524804.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37647.1| conserved hypothetical protein [Ricinus communis]
Length=550

 Score =   312 bits (799),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQK--SSNEPIPT  176
            NELRV GQNGEL GETFIL+N+Q+KGNKRELIQLG PIFG++KE+ + +K  SS EPIP 
Sbjct  248  NELRVAGQNGELEGETFILFNKQMKGNKRELIQLGIPIFGHIKEEASSKKQTSSIEPIPA  307

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VIDHLIQW LI E ++PNGCII+FFDE EYSQPF KPPHLEQP+STLLLSESTMAF
Sbjct  308  LLQHVIDHLIQWQLIPEYKKPNGCIIHFFDEEEYSQPFQKPPHLEQPISTLLLSESTMAF  367

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GRTL  D+DGNYRG L+LSLKEGSLLVMRGNS+DMARH MC SPN+RVSITFFK+R    
Sbjct  368  GRTLVSDNDGNYRGPLMLSLKEGSLLVMRGNSSDMARHVMCPSPNKRVSITFFKVRPDAY  427

Query  537  NNSAEVVPPLTRAMTLWQPGIPSSPY  614
               +    P+  AMTLWQPG+P SPY
Sbjct  428  QGQSPPTSPMAGAMTLWQPGVP-SPY  452



>ref|XP_011082539.1| PREDICTED: uncharacterized protein LOC105165276 [Sesamum indicum]
Length=555

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLA--CQKSSNEPIPT  176
            NEL+V G+NGELSGETFILYNQQ+KGNKRELIQLG PIFG +KED +   QKS  EPIP 
Sbjct  259  NELKVAGRNGELSGETFILYNQQMKGNKRELIQLGVPIFGQIKEDASNKFQKSHIEPIPA  318

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VI+HL QWHLI E R+PN CIINFFDEGEYSQPFLKPPHL+QP++TLLLS+STMAF
Sbjct  319  LLQGVINHLTQWHLIPETRKPNSCIINFFDEGEYSQPFLKPPHLDQPLATLLLSQSTMAF  378

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L  DS+GNYRG L L L+EGSLLVMRGNS+D ARHAMCSS N+R SITFF++R   E
Sbjct  379  GRALVSDSEGNYRGPLTLPLREGSLLVMRGNSSDTARHAMCSSENKRASITFFRVRIETE  438

Query  537  NNSAEVVPPLTRAMTLWQPGIPSSPY  614
             N +E+  PL+++MTLWQ G+ ++PY
Sbjct  439  TNLSEITTPLSKSMTLWQSGV-ANPY  463



>emb|CDP03590.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLA-CQKSSNEPIPTI  179
            NE+RV GQNGELSGETFILYNQQ+KGNKRE+IQLG PIFG + E  + C KS  EPIP +
Sbjct  264  NEIRVAGQNGELSGETFILYNQQMKGNKREMIQLGVPIFGQINEATSKCPKSHIEPIPAL  323

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L+ V+DHLIQWH+IS+N+RPNGCIINFFDEGEYSQPFLKPPHL+QP+STLLLS+STMAFG
Sbjct  324  LQGVVDHLIQWHIISDNKRPNGCIINFFDEGEYSQPFLKPPHLDQPISTLLLSQSTMAFG  383

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVEN  539
            RTL   ++GNYRG L+L +KEGSL+VMR NSAD+ARH MCSSPN+RVSITFFK+R   E+
Sbjct  384  RTLVNGNEGNYRGPLMLPVKEGSLVVMRANSADVARHVMCSSPNKRVSITFFKVRMEEES  443

Query  540  NSAEVVPPLTRAMTLWQPGIPS  605
                   P T AMT+WQPG+P+
Sbjct  444  TLMPTASP-TSAMTVWQPGVPT  464



>gb|KHN03771.1| hypothetical protein glysoja_011000 [Glycine soja]
Length=386

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 168/204 (82%), Gaps = 3/204 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +KED    KS+ EPIP +L
Sbjct  95   NEIHAAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKED---AKSNIEPIPALL  151

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW L+ E +RPNGCIINFF+EGE+SQPFLKPPHL+QPVSTLLLSESTMAFGR
Sbjct  152  QGVIDHLIQWQLLPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPVSTLLLSESTMAFGR  211

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L LSLK+GSLLVMRGNSADMARH MC SPNRRVSITFF++R      
Sbjct  212  ILMSENDGNYKGPLTLSLKQGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVRPDSNQC  271

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
             +     +T AMT+WQPGI +SPY
Sbjct  272  QSPTPTTMTSAMTVWQPGIAASPY  295



>ref|XP_006588616.1| PREDICTED: uncharacterized protein LOC100802371 [Glycine max]
Length=511

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 167/204 (82%), Gaps = 3/204 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +KED  C   + EPIP +L
Sbjct  220  NEIHAAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKEDAKC---NIEPIPALL  276

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW L+ E +RPNGCIINFF+EGE+SQPFLKPPHL+QPVSTLLLSESTMAFGR
Sbjct  277  QGVIDHLIQWQLLPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPVSTLLLSESTMAFGR  336

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L LSLK+GSLLVMRGNSADMARH MC SPNRRVSITFF++R      
Sbjct  337  ILMSENDGNYKGPLTLSLKQGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVRPDSNQC  396

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
             +     +T AMT+WQPGI +SPY
Sbjct  397  QSPTPTTMTSAMTVWQPGIAASPY  420



>gb|KJB23151.1| hypothetical protein B456_004G083800 [Gossypium raimondii]
Length=555

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 169/206 (82%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC--QKSSNEPIPT  176
            +ELR  GQNGELSGETFIL+N+QIKGNKRELIQ G PIFG++KE+L    Q  + EPIP 
Sbjct  251  SELRSSGQNGELSGETFILFNKQIKGNKRELIQFGVPIFGHIKEELTSNNQTINIEPIPA  310

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VI+HLIQW LI E ++PNGCIINFFDE EYSQPFLKPPHLEQP+STLLLSESTMAF
Sbjct  311  LLQDVIEHLIQWQLIPEYKKPNGCIINFFDEDEYSQPFLKPPHLEQPISTLLLSESTMAF  370

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GRTL  DS+GNYRG L LSLKEGSLLVMRGNS+DMARH MC SPN+RVSITFF++R  + 
Sbjct  371  GRTLTSDSEGNYRGPLQLSLKEGSLLVMRGNSSDMARHVMCPSPNKRVSITFFRVRPDIN  430

Query  537  NNSAEVVPPLTRAMTLWQPGIPSSPY  614
               +    P + AMTLWQPG+P  PY
Sbjct  431  QGQSPPTTPQSGAMTLWQPGVP-GPY  455



>ref|XP_002271361.1| PREDICTED: uncharacterized protein LOC100256341 [Vitis vinifera]
Length=557

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 170/209 (81%), Gaps = 13/209 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +ELR+ GQNGELSGETFILYN+QIKGNKRELIQ G PIFG + E   C   + EPIP +L
Sbjct  252  DELRIAGQNGELSGETFILYNKQIKGNKRELIQFGVPIFGQISE--GC---NGEPIPALL  306

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW LI E ++PN CIINFFDEGEYSQPFLKPPHLEQP+STLLLSESTMAFGR
Sbjct  307  QNVIDHLIQWELIPEYKKPNNCIINFFDEGEYSQPFLKPPHLEQPISTLLLSESTMAFGR  366

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR------  524
             L  D+DGN++G  +L+LKEGSL+VMRGNSADMARH MC S N+RVSITFF++R      
Sbjct  367  VLGSDNDGNFKGPFMLTLKEGSLIVMRGNSADMARHVMCPSSNKRVSITFFRVRTETNRD  426

Query  525  --TCVENNSAEVVPPLTRAMTLWQPGIPS  605
              T V  + ++V PPLT+A+TLWQPG+P+
Sbjct  427  QLTPVNKDRSQVTPPLTKAITLWQPGVPT  455



>gb|KHN18902.1| hypothetical protein glysoja_028271 [Glycine soja]
Length=492

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 171/206 (83%), Gaps = 7/206 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +KED    KS+ EPIP +L
Sbjct  193  NEIHAAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKED---AKSNIEPIPVLL  249

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW L+ E +RPNGCIINFF++GE+SQPFLKPPHL+QPVSTLLLSES MAFGR
Sbjct  250  QGVIDHLIQWQLLPEYKRPNGCIINFFEKGEFSQPFLKPPHLDQPVSTLLLSESAMAFGR  309

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L LSLK+GSLLVMRGNSADMARH MC SPNRRVSITFF++R   ++N
Sbjct  310  ILMSENDGNYKGPLTLSLKQGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVRP--DSN  367

Query  543  SAEVVPP--LTRAMTLWQPGIPSSPY  614
              +   P  +T AMT+WQPGI +SPY
Sbjct  368  QCQTPTPTTMTSAMTMWQPGIAASPY  393



>ref|XP_003520217.1| PREDICTED: uncharacterized protein LOC100791586 [Glycine max]
Length=514

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 171/206 (83%), Gaps = 7/206 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +KED    KS+ EPIP +L
Sbjct  215  NEIHAAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKED---AKSNIEPIPVLL  271

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW L+ E +RPNGCIINFF++GE+SQPFLKPPHL+QPVSTLLLSES MAFGR
Sbjct  272  QGVIDHLIQWQLLPEYKRPNGCIINFFEKGEFSQPFLKPPHLDQPVSTLLLSESAMAFGR  331

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L LSLK+GSLLVMRGNSADMARH MC SPNRRVSITFF++R   ++N
Sbjct  332  ILMSENDGNYKGPLTLSLKQGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVRP--DSN  389

Query  543  SAEVVPP--LTRAMTLWQPGIPSSPY  614
              +   P  +T AMT+WQPGI +SPY
Sbjct  390  QCQTPTPTTMTSAMTMWQPGIAASPY  415



>gb|EYU46628.1| hypothetical protein MIMGU_mgv1a003933mg [Erythranthe guttata]
Length=554

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 176/212 (83%), Gaps = 7/212 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELRV GQ+G+LSGETFILYNQQ KGNKRELIQLG PIFG +K++   ++   EPIP +L
Sbjct  256  NELRVAGQSGDLSGETFILYNQQTKGNKRELIQLGVPIFGQIKDE---ERRHIEPIPALL  312

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+HL+QW L+ ENRRPN CIINFFDEGEYSQPFLKPPHLEQP+ST+LLS+S MAFGR
Sbjct  313  QGVIEHLVQWRLLPENRRPNSCIINFFDEGEYSQPFLKPPHLEQPMSTILLSDSVMAFGR  372

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE--  536
             L  D +GNYRG  ++S KEGSLLVMRG+S+D ARH MCSSPN+RVSI+FF++R+ VE  
Sbjct  373  MLVSDGEGNYRGPFMVSPKEGSLLVMRGHSSDTARHVMCSSPNKRVSISFFRVRSEVEVE  432

Query  537  -NNSAEVVPPLTRAMTLWQPGIPSSPYNGTPD  629
             N  +E++ P++ +MTLWQPG+P +PYN  P+
Sbjct  433  RNIPSEIIAPMSTSMTLWQPGVP-TPYNNMPN  463



>ref|XP_011033673.1| PREDICTED: uncharacterized protein LOC105132083 [Populus euphratica]
Length=521

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 171/214 (80%), Gaps = 10/214 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN--EPIPT  176
            NELRV GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG++KE+ A    S+  EPIP 
Sbjct  220  NELRVAGQNGELSGETFILFNKQVKGNKRELIQLGVPIFGHIKEEAASNNPSSNIEPIPV  279

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VIDHL+QW LI E ++PNGCII+FFDE EYSQPFLKPPHL+QP+STL+LSESTMAF
Sbjct  280  LLQGVIDHLVQWQLIPEYKKPNGCIIHFFDEEEYSQPFLKPPHLDQPISTLILSESTMAF  339

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L  DSDGNYRGSL L LK+GSLLVMRGNSADMA HAMC S N+RVSITFF++R    
Sbjct  340  GRILGSDSDGNYRGSLSLFLKKGSLLVMRGNSADMAGHAMCPSSNKRVSITFFRVRP---  396

Query  537  NNSAEVVPPLTRAMTLWQPGIPSSPY---NGTPD  629
              S  V  P T  MTLWQP IP SPY   NG  D
Sbjct  397  -ESKHVQSPPTSPMTLWQPSIP-SPYPVPNGALD  428



>ref|XP_007144596.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
 gb|ESW16590.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
Length=505

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 168/204 (82%), Gaps = 5/204 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+ V GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +KED+   KS+ EPIP +L
Sbjct  210  NEIHVAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKEDV---KSNIEPIPALL  266

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW L+ E +RPNGCIINFF+EGE+SQPFLKPPHL+QPVSTLLLSESTMAFGR
Sbjct  267  QGVIDHLIQWQLLPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPVSTLLLSESTMAFGR  326

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L+LSLK+GSLLVMRGNSADMARH MC SPNRRVSI FF++R    N 
Sbjct  327  ILMSENDGNYKGPLMLSLKQGSLLVMRGNSADMARHVMCPSPNRRVSIAFFRVRPD-SNQ  385

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
                 P +  AMTLWQP   +SPY
Sbjct  386  CQSPTPAMANAMTLWQPSF-ASPY  408



>ref|XP_003591621.1| hypothetical protein MTR_1g089860 [Medicago truncatula]
Length=513

 Score =   298 bits (763),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 169/204 (83%), Gaps = 5/204 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +E+   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +KED    KS+ EPIP +L
Sbjct  216  DEIHTAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKED---TKSNIEPIPALL  272

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDH IQWHL+ E +RPNGCIINFF+EGE+SQPFLKPPHL+QPV+TLLLSESTMAFGR
Sbjct  273  QRVIDHFIQWHLLPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPVTTLLLSESTMAFGR  332

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L+LSLK+GSLLVMRGNSADMARH MC SPNRRVSITFF++R    N 
Sbjct  333  ILMSENDGNYKGPLMLSLKKGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVRP-DSNQ  391

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
                 P +T AMT+WQP I ++PY
Sbjct  392  CQSPTPTMTSAMTMWQPAI-ANPY  414



>gb|KEH43288.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=526

 Score =   298 bits (763),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 169/204 (83%), Gaps = 5/204 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +E+   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +KED    KS+ EPIP +L
Sbjct  229  DEIHTAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKED---TKSNIEPIPALL  285

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDH IQWHL+ E +RPNGCIINFF+EGE+SQPFLKPPHL+QPV+TLLLSESTMAFGR
Sbjct  286  QRVIDHFIQWHLLPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPVTTLLLSESTMAFGR  345

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L+LSLK+GSLLVMRGNSADMARH MC SPNRRVSITFF++R    N 
Sbjct  346  ILMSENDGNYKGPLMLSLKKGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVRPD-SNQ  404

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
                 P +T AMT+WQP I ++PY
Sbjct  405  CQSPTPTMTSAMTMWQPAI-ANPY  427



>ref|XP_007050695.1| Oxidoreductase, 2OG-Fe(II) oxygenase family protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOX94852.1| Oxidoreductase, 2OG-Fe(II) oxygenase family protein, putative 
isoform 2, partial [Theobroma cacao]
Length=446

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 163/206 (79%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN--EPIPT  176
            +ELR  GQNGELSGETFIL+N+QIKGNKRELIQLG PIFG++ E+    K +   EPIP 
Sbjct  220  SELRAAGQNGELSGETFILFNKQIKGNKRELIQLGVPIFGHIIEEPMSNKQTINIEPIPA  279

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VI+HL+QW LI E ++PNGCIINFFDEGEYSQPFLKPPHLEQP+STL LSESTMAF
Sbjct  280  LLQGVIEHLVQWQLIPEYKKPNGCIINFFDEGEYSQPFLKPPHLEQPISTLFLSESTMAF  339

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GRTL  DS+GNYRG L LSLKEGSLLVMRGNSADMARH MC SP  RVSITFF++R    
Sbjct  340  GRTLVSDSEGNYRGPLQLSLKEGSLLVMRGNSADMARHVMCPSPRNRVSITFFRVRPDTN  399

Query  537  NNSAEVVPPLTRAMTLWQPGIPSSPY  614
                    P   AMTLW+PG+P  PY
Sbjct  400  QGQLPPASPQPGAMTLWEPGVP-GPY  424



>ref|XP_010279049.1| PREDICTED: uncharacterized protein LOC104613055 [Nelumbo nucifera]
Length=557

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQ--KSSNEPIPT  176
            NELR  G++GELSGETFIL+N+Q+KGNKRELIQLG PIFG +K++   +  K + +PIP+
Sbjct  256  NELRSAGRDGELSGETFILFNKQLKGNKRELIQLGVPIFGQIKDEATSKLHKCNIDPIPS  315

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VIDHL+Q  LI E+R+PN  IINFFDEGEYSQP+L+PPHLEQP+STLLLSESTMAF
Sbjct  316  VLQAVIDHLVQCRLIPESRKPNSSIINFFDEGEYSQPYLRPPHLEQPISTLLLSESTMAF  375

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L  D++GN++GSL+LSLKEGSLLVMRGNS+DMARH +C S N+RVSITFFK+R    
Sbjct  376  GRVLQNDANGNFKGSLMLSLKEGSLLVMRGNSSDMARHVICPSSNKRVSITFFKVRLDTN  435

Query  537  NNSAEVVPPLTRAMTLWQPGIP  602
                +V+PPLT+AMTLWQPG+P
Sbjct  436  PIQTQVIPPLTKAMTLWQPGVP  457



>gb|EPS57869.1| hypothetical protein M569_16948, partial [Genlisea aurea]
Length=341

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 163/197 (83%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NEL+V G+NGELSG+TFILYNQQ+KGNKRELIQLG PIF  V+ D   +K   EPIP ++
Sbjct  60   NELQVAGRNGELSGDTFILYNQQMKGNKRELIQLGVPIFRKVQYDETPEKDCIEPIPALI  119

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            E VI HLIQWHLI E RRPN CIINFFDEGEYSQPFLKPPHLEQP+STL LS+STMAFGR
Sbjct  120  EGVIRHLIQWHLIPETRRPNSCIINFFDEGEYSQPFLKPPHLEQPLSTLTLSDSTMAFGR  179

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D +GNY+G+L+LSLK+GSLLVMRGNS+D ARHAMC+SPN+R+SITFFK+R+ V+ +
Sbjct  180  ILVSDGEGNYKGTLMLSLKQGSLLVMRGNSSDTARHAMCASPNKRISITFFKVRSDVDES  239

Query  543  SAEVVPPLTRAMTLWQP  593
             +E   P    M LWQP
Sbjct  240  ESESNHP----MMLWQP  252



>ref|XP_007162387.1| hypothetical protein PHAVU_001G147800g [Phaseolus vulgaris]
 gb|ESW34381.1| hypothetical protein PHAVU_001G147800g [Phaseolus vulgaris]
Length=516

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 169/204 (83%), Gaps = 5/204 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N++   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +K+D    K++ EPIP ++
Sbjct  221  NDIHAAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKDD---TKNNIEPIPALV  277

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              VIDHLIQW LI E +RPNGCIINFF+EGE+SQPFLKPPHL+QP+STLLLSESTMAFGR
Sbjct  278  HDVIDHLIQWKLIPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPLSTLLLSESTMAFGR  337

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L+LSLKEGSL+VMRGNSADM+RH MC SPNRRVSI+FF+++    N 
Sbjct  338  ILVSENDGNYKGPLMLSLKEGSLIVMRGNSADMSRHVMCPSPNRRVSISFFRVKPD-SNQ  396

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
                 P +T AMTLWQPGI +SPY
Sbjct  397  CQSPNPTMTAAMTLWQPGI-TSPY  419



>ref|XP_004496294.1| PREDICTED: uncharacterized protein LOC101493086 [Cicer arietinum]
Length=508

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 168/204 (82%), Gaps = 5/204 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+   GQNG+LSGETFIL+N+Q+KGNKRELIQLG PIFG +KED    K++ EPIP +L
Sbjct  213  NEIHTAGQNGDLSGETFILFNKQMKGNKRELIQLGVPIFGQIKED---TKNNIEPIPGLL  269

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW L+ E +RPNGCIINFF+EGE+SQPFLKPPHL+QPVSTLLLSESTMAFGR
Sbjct  270  QRVIDHLIQWQLLPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPVSTLLLSESTMAFGR  329

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L+LSLK+GSL+VMRGNSADMARH MC SPNRRVSITFF++R    N 
Sbjct  330  ILMSENDGNYKGPLMLSLKKGSLVVMRGNSADMARHVMCPSPNRRVSITFFRVRPD-SNQ  388

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
                 P +T  MTLWQP I ++PY
Sbjct  389  CQSPTPTMTSEMTLWQPAI-ANPY  411



>gb|KDP21510.1| hypothetical protein JCGZ_21981 [Jatropha curcas]
Length=550

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 166/206 (81%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC--QKSSNEPIPT  176
             ELRV GQNGEL+G+++IL+N+Q+KGNKRELIQLG PIFG++KE+     Q S  E IP 
Sbjct  247  TELRVAGQNGELAGDSYILFNKQMKGNKRELIQLGVPIFGHIKEEAISNNQTSDLESIPA  306

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VIDHL+QW LI E ++PNGCII+FFD+ EYSQPF KPPHL+QP+STL+LSESTMAF
Sbjct  307  LLESVIDHLVQWQLIPEYKKPNGCIIHFFDKEEYSQPFQKPPHLDQPISTLVLSESTMAF  366

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GRTL  D+DGNYRG L+LSLKEGSLLVMRGNS+DMARH MCSSP  RVSITFF++R    
Sbjct  367  GRTLVSDNDGNYRGPLMLSLKEGSLLVMRGNSSDMARHVMCSSPKDRVSITFFRVRPDSN  426

Query  537  NNSAEVVPPLTRAMTLWQPGIPSSPY  614
               +    P+  AMTLWQP IP SPY
Sbjct  427  QGQSPPTSPMAGAMTLWQPSIP-SPY  451



>gb|KHF97715.1| putative alpha-ketoglutarate-dependent dioxygenase ABH5 [Gossypium 
arboreum]
Length=549

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 166/204 (81%), Gaps = 5/204 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +ELR  GQNGELSGETFIL+N+QIKGNKRELIQ G PIFG++KE+      + EPIP +L
Sbjct  251  SELRSSGQNGELSGETFILFNKQIKGNKRELIQFGVPIFGHIKEEPTI---NIEPIPALL  307

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+HLIQW LI E ++PNGCIINFFDE EYSQPFLKPPHLEQP+STLLLSESTMAFG 
Sbjct  308  QDVIEHLIQWQLIPEYKKPNGCIINFFDEDEYSQPFLKPPHLEQPISTLLLSESTMAFGL  367

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL  DS+GNYRG L L LKEGSLLVMRGNS+DMARH MC SPN+RVSITFF++R  + + 
Sbjct  368  TLTSDSEGNYRGPLQLPLKEGSLLVMRGNSSDMARHVMCPSPNKRVSITFFRVRPDINHQ  427

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
            S     P + AMTLWQPG+P  PY
Sbjct  428  SPPTT-PQSGAMTLWQPGVP-GPY  449



>ref|XP_004290685.2| PREDICTED: uncharacterized protein LOC101299256 [Fragaria vesca 
subsp. vesca]
Length=538

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 171/212 (81%), Gaps = 10/212 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR  G NGELSGETFIL+N+QIKGN+RELIQ G PIFG VKE+ A   S+  PIP +L
Sbjct  243  NELRTAGLNGELSGETFILFNKQIKGNRRELIQFGIPIFGQVKEEAA---SNIGPIPALL  299

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              VIDHL+ W+LI E +RPNGCIINFF+EGEYSQPFLKPPHL+QP+STLLLSESTMA+GR
Sbjct  300  HDVIDHLVLWNLIPEYKRPNGCIINFFEEGEYSQPFLKPPHLDQPISTLLLSESTMAYGR  359

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL  DSDGNY+G L LSLKEGSLLVMRGNSADMARH MC SPN+R+SITFF++R  V++N
Sbjct  360  TLVTDSDGNYKGPLTLSLKEGSLLVMRGNSADMARHVMCPSPNKRISITFFRVR--VDSN  417

Query  543  ---SAEVVPPLTRAMTLWQPGIPSSPYNGTPD  629
               S+   P    AMT+WQPG+  SPY   PD
Sbjct  418  QYQSSPQSPTQNGAMTVWQPGV-MSPY-AAPD  447



>ref|XP_007050694.1| Transport protein sec31 isoform 1 [Theobroma cacao]
 gb|EOX94851.1| Transport protein sec31 isoform 1 [Theobroma cacao]
Length=610

 Score =   295 bits (756),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 163/206 (79%), Gaps = 3/206 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN--EPIPT  176
            +ELR  GQNGELSGETFIL+N+QIKGNKRELIQLG PIFG++ E+    K +   EPIP 
Sbjct  303  SELRAAGQNGELSGETFILFNKQIKGNKRELIQLGVPIFGHIIEEPMSNKQTINIEPIPA  362

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VI+HL+QW LI E ++PNGCIINFFDEGEYSQPFLKPPHLEQP+STL LSESTMAF
Sbjct  363  LLQGVIEHLVQWQLIPEYKKPNGCIINFFDEGEYSQPFLKPPHLEQPISTLFLSESTMAF  422

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GRTL  DS+GNYRG L LSLKEGSLLVMRGNSADMARH MC SP  RVSITFF++R    
Sbjct  423  GRTLVSDSEGNYRGPLQLSLKEGSLLVMRGNSADMARHVMCPSPRNRVSITFFRVRPDTN  482

Query  537  NNSAEVVPPLTRAMTLWQPGIPSSPY  614
                    P   AMTLW+PG+P  PY
Sbjct  483  QGQLPPASPQPGAMTLWEPGVP-GPY  507



>ref|XP_010255802.1| PREDICTED: uncharacterized protein LOC104596380 isoform X2 [Nelumbo 
nucifera]
Length=559

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 9/214 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQ--KSSNEPIPT  176
            NELR  G+NGELSGETFIL+N+Q+KGNKRELIQLG PIFG +K++   +  K   EPIP+
Sbjct  259  NELRTAGRNGELSGETFILFNKQLKGNKRELIQLGVPIFGQIKDEATSKVHKCDIEPIPS  318

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VID+L+ W LI E+R+PN CIINFFDEGEYSQP+LKPPHL+QP+STLLLSESTMAF
Sbjct  319  VLQAVIDNLVHWRLIPESRKPNSCIINFFDEGEYSQPYLKPPHLDQPISTLLLSESTMAF  378

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR----  524
            GR L  + +GN++GSL+LSLKEGSLLVMRGNSA+MARH +C   N+RVSITFFK+R    
Sbjct  379  GRVLV-NHNGNFKGSLMLSLKEGSLLVMRGNSAEMARHVICPCSNKRVSITFFKVRLDST  437

Query  525  -TCVENNSAEVVPPLTRAMTLWQPGIPSSPYNGT  623
             T         +PPLT+AMTLWQPG+P  PY  T
Sbjct  438  TTTSPMQQPTTIPPLTKAMTLWQPGVP-PPYTTT  470



>ref|XP_010255801.1| PREDICTED: uncharacterized protein LOC104596380 isoform X1 [Nelumbo 
nucifera]
Length=560

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 9/214 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQ--KSSNEPIPT  176
            NELR  G+NGELSGETFIL+N+Q+KGNKRELIQLG PIFG +K++   +  K   EPIP+
Sbjct  260  NELRTAGRNGELSGETFILFNKQLKGNKRELIQLGVPIFGQIKDEATSKVHKCDIEPIPS  319

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VID+L+ W LI E+R+PN CIINFFDEGEYSQP+LKPPHL+QP+STLLLSESTMAF
Sbjct  320  VLQAVIDNLVHWRLIPESRKPNSCIINFFDEGEYSQPYLKPPHLDQPISTLLLSESTMAF  379

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR----  524
            GR L  + +GN++GSL+LSLKEGSLLVMRGNSA+MARH +C   N+RVSITFFK+R    
Sbjct  380  GRVLV-NHNGNFKGSLMLSLKEGSLLVMRGNSAEMARHVICPCSNKRVSITFFKVRLDST  438

Query  525  -TCVENNSAEVVPPLTRAMTLWQPGIPSSPYNGT  623
             T         +PPLT+AMTLWQPG+P  PY  T
Sbjct  439  TTTSPMQQPTTIPPLTKAMTLWQPGVP-PPYTTT  471



>ref|XP_006444148.1| hypothetical protein CICLE_v10019581mg [Citrus clementina]
 ref|XP_006479782.1| PREDICTED: uncharacterized protein LOC102631062 [Citrus sinensis]
 gb|ESR57388.1| hypothetical protein CICLE_v10019581mg [Citrus clementina]
 gb|KDO68840.1| hypothetical protein CISIN_1g008986mg [Citrus sinensis]
Length=547

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 173/219 (79%), Gaps = 15/219 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN--EPIPT  176
            NELR+ GQ+GELSGETFIL+N+Q+KGN+RELI+ G PIF ++KE+          EPIP 
Sbjct  243  NELRLAGQSGELSGETFILFNKQMKGNRRELIRFGIPIFRHIKEEATSNNEIGNLEPIPA  302

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ VIDHL+QW LI E ++PNGCIINFFDE EYSQPFLKPPHL+QP+STLLLS+S MAF
Sbjct  303  LLQSVIDHLVQWQLIPEYKKPNGCIINFFDEAEYSQPFLKPPHLDQPISTLLLSDSAMAF  362

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR+L CD+DGNY+G L+LSLKEGSL+VMRGNSAD ARH MC SPN+R+SITFF++R   E
Sbjct  363  GRSLVCDNDGNYKGQLMLSLKEGSLVVMRGNSADTARHVMCPSPNKRISITFFRVRP--E  420

Query  537  NNSAEVVPPLT------RAMTLWQPGIPSSPY---NGTP  626
            +N ++  PP T       AM LWQPG+P SPY   NG P
Sbjct  421  SNQSQ-SPPTTPTGTMNGAMALWQPGVP-SPYSVPNGAP  457



>ref|XP_008234920.1| PREDICTED: uncharacterized protein LOC103333806 [Prunus mume]
Length=549

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 168/206 (82%), Gaps = 8/206 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NEL   G NGELSGETFIL+N+QIKGN+RELIQ G PIFG +KE+     S+  PIP +L
Sbjct  255  NELHAAGLNGELSGETFILFNKQIKGNRRELIQFGVPIFGQIKEETT---SNIGPIPALL  311

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + V+DH + W LI E +RPNGCIINFF+EGEYSQPFLKPPHL+QP++TLLLSESTMAFGR
Sbjct  312  QDVVDHFVLWQLIPEYKRPNGCIINFFEEGEYSQPFLKPPHLDQPIATLLLSESTMAFGR  371

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL  D+DGNY+G L+LSLKEGSLLVMRGNSADMARH MC SPNRRVSITFF++R  V++N
Sbjct  372  TLLSDNDGNYKGPLMLSLKEGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVR--VDSN  429

Query  543  SAEVVPPLTR--AMTLWQPGIPSSPY  614
              +  P  T+  AMTLWQPG+  SPY
Sbjct  430  QFQSPPSPTQNGAMTLWQPGV-VSPY  454



>ref|XP_007201711.1| hypothetical protein PRUPE_ppa003815mg [Prunus persica]
 gb|EMJ02910.1| hypothetical protein PRUPE_ppa003815mg [Prunus persica]
Length=547

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 162/204 (79%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NEL   G NGELSGETFIL+N+QIKGN+RELIQ G PIFG +KE+     S+  PIP +L
Sbjct  253  NELHAAGLNGELSGETFILFNKQIKGNRRELIQFGVPIFGQIKEETT---SNIGPIPALL  309

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + V+DH + W LI E +RPNGCIINFF+EGEYSQPFLKPPHL+QP++TLLLSESTMAFGR
Sbjct  310  QDVVDHFVLWQLIPEYKRPNGCIINFFEEGEYSQPFLKPPHLDQPIATLLLSESTMAFGR  369

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL  D+DGNY+G L+LSLKEGSLLVMRGNSADMARH MC SPNRRVSITFF++R      
Sbjct  370  TLLSDNDGNYKGPLMLSLKEGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVRADSNQF  429

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
             +   P    AMTLWQPG+  SPY
Sbjct  430  QSPPSPTQNGAMTLWQPGV-VSPY  452



>ref|XP_008386575.1| PREDICTED: uncharacterized protein LOC103449078 [Malus domestica]
Length=545

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 163/209 (78%), Gaps = 5/209 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+L   G NGELSGETFIL+N+Q+KGN+RELIQ G PIFG +KED     S+  PIP +L
Sbjct  255  NDLHAAGINGELSGETFILFNKQVKGNRRELIQFGVPIFGQIKEDTT---SNMVPIPALL  311

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            E VIDH + W LI E +RPNGC+INFF+EGEYSQPFLKPPHL+QP++TLLLSES MAFGR
Sbjct  312  EDVIDHFVLWQLIPEYKRPNGCMINFFEEGEYSQPFLKPPHLDQPIATLLLSESAMAFGR  371

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL  D+DGNY+G L+LSLK+GSLLVMRGNSADM+RH MC SPNRRVSITFF++R      
Sbjct  372  TLLSDNDGNYKGPLMLSLKQGSLLVMRGNSADMSRHVMCPSPNRRVSITFFRVRVHSNQF  431

Query  543  SAEVVPPLTRAMTLWQPGIPSSPYNGTPD  629
             +   P    AMTLWQPG+  SPY   PD
Sbjct  432  QSPQSPTNNGAMTLWQPGM-VSPYT-MPD  458



>ref|XP_008775273.1| PREDICTED: uncharacterized protein LOC103695673 [Phoenix dactylifera]
Length=314

 Score =   278 bits (712),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 156/200 (78%), Gaps = 3/200 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR+ G+ GELSGETFI +N+QIKGNKRE++QLG P+F    E+ +    + EPIP IL
Sbjct  28   NELRLSGRRGELSGETFIFFNKQIKGNKREILQLGVPLFQPTNEEAS---GNIEPIPPIL  84

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            +  IDHL+QWH+I EN+RPN CIINFFDE EYSQP+ KPPHL+ P+STL LSE+T AFGR
Sbjct  85   QTAIDHLVQWHVIPENKRPNSCIINFFDEDEYSQPYFKPPHLDNPISTLFLSETTTAFGR  144

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D++GNY+GSL L LKEGSLLVMRGNSADMARH +C SPNRRVSITF K+R      
Sbjct  145  VLVSDNNGNYKGSLTLPLKEGSLLVMRGNSADMARHVICQSPNRRVSITFVKVRPANNQT  204

Query  543  SAEVVPPLTRAMTLWQPGIP  602
             +  + PLT A+TLWQPG P
Sbjct  205  DSSTMSPLTTAITLWQPGSP  224



>ref|XP_009356724.1| PREDICTED: uncharacterized protein LOC103947542 [Pyrus x bretschneideri]
Length=545

 Score =   286 bits (731),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 163/209 (78%), Gaps = 5/209 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+L   G NGELSGETFIL+N+Q+KGN+RELIQ G PIFG +KED     S+  PIP +L
Sbjct  255  NDLHAAGINGELSGETFILFNKQVKGNRRELIQFGVPIFGQIKEDTT---SNIVPIPALL  311

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            E VIDH + W LI E +RPNGC+INFF+EGEYSQPFLKPPHL+QP++TLLLSES MAFGR
Sbjct  312  EDVIDHFVLWQLIPEYKRPNGCMINFFEEGEYSQPFLKPPHLDQPIATLLLSESAMAFGR  371

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL  D+DGNY+G L+LSLK+GSLLVMRGNSADM+RH MC SPNRRVSITFF++R      
Sbjct  372  TLLSDNDGNYKGPLMLSLKQGSLLVMRGNSADMSRHVMCPSPNRRVSITFFRVRVDSNQF  431

Query  543  SAEVVPPLTRAMTLWQPGIPSSPYNGTPD  629
             +   P    AMTLWQPG+  SPY   PD
Sbjct  432  QSPQSPTNNGAMTLWQPGM-VSPYT-MPD  458



>emb|CBI32322.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 155/188 (82%), Gaps = 7/188 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +ELR+ GQNGELSGETFILYN+QIKGNKRELIQ G PIFG + E   C   + EPIP +L
Sbjct  124  DELRIAGQNGELSGETFILYNKQIKGNKRELIQFGVPIFGQISE--GC---NGEPIPALL  178

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW LI E ++PN CIINFFDEGEYSQPFLKPPHLEQP+STLLLSESTMAFGR
Sbjct  179  QNVIDHLIQWELIPEYKKPNNCIINFFDEGEYSQPFLKPPHLEQPISTLLLSESTMAFGR  238

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D+DGN++G  +L+LKEGSL+VMRGNSADMARH MC S N+RVSITFF++RT  E N
Sbjct  239  VLGSDNDGNFKGPFMLTLKEGSLIVMRGNSADMARHVMCPSSNKRVSITFFRVRT--ETN  296

Query  543  SAEVVPPL  566
              ++ P L
Sbjct  297  RDQLTPFL  304



>ref|XP_010696340.1| PREDICTED: uncharacterized protein LOC104908870 [Beta vulgaris 
subsp. vulgaris]
Length=546

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN-EPIPTI  179
            +ELR  GQNGEL G T++L+N+Q+K NKRE IQLG PIFG +K+D   ++ SN E IP +
Sbjct  250  HELRAAGQNGELLGGTYVLFNKQMKANKREQIQLGVPIFGQIKDDTTHEQKSNIEQIPVL  309

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L+ VIDHL+QWH++ ENR+PNGCIIN+F+EGEYSQPFLKPPHL+QP+ TL+LSESTMA+G
Sbjct  310  LQSVIDHLVQWHVLPENRKPNGCIINYFEEGEYSQPFLKPPHLDQPLCTLVLSESTMAYG  369

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR-TCVE  536
            RT+  D DGN++G L+L LK+GSLLVMR NSADMARH MC+SP+RRVSITF +IR   V 
Sbjct  370  RTVVNDGDGNFKGQLMLPLKQGSLLVMRNNSADMARHVMCASPSRRVSITFSRIRPDSVH  429

Query  537  NNSAEVVPPLTRAMTLWQPGIPS  605
            N+    + PL +AMT+WQPG+P+
Sbjct  430  NHHTAPLSPLPQAMTMWQPGMPN  452



>ref|XP_004493638.1| PREDICTED: uncharacterized protein LOC101495753 [Cicer arietinum]
Length=522

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 166/209 (79%), Gaps = 5/209 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
             E+   GQ GELSG+TFILYN+QIKGNKRELIQLG PIFG +K+D+   KS+ EPIP++L
Sbjct  226  KEIHAAGQKGELSGDTFILYNKQIKGNKRELIQLGVPIFGQIKDDV---KSNIEPIPSLL  282

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW LI E +RPNGCIINFF+E E+SQPFLKPPHL+QP+STLLLSESTMAFGR
Sbjct  283  QGVIDHLIQWQLIPEYKRPNGCIINFFEEEEFSQPFLKPPHLDQPLSTLLLSESTMAFGR  342

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L+L LK+GSLLVM+GNSADMARH MC SPN+RVSITFF++R      
Sbjct  343  ILMSENDGNYKGPLMLPLKQGSLLVMKGNSADMARHVMCPSPNKRVSITFFRVREDSYQG  402

Query  543  SAEVVPPLTRAMTLWQP--GIPSSPYNGT  623
             +   P  T AMTLWQP  G P +  NG 
Sbjct  403  PSTSPPTTTSAMTLWQPSSGSPDALSNGA  431



>ref|XP_010938799.1| PREDICTED: uncharacterized protein LOC105057798 [Elaeis guineensis]
 ref|XP_010938800.1| PREDICTED: uncharacterized protein LOC105057798 [Elaeis guineensis]
Length=536

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 159/200 (80%), Gaps = 3/200 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR+ G+ G+LSGETFI +N+QIKGNKRE++QLG P+F    E+ +   S+ EPIP +L
Sbjct  250  NELRLAGRRGDLSGETFIFFNKQIKGNKREILQLGVPLFQPTNEEAS---SNIEPIPPVL  306

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QWHLI E+++PN CIINFFDE EYSQP+ KPPHL+ PVSTL LSE+TMAFGR
Sbjct  307  QTVIDHLVQWHLIPESKKPNSCIINFFDEDEYSQPYFKPPHLDNPVSTLFLSETTMAFGR  366

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D++GNY+GSL L LKEGSLLVMRGNSADMARH +C SPNRRVSITF K+R      
Sbjct  367  VLVSDNNGNYKGSLTLPLKEGSLLVMRGNSADMARHVICQSPNRRVSITFVKVRPANNQT  426

Query  543  SAEVVPPLTRAMTLWQPGIP  602
             +  + PLT AMTLWQPG P
Sbjct  427  DSSTMSPLTTAMTLWQPGSP  446



>gb|KHN45381.1| hypothetical protein glysoja_028388 [Glycine soja]
Length=366

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 165/203 (81%), Gaps = 5/203 (2%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILE  185
            E+    QNGELSGETFIL+N+Q+KGNKRELIQLG PIF  +K+D    KS+ EPIP +L 
Sbjct  72   EIHAAAQNGELSGETFILFNKQMKGNKRELIQLGVPIFRQIKDD---NKSNIEPIPALLH  128

Query  186  VVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRT  365
             VIDHLIQW LI E +RPNGCIINFF+EGE+SQPFLKPPHL+QP+STLLLSESTMAFGR 
Sbjct  129  DVIDHLIQWKLIPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPLSTLLLSESTMAFGRI  188

Query  366  LACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENNS  545
            L  ++DGNY+G L+LSLKEGSLLVMRGNSADMARH MC SPNRRVSITFF++R    N  
Sbjct  189  LMSENDGNYKGPLMLSLKEGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVRPD-SNQC  247

Query  546  AEVVPPLTRAMTLWQPGIPSSPY  614
                P +T AMTLWQP I +SP+
Sbjct  248  QSPTPTMTTAMTLWQPSI-ASPF  269



>gb|KJB42033.1| hypothetical protein B456_007G133500 [Gossypium raimondii]
Length=557

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +ELR  G NGELSGETFIL+N+QIKGNKRELIQLG PIF +V+E+ +    + EPIP +L
Sbjct  255  SELRSAGHNGELSGETFILFNKQIKGNKRELIQLGVPIFRHVREE-SNPTINIEPIPALL  313

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI HL+QW LI E ++PNGCIINFFDEGEYSQPFLKPPHL+QP+STLLLSESTMAFGR
Sbjct  314  QGVIKHLVQWQLIPEYKKPNGCIINFFDEGEYSQPFLKPPHLDQPISTLLLSESTMAFGR  373

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL  DS+G YRG+L L LKEGSLLVMRGNS+DMARH MC SP++RVSITFF++R      
Sbjct  374  TLVSDSEGKYRGALQLPLKEGSLLVMRGNSSDMARHVMCPSPSKRVSITFFRVRPDTNQG  433

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
             +    P   AM LWQP +P  PY
Sbjct  434  HSPPTVPQAGAMPLWQPSVP-VPY  456



>gb|KHN19859.1| hypothetical protein glysoja_033491 [Glycine soja]
Length=366

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 167/212 (79%), Gaps = 10/212 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +K+D    K++ EPIP +L
Sbjct  71   NEIHAAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKDD---TKNNIEPIPALL  127

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              VIDHLIQW LI E +RPNGCIINFF+E E+SQPFLKPPHL+QP+STLLLSESTMAFGR
Sbjct  128  HDVIDHLIQWKLIPEYKRPNGCIINFFEEEEFSQPFLKPPHLDQPLSTLLLSESTMAFGR  187

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L+LSLKEGSLLVMRGNSADMAR+ MC SPNRRVSITFF++R    N+
Sbjct  188  ILTSENDGNYKGPLMLSLKEGSLLVMRGNSADMARYVMCPSPNRRVSITFFRVRPD-SNH  246

Query  543  SAEVVPPLTRAMTLWQPGI------PSSPYNG  620
                 P +T AMTLW P I      P  P NG
Sbjct  247  CQSPTPTMTTAMTLWHPSISSPFTLPKGPLNG  278



>gb|KCW58911.1| hypothetical protein EUGRSUZ_H01531 [Eucalyptus grandis]
Length=411

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 162/201 (81%), Gaps = 3/201 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  GQNGELSGET+IL+N+Q+KGNKRELIQ G PIFG+++E+  C  S  EPIP +L
Sbjct  119  NDLRAAGQNGELSGETYILFNKQMKGNKRELIQFGVPIFGHIQEEGTCN-SKAEPIPALL  177

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            E VIDHL++W LI   ++PN CIINFFDE EYSQPFLKPPHL+QP+S+LLLS+STM FGR
Sbjct  178  ERVIDHLVEWQLIPVYKKPNSCIINFFDEEEYSQPFLKPPHLDQPISSLLLSDSTMVFGR  237

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D++GNY+G L+L LKEGSLLVMRGNSADMARH  C SPN+RV+ITFF++R   ++N
Sbjct  238  FLVSDNEGNYKGPLMLPLKEGSLLVMRGNSADMARHVTCPSPNKRVTITFFRVRP--DSN  295

Query  543  SAEVVPPLTRAMTLWQPGIPS  605
              +   PL+ +MTLWQ   PS
Sbjct  296  QGQPSSPLSGSMTLWQAANPS  316



>gb|KCW58910.1| hypothetical protein EUGRSUZ_H01531 [Eucalyptus grandis]
Length=414

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 164/203 (81%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC-QKSSN-EPIPT  176
            N+LR  GQNGELSGET+IL+N+Q+KGNKRELIQ G PIFG+++E+  C  K+ N EPIP 
Sbjct  119  NDLRAAGQNGELSGETYILFNKQMKGNKRELIQFGVPIFGHIQEEGTCNSKAGNIEPIPA  178

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VIDHL++W LI   ++PN CIINFFDE EYSQPFLKPPHL+QP+S+LLLS+STM F
Sbjct  179  LLERVIDHLVEWQLIPVYKKPNSCIINFFDEEEYSQPFLKPPHLDQPISSLLLSDSTMVF  238

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L  D++GNY+G L+L LKEGSLLVMRGNSADMARH  C SPN+RV+ITFF++R   +
Sbjct  239  GRFLVSDNEGNYKGPLMLPLKEGSLLVMRGNSADMARHVTCPSPNKRVTITFFRVRP--D  296

Query  537  NNSAEVVPPLTRAMTLWQPGIPS  605
            +N  +   PL+ +MTLWQ   PS
Sbjct  297  SNQGQPSSPLSGSMTLWQAANPS  319



>gb|KEH23703.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=514

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 160/200 (80%), Gaps = 3/200 (2%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILE  185
            E+   GQNGEL GETFILYN+Q+KGNKRE+IQLG P+FG +K++    KS+ EPIP +LE
Sbjct  219  EIHAAGQNGELPGETFILYNKQVKGNKREMIQLGVPLFGQIKDN---TKSNIEPIPPLLE  275

Query  186  VVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRT  365
             VIDHLIQW +I +N+RPNGCIINFFDEGE+SQPF KPPH++QP+STLLLSESTMAFGR 
Sbjct  276  GVIDHLIQWQIIWDNKRPNGCIINFFDEGEFSQPFFKPPHVDQPLSTLLLSESTMAFGRI  335

Query  366  LACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENNS  545
            L  ++DGNY+G L+LSLK+GSLLVM+GNSADMA H M  S N+RVSITFF++R       
Sbjct  336  LMSENDGNYKGPLMLSLKQGSLLVMKGNSADMASHVMRPSTNKRVSITFFRVRGDNYQGQ  395

Query  546  AEVVPPLTRAMTLWQPGIPS  605
            +   P  T AMTLWQP  PS
Sbjct  396  STSPPTTTSAMTLWQPSTPS  415



>ref|XP_010905740.1| PREDICTED: uncharacterized protein LOC105032859 [Elaeis guineensis]
Length=525

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 157/200 (79%), Gaps = 3/200 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR+ G+ GELSGETFI +N+Q+KGNKRE++QLG P+F    E      S+ EPIP +L
Sbjct  239  NELRLAGRRGELSGETFIFFNKQMKGNKREILQLGVPLFQPTNE---AASSNIEPIPPVL  295

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI E+R+PN CI+NFFDEGEYSQP+ KPPHL+ P+STLLLSE+TMAFGR
Sbjct  296  QTVIDHLVQWRLIPESRKPNSCIVNFFDEGEYSQPYFKPPHLDNPISTLLLSETTMAFGR  355

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D++GNY+GSL L LKEGSLLVMRGNSADMARH +C SPNRRVSITF K+R      
Sbjct  356  MLVSDNNGNYKGSLTLPLKEGSLLVMRGNSADMARHVICESPNRRVSITFVKVRPADGQT  415

Query  543  SAEVVPPLTRAMTLWQPGIP  602
             +  +   T+AMTLWQPG P
Sbjct  416  DSSTMSSPTKAMTLWQPGTP  435



>ref|XP_006576883.1| PREDICTED: uncharacterized protein LOC100796344 [Glycine max]
Length=520

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 167/212 (79%), Gaps = 10/212 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +K+D    K++ EPIP +L
Sbjct  225  NEIHAAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKDD---TKNNIEPIPALL  281

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              VIDHLIQW LI E +RPNGCIINFF+E E+SQPFLKPPHL+QP+STLLLSESTMAFGR
Sbjct  282  HDVIDHLIQWKLIPEYKRPNGCIINFFEEEEFSQPFLKPPHLDQPLSTLLLSESTMAFGR  341

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L+LSLKEGSLLVMRGNSADMAR+ MC SPNRRVSITFF++R    N+
Sbjct  342  ILTSENDGNYKGPLMLSLKEGSLLVMRGNSADMARYVMCPSPNRRVSITFFRVRPD-SNH  400

Query  543  SAEVVPPLTRAMTLWQPGI------PSSPYNG  620
                 P +T AMTLW P I      P  P NG
Sbjct  401  CQSPTPTMTTAMTLWHPSISSPFTLPKGPLNG  432



>ref|XP_008809229.1| PREDICTED: uncharacterized protein LOC103721002 isoform X1 [Phoenix 
dactylifera]
Length=545

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 157/200 (79%), Gaps = 3/200 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR+ G+ GELSGETFI +N+Q+KGNKRE++QLG P+F    E      S+ EPIP +L
Sbjct  257  NELRLAGRRGELSGETFIFFNKQMKGNKREILQLGVPLFQPTNE---AASSNIEPIPPVL  313

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            +  IDHL+QW LI E+R+PN CI+NFFDEGE+SQP+ KPPHL+ P+STLLLSE+TMAFGR
Sbjct  314  QTAIDHLVQWRLIPESRKPNSCIVNFFDEGEHSQPYFKPPHLDNPISTLLLSETTMAFGR  373

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D++GNY+GSL L LKEGSLLVMRGNSADMARH +C SP RRVSITF K+R      
Sbjct  374  VLVSDNNGNYKGSLTLPLKEGSLLVMRGNSADMARHVICQSPGRRVSITFVKVRPADSQT  433

Query  543  SAEVVPPLTRAMTLWQPGIP  602
             +  + PLT+A+TLWQPG P
Sbjct  434  DSSTMAPLTKALTLWQPGTP  453



>ref|XP_008809230.1| PREDICTED: uncharacterized protein LOC103721002 isoform X2 [Phoenix 
dactylifera]
Length=527

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 157/200 (79%), Gaps = 3/200 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR+ G+ GELSGETFI +N+Q+KGNKRE++QLG P+F    E      S+ EPIP +L
Sbjct  239  NELRLAGRRGELSGETFIFFNKQMKGNKREILQLGVPLFQPTNE---AASSNIEPIPPVL  295

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            +  IDHL+QW LI E+R+PN CI+NFFDEGE+SQP+ KPPHL+ P+STLLLSE+TMAFGR
Sbjct  296  QTAIDHLVQWRLIPESRKPNSCIVNFFDEGEHSQPYFKPPHLDNPISTLLLSETTMAFGR  355

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D++GNY+GSL L LKEGSLLVMRGNSADMARH +C SP RRVSITF K+R      
Sbjct  356  VLVSDNNGNYKGSLTLPLKEGSLLVMRGNSADMARHVICQSPGRRVSITFVKVRPADSQT  415

Query  543  SAEVVPPLTRAMTLWQPGIP  602
             +  + PLT+A+TLWQPG P
Sbjct  416  DSSTMAPLTKALTLWQPGTP  435



>ref|XP_006604415.1| PREDICTED: uncharacterized protein LOC100776159 isoform X1 [Glycine 
max]
Length=518

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 165/204 (81%), Gaps = 5/204 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
             E+    QNGELSGETFIL+N+Q+KGNKRELIQLG PIF  +K+D    KS+ EPIP +L
Sbjct  223  KEIHAAAQNGELSGETFILFNKQMKGNKRELIQLGVPIFRQIKDD---NKSNIEPIPALL  279

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              VIDHLIQW LI E +RPNGCIINFF+EGE+SQPFLKPPHL+QP+STLLLSESTMAFGR
Sbjct  280  HDVIDHLIQWKLIPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPLSTLLLSESTMAFGR  339

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  ++DGNY+G L+LSLKEGSLLVMRGNSADMARH MC SPNRRVSITFF++R    N 
Sbjct  340  ILMSENDGNYKGPLMLSLKEGSLLVMRGNSADMARHVMCPSPNRRVSITFFRVRPD-SNQ  398

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
                 P +T AMTLWQP I +SP+
Sbjct  399  CQSPTPTMTTAMTLWQPSI-ASPF  421



>ref|XP_010070256.1| PREDICTED: uncharacterized protein LOC104457030 isoform X1 [Eucalyptus 
grandis]
Length=525

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 164/203 (81%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC-QKSSN-EPIPT  176
            N+LR  GQNGELSGET+IL+N+Q+KGNKRELIQ G PIFG+++E+  C  K+ N EPIP 
Sbjct  230  NDLRAAGQNGELSGETYILFNKQMKGNKRELIQFGVPIFGHIQEEGTCNSKAGNIEPIPA  289

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VIDHL++W LI   ++PN CIINFFDE EYSQPFLKPPHL+QP+S+LLLS+STM F
Sbjct  290  LLERVIDHLVEWQLIPVYKKPNSCIINFFDEEEYSQPFLKPPHLDQPISSLLLSDSTMVF  349

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L  D++GNY+G L+L LKEGSLLVMRGNSADMARH  C SPN+RV+ITFF++R   +
Sbjct  350  GRFLVSDNEGNYKGPLMLPLKEGSLLVMRGNSADMARHVTCPSPNKRVTITFFRVRP--D  407

Query  537  NNSAEVVPPLTRAMTLWQPGIPS  605
            +N  +   PL+ +MTLWQ   PS
Sbjct  408  SNQGQPSSPLSGSMTLWQAANPS  430



>gb|KHG19647.1| putative alpha-ketoglutarate-dependent dioxygenase ABH5 [Gossypium 
arboreum]
 gb|KHG21011.1| putative alpha-ketoglutarate-dependent dioxygenase ABH5 [Gossypium 
arboreum]
Length=557

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 159/204 (78%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +ELR  G NGELSGETFIL+N+QIKGNKRELIQLG PIF +V+E+ +    + EPIP +L
Sbjct  255  SELRSAGHNGELSGETFILFNKQIKGNKRELIQLGLPIFRHVREE-SNPTINREPIPALL  313

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI HL+QW LI E ++PNGCIINFFDEGEYSQPFLKPPHL+QP+STLLLSES MAFG 
Sbjct  314  QGVIKHLVQWQLIPEYKKPNGCIINFFDEGEYSQPFLKPPHLDQPISTLLLSESAMAFGH  373

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            TL  DS+G YRG+L L LKEGSLLVMRGNS+DMARH MC SP +RVSITFF++R      
Sbjct  374  TLVSDSEGKYRGALQLPLKEGSLLVMRGNSSDMARHVMCPSPRKRVSITFFRVRPDTNQG  433

Query  543  SAEVVPPLTRAMTLWQPGIPSSPY  614
             +    P   AM LWQP +P  PY
Sbjct  434  HSPPTVPQAGAMPLWQPSVP-VPY  456



>ref|XP_010070257.1| PREDICTED: uncharacterized protein LOC104457030 isoform X2 [Eucalyptus 
grandis]
Length=553

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 164/203 (81%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC-QKSSN-EPIPT  176
            N+LR  GQNGELSGET+IL+N+Q+KGNKRELIQ G PIFG+++E+  C  K+ N EPIP 
Sbjct  258  NDLRAAGQNGELSGETYILFNKQMKGNKRELIQFGVPIFGHIQEEGTCNSKAGNIEPIPA  317

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VIDHL++W LI   ++PN CIINFFDE EYSQPFLKPPHL+QP+S+LLLS+STM F
Sbjct  318  LLERVIDHLVEWQLIPVYKKPNSCIINFFDEEEYSQPFLKPPHLDQPISSLLLSDSTMVF  377

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L  D++GNY+G L+L LKEGSLLVMRGNSADMARH  C SPN+RV+ITFF++R   +
Sbjct  378  GRFLVSDNEGNYKGPLMLPLKEGSLLVMRGNSADMARHVTCPSPNKRVTITFFRVRP--D  435

Query  537  NNSAEVVPPLTRAMTLWQPGIPS  605
            +N  +   PL+ +MTLWQ   PS
Sbjct  436  SNQGQPSSPLSGSMTLWQAANPS  458



>ref|XP_010422515.1| PREDICTED: uncharacterized protein LOC104707789 [Camelina sativa]
Length=575

 Score =   279 bits (713),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 158/201 (79%), Gaps = 5/201 (2%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPIP  173
            ELR  G NG+L+GETFIL+N+QIKGNKRELIQLG PIFG+VK D     S+N    EPIP
Sbjct  270  ELREAGVNGKLAGETFILFNKQIKGNKRELIQLGVPIFGHVKTDEKSNDSNNSVNIEPIP  329

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
             +LE VIDH + W LI E +RPNGC+INFF+EGEYSQPFLKPPHLEQP+STL+LSESTMA
Sbjct  330  PLLESVIDHFVTWRLIPEYKRPNGCVINFFEEGEYSQPFLKPPHLEQPISTLVLSESTMA  389

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR-TC  530
            FGR L+ D++GN+RG L LSLK+GS+LVMRGNSADMARH MC S  +RVSITFF+IR   
Sbjct  390  FGRILSSDNEGNFRGPLTLSLKQGSMLVMRGNSADMARHVMCPSQTKRVSITFFRIRPES  449

Query  531  VENNSAEVVPPLTRAMTLWQP  593
              N+S    P     MT+WQP
Sbjct  450  YHNHSRPTSPHNDGVMTMWQP  470



>ref|XP_010090348.1| hypothetical protein L484_025013 [Morus notabilis]
 gb|EXB39318.1| hypothetical protein L484_025013 [Morus notabilis]
Length=664

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 160/204 (78%), Gaps = 3/204 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE R  GQNGELSG+TFIL+NQQ+KGNKREL+Q G PIFG +KE+   Q S+ EPIP +L
Sbjct  362  NEFRTAGQNGELSGDTFILFNQQMKGNKRELLQFGIPIFGQIKEEGDNQTSNIEPIPALL  421

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            E VI+HLI W LI E +RPNGCIINFFDE E+S PF KPPHLEQP+STLLLSESTMA GR
Sbjct  422  ENVINHLILWKLIPEYKRPNGCIINFFDEDEHSHPFQKPPHLEQPISTLLLSESTMAIGR  481

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  D+DGNY+G L+LSLK GSLLVMRG+S D+ARH MC+SPN+RVSI+FFK+R      
Sbjct  482  SLVSDNDGNYKGPLMLSLKGGSLLVMRGHSCDIARHVMCASPNKRVSISFFKVRLESNQC  541

Query  543  SAEVVPPLTRAMTLWQP---GIPS  605
             A   P    AMT+WQP   G+P+
Sbjct  542  QAPTSPTSASAMTVWQPSAYGMPN  565



>ref|XP_006287389.1| hypothetical protein CARUB_v10000595mg [Capsella rubella]
 gb|EOA20287.1| hypothetical protein CARUB_v10000595mg [Capsella rubella]
Length=563

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 158/201 (79%), Gaps = 5/201 (2%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPIP  173
            ELR  G NG+L+GETFIL+N+QIKGNKRELIQLG PIFG+VK D     S+N    EPIP
Sbjct  258  ELREAGINGKLAGETFILFNKQIKGNKRELIQLGVPIFGHVKADENSNDSNNSVNIEPIP  317

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
             +LE VIDH + W LI E +RPNGC+INFF+EGEYSQPFLKPPHLEQP+STL+LSESTMA
Sbjct  318  PLLESVIDHFVTWRLIPEYKRPNGCVINFFEEGEYSQPFLKPPHLEQPISTLVLSESTMA  377

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR-TC  530
            FGR L+ D+DGN+RG L LSLK+GSLLVMRGNSADMARH MC S  +RVSITFF+IR   
Sbjct  378  FGRILSSDNDGNFRGPLTLSLKQGSLLVMRGNSADMARHVMCPSQTKRVSITFFRIRPDT  437

Query  531  VENNSAEVVPPLTRAMTLWQP  593
              N+S    P     MT+WQP
Sbjct  438  YHNHSRPTSPHNDGVMTMWQP  458



>ref|XP_002321056.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE99371.1| oxidoreductase family protein [Populus trichocarpa]
Length=551

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 171/218 (78%), Gaps = 10/218 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN------E  164
            +ELRV GQNGELSGETFIL+N+Q+KGNK+ELIQLG PIFG++KE+ A    S+      E
Sbjct  242  DELRVAGQNGELSGETFILFNKQVKGNKKELIQLGVPIFGHIKEEAASNNPSSKISCNIE  301

Query  165  PIPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSES  344
            PIP +L+ VIDHL+QW LI E ++PNGCII+FFDE EYSQPFLKPPHL+QP+STL+LSES
Sbjct  302  PIPALLQGVIDHLVQWQLIPEYKKPNGCIIHFFDEEEYSQPFLKPPHLDQPISTLILSES  361

Query  345  TMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
            TMAFGR L  DSDGNYRGSL L LK+GSLLVMRGNSADMA HAMC S N+R SITFF++R
Sbjct  362  TMAFGRILGSDSDGNYRGSLSLLLKKGSLLVMRGNSADMAGHAMCPSSNKRASITFFRVR  421

Query  525  TCVENNSAEVVPPLTRAMTLWQPGIPSSPY---NGTPD  629
               +   +    P+  AMTLWQP IP SPY   NG  D
Sbjct  422  PESKQGQSPPTSPMNGAMTLWQPSIP-SPYPVPNGALD  458



>ref|NP_192203.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAC79112.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77779.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM13042.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91324.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82253.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=569

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 159/201 (79%), Gaps = 5/201 (2%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPIP  173
            ELR  G NG+L+GE+FIL+N+QIKGNKRELIQLG PIFG+VK D     ++N    EPIP
Sbjct  263  ELREAGINGKLAGESFILFNKQIKGNKRELIQLGVPIFGHVKADENSNDTNNSVNIEPIP  322

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
             +LE VIDH + W LI E +RPNGC+INFF+EGEYSQPFLKPPHLEQP+STL+LSESTMA
Sbjct  323  PLLESVIDHFVTWRLIPEYKRPNGCVINFFEEGEYSQPFLKPPHLEQPISTLVLSESTMA  382

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR-TC  530
            +GR L+ D++GN+RG L LSLK+GSLLVMRGNSADMARH MC S N+RVSITFF+IR   
Sbjct  383  YGRILSSDNEGNFRGPLTLSLKQGSLLVMRGNSADMARHVMCPSQNKRVSITFFRIRPDT  442

Query  531  VENNSAEVVPPLTRAMTLWQP  593
              N+S    P     MT+WQP
Sbjct  443  YHNHSQPNSPRNDGVMTMWQP  463



>ref|XP_002874886.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51145.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=565

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 159/201 (79%), Gaps = 5/201 (2%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPIP  173
            ELR  G NG+L+GE+FIL+N+QIKGNKRELIQLG PIFG+VK D     ++N    EPIP
Sbjct  259  ELREAGINGKLAGESFILFNKQIKGNKRELIQLGVPIFGHVKADENSNDTNNSVNIEPIP  318

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
             +LE VIDH + W LI E +RPNGC+INFF+EGEYSQPFLKPPHLEQP+STL+LSESTMA
Sbjct  319  PLLESVIDHFVTWRLIPEYKRPNGCVINFFEEGEYSQPFLKPPHLEQPISTLVLSESTMA  378

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR-TC  530
            +GR L+ D++GN+RG L LSLK+GSLLVMRGNSADMARH MC S N+RVSITFF+IR   
Sbjct  379  YGRILSSDNEGNFRGPLTLSLKQGSLLVMRGNSADMARHVMCPSQNKRVSITFFRIRPDT  438

Query  531  VENNSAEVVPPLTRAMTLWQP  593
              N+S    P     MT+WQP
Sbjct  439  YHNHSQPNSPRNDGVMTMWQP  459



>ref|XP_006296016.1| hypothetical protein CARUB_v10025161mg [Capsella rubella]
 gb|EOA28914.1| hypothetical protein CARUB_v10025161mg [Capsella rubella]
Length=459

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 162/207 (78%), Gaps = 10/207 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+N +LSGETF+L+NQ  KG KREL+QLG PIFG+  ++ A      EPIPT++
Sbjct  195  NQLREAGRNHQLSGETFVLFNQNTKGTKRELLQLGVPIFGSTTDEHAV-----EPIPTLV  249

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  250  QSVIDHLLQWRLIPEYKRPNGCVINFFDEDEHSQPFQKPPHVDQPISTLVLSESTMVFGH  309

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D+DGN+RGSL L LKEGSLLVMRGNSADMARH MC SPN+RV+ITFFK++     +
Sbjct  310  RLGVDNDGNFRGSLTLPLKEGSLLVMRGNSADMARHVMCPSPNKRVAITFFKLKP----D  365

Query  543  SAEVV-PPLTRAMTLWQPGIPSSPYNG  620
            S +V  PP+T  +TLW+PG P+ P  G
Sbjct  366  SGKVQPPPITNPVTLWRPGTPAPPACG  392



>ref|XP_010430544.1| PREDICTED: uncharacterized protein LOC104714781 [Camelina sativa]
Length=567

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIPT  176
            ELR  G NG+L+GETFIL+N+QIKGNKRELIQLG PIFG+VK D +   +++   EPIP 
Sbjct  263  ELREAGINGKLAGETFILFNKQIKGNKRELIQLGVPIFGHVKADDSNDSNNSVNIEPIPP  322

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VIDH + W LI E +RPNGC+INFF+EGEYSQPFLKPPHLEQP+STL+LSESTMAF
Sbjct  323  LLESVIDHFVTWRLIPEYKRPNGCVINFFEEGEYSQPFLKPPHLEQPISTLVLSESTMAF  382

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR-TCV  533
            GR L+ D++GN+RG L LSLK+GS+LVMRGNSADMARH MC S  +RVSITFF+IR    
Sbjct  383  GRILSSDNEGNFRGPLTLSLKQGSMLVMRGNSADMARHVMCPSQTKRVSITFFRIRPETY  442

Query  534  ENNSAEVVPPLTRAMTLWQP  593
             N+S    P     MT+WQP
Sbjct  443  HNHSRPTSPHNDGVMTMWQP  462



>ref|XP_010455955.1| PREDICTED: uncharacterized protein LOC104737461 [Camelina sativa]
Length=572

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 159/201 (79%), Gaps = 5/201 (2%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPIP  173
            ELR  G NG+L+GETFIL+N+QIKGNKRELIQLG PIFG+VK D     SSN    EPIP
Sbjct  267  ELREAGVNGKLAGETFILFNKQIKGNKRELIQLGVPIFGHVKADDNSNDSSNSVNIEPIP  326

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
             +LE VIDH + W LI E +RPNGC+INFF+EGEYSQPFLKPPHLEQP+STL+LSESTMA
Sbjct  327  PLLESVIDHFVTWRLIPEYKRPNGCVINFFEEGEYSQPFLKPPHLEQPISTLVLSESTMA  386

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR-TC  530
            FGR L+ D++GN+RG L LSLK+GS+LVMRGNSADMARH MC S N+RVSITFF+IR   
Sbjct  387  FGRILSSDNEGNFRGPLTLSLKQGSMLVMRGNSADMARHVMCPSQNKRVSITFFRIRPET  446

Query  531  VENNSAEVVPPLTRAMTLWQP  593
              N+S    P     MT+WQP
Sbjct  447  YHNHSRPTSPHNDGVMTMWQP  467



>ref|XP_010506854.1| PREDICTED: uncharacterized protein LOC104783394 [Camelina sativa]
Length=459

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 161/207 (78%), Gaps = 10/207 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+N +LSGETF+L+N+  KG KREL+QLG PIFGN   +      S EPIPT++
Sbjct  194  NQLREAGRNHQLSGETFVLFNKNTKGTKRELLQLGVPIFGNTTYE-----HSVEPIPTLV  248

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  249  QSVIDHLLQWRLIPEYKRPNGCVINFFDEDEHSQPFQKPPHVDQPISTLVLSESTMVFGH  308

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D+DGN+RGSL L LKEGSLLVMRGNSADMARH MC SPN+RV+ITFFK++     +
Sbjct  309  RLGVDNDGNFRGSLTLPLKEGSLLVMRGNSADMARHVMCPSPNKRVTITFFKLKP----D  364

Query  543  SAEVVP-PLTRAMTLWQPGIPSSPYNG  620
            S +V P P+T  ++LW+PG P+ P  G
Sbjct  365  SGKVQPRPITNPVSLWRPGTPAPPACG  391



>ref|XP_004148896.1| PREDICTED: uncharacterized protein LOC101203670 [Cucumis sativus]
Length=548

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 160/201 (80%), Gaps = 3/201 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLA--CQKSSNEPIPT  176
            ++LR    NGELSG TFIL+N+Q+KG++RE+IQLG PIF  + E+     Q S+ EPIP 
Sbjct  250  DDLRSAANNGELSGGTFILFNKQVKGSRREMIQLGVPIFRQIGEESGNNSQTSNIEPIPH  309

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            IL  VIDHLIQW LI E +RPNGC+ NFF+EGEYSQPF KPPHLEQP+STL+LSESTMAF
Sbjct  310  ILMTVIDHLIQWQLIPEYKRPNGCLFNFFEEGEYSQPFQKPPHLEQPISTLVLSESTMAF  369

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR++  D++GNY+G L LSLKEGSLLVMRGNSAD+ARH MC+SPN+RV+ITFF++R   +
Sbjct  370  GRSIVSDNEGNYKGPLTLSLKEGSLLVMRGNSADVARHVMCASPNKRVTITFFRVRPEYD  429

Query  537  NNSAEVVPPLTRAMTLWQPGI  599
               +   P ++ AMTLWQP +
Sbjct  430  QCQSP-TPQMSNAMTLWQPTV  449



>ref|XP_004158952.1| PREDICTED: uncharacterized LOC101203670 [Cucumis sativus]
Length=548

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 160/201 (80%), Gaps = 3/201 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLA--CQKSSNEPIPT  176
            ++LR    NGELSG TFIL+N+Q+KG++RE+IQLG PIF  + E+     Q S+ EPIP 
Sbjct  250  DDLRSAANNGELSGGTFILFNKQVKGSRREMIQLGVPIFRQIGEESGNNSQTSNIEPIPH  309

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            IL  VIDHLIQW LI E +RPNGC+ NFF+EGEYSQPF KPPHLEQP+STL+LSESTMAF
Sbjct  310  ILMTVIDHLIQWQLIPEYKRPNGCLFNFFEEGEYSQPFQKPPHLEQPISTLVLSESTMAF  369

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR++  D++GNY+G L LSLKEGSLLVMRGNSAD+ARH MC+SPN+RV+ITFF++R   +
Sbjct  370  GRSIVSDNEGNYKGPLTLSLKEGSLLVMRGNSADVARHVMCASPNKRVTITFFRVRPEYD  429

Query  537  NNSAEVVPPLTRAMTLWQPGI  599
               +   P ++ AMTLWQP +
Sbjct  430  QCQSP-TPQMSNAMTLWQPTV  449



>gb|KGN44860.1| hypothetical protein Csa_7G392330 [Cucumis sativus]
Length=583

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLA--CQKSSNEPIPT  176
            ++LR    NGELSG TFIL+N+Q+KG++RE+IQLG PIF  + E+     Q S+ EPIP 
Sbjct  285  DDLRSAANNGELSGGTFILFNKQVKGSRREMIQLGVPIFRQIGEESGNNSQTSNIEPIPH  344

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            IL  VIDHLIQW LI E +RPNGC+ NFF+EGEYSQPF KPPHLEQP+STL+LSESTMAF
Sbjct  345  ILMTVIDHLIQWQLIPEYKRPNGCLFNFFEEGEYSQPFQKPPHLEQPISTLVLSESTMAF  404

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR++  D++GNY+G L LSLKEGSLLVMRGNSAD+ARH MC+SPN+RV+ITFF++R   +
Sbjct  405  GRSIVSDNEGNYKGPLTLSLKEGSLLVMRGNSADVARHVMCASPNKRVTITFFRVRPEYD  464

Query  537  NNSAEVVPPLTRAMTLWQPGIPSS  608
               +   P ++ AMTLWQP +  +
Sbjct  465  QCQSP-TPQMSNAMTLWQPTVAGT  487



>emb|CDY21925.1| BnaC09g00310D [Brassica napus]
Length=386

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 162/212 (76%), Gaps = 6/212 (3%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIPT  176
            +LR  GQNG+LSGETFIL+N+QIKGNKREL+QLG PIF + +++     +++   EPIP 
Sbjct  81   DLREAGQNGKLSGETFILFNKQIKGNKRELVQLGVPIFSHARDENTNDSNNSVNIEPIPP  140

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VIDH I W LI E +RPNGC+INFF+EGE+SQPFLKPPHLEQP+STL+LSESTMAF
Sbjct  141  LLESVIDHFITWRLIPEYKRPNGCVINFFEEGEHSQPFLKPPHLEQPISTLVLSESTMAF  200

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L+ D++GN+RG L L LK+GSLLVMRGNSADMARH MC S  +RVSITFF++R  + 
Sbjct  201  GRILSSDNEGNFRGPLTLPLKQGSLLVMRGNSADMARHVMCPSQTKRVSITFFRVRPEIN  260

Query  537  NNSAEVVPPLTRAMTLWQPGIPSSPYNGTPDY  632
            N+++   P     MT+WQ      P   TP Y
Sbjct  261  NHNS---PHNDGVMTMWQQQPRHYPMAPTPYY  289



>gb|AFW77933.1| hypothetical protein ZEAMMB73_473012 [Zea mays]
Length=317

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 152/197 (77%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    ED  C     EPIP +L
Sbjct  8    NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEDANCH---TEPIPLVL  64

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  +INFFDE E+SQP+ KPPHL+ P+ TLLLSE+TMAFGR
Sbjct  65   QAVIDHLVLWRLIPESRKPNSVVINFFDEDEHSQPYFKPPHLDNPICTLLLSETTMAFGR  124

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  125  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFARVRPSTPVD  184

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+AMT WQP
Sbjct  185  MSPLPSP-TKAMTPWQP  200



>ref|NP_182329.2| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AEC10932.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=438

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 157/201 (78%), Gaps = 13/201 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+N +LSGETF+L+N+  KG KREL+QLG PIFGN  ++      S EPIPT++
Sbjct  188  NQLREAGRNHQLSGETFVLFNKNTKGTKRELLQLGVPIFGNTTDE-----HSVEPIPTLV  242

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  243  QSVIDHLLQWRLIPEYKRPNGCVINFFDEDEHSQPFQKPPHVDQPISTLVLSESTMVFGH  302

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D+DGN+RGSL L LKEGSLLVMRGNSADMARH MC SPN+RV+ITFFK++     +
Sbjct  303  RLGVDNDGNFRGSLTLPLKEGSLLVMRGNSADMARHVMCPSPNKRVAITFFKLKP----D  358

Query  543  SAEVVPPLTRAMTLWQPGIPS  605
            S +V PP     TLW+PG PS
Sbjct  359  SGKVQPP----PTLWRPGTPS  375



>gb|AAD13711.1| unknown protein [Arabidopsis thaliana]
Length=433

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 157/201 (78%), Gaps = 13/201 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+N +LSGETF+L+N+  KG KREL+QLG PIFGN  ++      S EPIPT++
Sbjct  183  NQLREAGRNHQLSGETFVLFNKNTKGTKRELLQLGVPIFGNTTDE-----HSVEPIPTLV  237

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  238  QSVIDHLLQWRLIPEYKRPNGCVINFFDEDEHSQPFQKPPHVDQPISTLVLSESTMVFGH  297

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D+DGN+RGSL L LKEGSLLVMRGNSADMARH MC SPN+RV+ITFFK++     +
Sbjct  298  RLGVDNDGNFRGSLTLPLKEGSLLVMRGNSADMARHVMCPSPNKRVAITFFKLKP----D  353

Query  543  SAEVVPPLTRAMTLWQPGIPS  605
            S +V PP     TLW+PG PS
Sbjct  354  SGKVQPP----PTLWRPGTPS  370



>ref|XP_002882147.1| hypothetical protein ARALYDRAFT_322448 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58406.1| hypothetical protein ARALYDRAFT_322448 [Arabidopsis lyrata subsp. 
lyrata]
Length=454

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 159/206 (77%), Gaps = 13/206 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+N +LSGETF+L+N+  KG KREL+QLG PIFGN  ++      S EPIPT++
Sbjct  195  NQLREAGRNHQLSGETFVLFNKNTKGTKRELLQLGVPIFGNTTDE-----HSVEPIPTLV  249

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW +I E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  250  QSVIDHLLQWRVIPEYKRPNGCVINFFDEDEHSQPFQKPPHVDQPISTLVLSESTMVFGH  309

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D+DGN+RGSL L LKEGSLLVMRGNSADMARH MC SPN+RV+ITFFK++     +
Sbjct  310  RLGVDNDGNFRGSLTLPLKEGSLLVMRGNSADMARHVMCPSPNKRVAITFFKLKP----D  365

Query  543  SAEVVPPLTRAMTLWQPGIPSSPYNG  620
            S +V PP     TLW+PG P+ P  G
Sbjct  366  SGKVQPP----PTLWRPGTPAPPACG  387



>ref|XP_008451400.1| PREDICTED: uncharacterized protein LOC103492703 [Cucumis melo]
Length=578

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 158/199 (79%), Gaps = 3/199 (2%)
 Frame = +3

Query  9    LRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLA--CQKSSNEPIPTIL  182
            LR    NGELSG TFIL+N+Q+KG++RE+IQLG PIF  + E+     Q S+ EPIP IL
Sbjct  282  LRSAANNGELSGGTFILFNKQVKGSRREMIQLGVPIFRQIGEESGNNSQTSNIEPIPHIL  341

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              VIDHLIQW LI E +RPNGC+ NFF+EGEYSQPF KPPHLEQP+STL+LSESTMAFGR
Sbjct  342  MTVIDHLIQWQLIPEYKRPNGCLFNFFEEGEYSQPFQKPPHLEQPISTLVLSESTMAFGR  401

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            ++  D++GNY+G L LSLKEGSLLVMRGNSAD+ARH MC+SPN+RV+ITFF++R   +  
Sbjct  402  SIVSDNEGNYKGPLTLSLKEGSLLVMRGNSADVARHVMCASPNKRVTITFFRVRPDYDQC  461

Query  543  SAEVVPPLTRAMTLWQPGI  599
             +   P ++ AMTLWQP +
Sbjct  462  QSP-TPQMSNAMTLWQPTV  479



>gb|AFW77935.1| hypothetical protein ZEAMMB73_473012 [Zea mays]
Length=337

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 152/197 (77%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    ED  C     EPIP +L
Sbjct  28   NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEDANCH---TEPIPLVL  84

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  +INFFDE E+SQP+ KPPHL+ P+ TLLLSE+TMAFGR
Sbjct  85   QAVIDHLVLWRLIPESRKPNSVVINFFDEDEHSQPYFKPPHLDNPICTLLLSETTMAFGR  144

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  145  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFARVRPSTPVD  204

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+AMT WQP
Sbjct  205  MSPLPSP-TKAMTPWQP  220



>emb|CDY22086.1| BnaA09g01150D [Brassica napus]
Length=584

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 163/213 (77%), Gaps = 8/213 (4%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIPT  176
            +LR  GQNG+LSGETFIL+N+QIKGNKREL+QLG PIFG+ +++     +++   EPIP 
Sbjct  280  DLREAGQNGKLSGETFILFNKQIKGNKRELVQLGVPIFGHARDENTNDSNNSVNIEPIPP  339

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VIDH I W LI E +RPNGC+INFF+EGE+SQPFLKPPHLEQP+STL+LSESTMAF
Sbjct  340  LLESVIDHFITWRLIPEYKRPNGCVINFFEEGEHSQPFLKPPHLEQPISTLVLSESTMAF  399

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L+ D++GN+RG L L LK+GSLLVMRGNSADMARH MC S  +RVSITFF++R  + 
Sbjct  400  GRILSSDNEGNFRGPLTLPLKQGSLLVMRGNSADMARHVMCPSQTKRVSITFFRVRPEIN  459

Query  537  NNSAEVVPPLTRAMTLWQPGIPSS-PYNGTPDY  632
            +NS    P     MT+WQ   P   P   TP Y
Sbjct  460  HNS----PHNDGVMTMWQQQQPCHYPMTPTPYY  488



>ref|NP_001147582.1| oxidoreductase, 2OG-Fe oxygenase family protein [Zea mays]
 gb|ACG27985.1| oxidoreductase, 2OG-Fe oxygenase family protein [Zea mays]
 gb|AFW77934.1| oxidoreductase, 2OG-Fe oxygenase family protein [Zea mays]
Length=345

 Score =   262 bits (670),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 152/197 (77%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    ED  C     EPIP +L
Sbjct  36   NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEDANCH---TEPIPLVL  92

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  +INFFDE E+SQP+ KPPHL+ P+ TLLLSE+TMAFGR
Sbjct  93   QAVIDHLVLWRLIPESRKPNSVVINFFDEDEHSQPYFKPPHLDNPICTLLLSETTMAFGR  152

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  153  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFARVRPSTPVD  212

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+AMT WQP
Sbjct  213  MSPLPSP-TKAMTPWQP  228



>ref|XP_010542876.1| PREDICTED: uncharacterized protein LOC104815949 [Tarenaya hassleriana]
Length=550

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 161/204 (79%), Gaps = 9/204 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIP  173
            ++LR  GQNG+LSGETFIL+N+Q+KGNKRE+IQLG PIFG++K++L+         EPIP
Sbjct  240  SQLRASGQNGKLSGETFILFNKQMKGNKREMIQLGVPIFGHLKDELSTDDVHAVDIEPIP  299

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
             +L+ VIDHL+ W LI E ++PNGCIINFF+EGEYSQPFLKPPHLEQP+STL+LSEST+A
Sbjct  300  PLLQSVIDHLVTWKLIPEYKKPNGCIINFFEEGEYSQPFLKPPHLEQPISTLVLSESTLA  359

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCV  533
            FGR L+ D++GN+RG L LSLK+GSLLVMRGNSADMARH MC S  +RVSIT F++R   
Sbjct  360  FGRILSSDNEGNFRGPLTLSLKQGSLLVMRGNSADMARHVMCPSHTKRVSITLFRVRP--  417

Query  534  ENNSAEVVPPLTR----AMTLWQP  593
            E +    +P   +     MT+WQP
Sbjct  418  EASQIHSLPTTLQTDGGVMTMWQP  441



>ref|XP_009111249.1| PREDICTED: uncharacterized protein LOC103836707 [Brassica rapa]
Length=585

 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 164/213 (77%), Gaps = 7/213 (3%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIPT  176
            +LR  GQNG+LSGETFIL+N+QIKGNKREL+QLG PIFG+ +++     +++   EPIP 
Sbjct  281  DLREAGQNGKLSGETFILFNKQIKGNKRELVQLGVPIFGHARDENTNDSNNSVNIEPIPP  340

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VIDH I W LI E +RPNGC+INFF+EGE+SQPFLKPPHLEQP+STL+LSESTMAF
Sbjct  341  LLESVIDHFITWRLIPEYKRPNGCVINFFEEGEHSQPFLKPPHLEQPISTLVLSESTMAF  400

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L+ D++GN+RG L L LK+GSLLVMRGNSADMARH MC S  +RVSITFF++R  + 
Sbjct  401  GRILSSDNEGNFRGPLTLPLKQGSLLVMRGNSADMARHVMCPSQTKRVSITFFRVRPEIN  460

Query  537  NNSAEVVPPLTRAMTLWQPGIPSS-PYNGTPDY  632
            N+++   P     MT+WQ   P   P   TP Y
Sbjct  461  NHNS---PHNDGVMTMWQQQQPCHYPMTPTPYY  490



>ref|XP_006396520.1| hypothetical protein EUTSA_v10028541mg [Eutrema salsugineum]
 gb|ESQ37973.1| hypothetical protein EUTSA_v10028541mg [Eutrema salsugineum]
Length=571

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 163/211 (77%), Gaps = 5/211 (2%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIPT  176
            +LR  GQNG+L+G++FIL+N+QIKGNKRELIQLG PIFG+ K++ +   + +   EPIP 
Sbjct  260  QLREAGQNGKLAGDSFILFNKQIKGNKRELIQLGVPIFGHAKDENSNDSNDSVNIEPIPP  319

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VI H + W L+ E +RPNGC+INFF+EGEYSQPFLKPPHLEQP+STL+LSESTMAF
Sbjct  320  LLESVIHHFVTWRLVPEYKRPNGCVINFFEEGEYSQPFLKPPHLEQPISTLVLSESTMAF  379

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE  536
            GR L+ D++GN+RG L LSLK+GSLLVMRGNSADMARH MC S  +RVSITFF++R    
Sbjct  380  GRILSSDNEGNFRGPLTLSLKQGSLLVMRGNSADMARHVMCPSNTKRVSITFFRVRPETN  439

Query  537  NNSAEV-VPPLTRAMTLWQPGIPSSPYNGTP  626
            +N +++  P     MT+WQ   P   Y  TP
Sbjct  440  HNHSQLNSPHHDGVMTMWQQPPPCH-YQMTP  469



>gb|AFW81533.1| hypothetical protein ZEAMMB73_697460 [Zea mays]
 gb|AFW81534.1| hypothetical protein ZEAMMB73_697460 [Zea mays]
Length=317

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 153/197 (78%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+Q+KGNKRE+IQLG P+F    E+  C     EPIP +L
Sbjct  8    NEIRQAGRNGELSGETFIFFNKQMKGNKREIIQLGVPLFQPTTEEANCH---TEPIPLVL  64

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+ TLLLSE+TMAFGR
Sbjct  65   QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPICTLLLSETTMAFGR  124

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C+S NRRVSITF ++R     +
Sbjct  125  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCTSSNRRVSITFARVRPSTPVD  184

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+A+T WQP
Sbjct  185  LSPLPSP-TKALTPWQP  200



>dbj|BAJ97023.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 155/197 (79%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F +  E+  C     EPIP +L
Sbjct  251  NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQHTTEETNCHI---EPIPVVL  307

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+STLLLSE++MAFGR
Sbjct  308  QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPISTLLLSETSMAFGR  367

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  368  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFVRVRPSTPVD  427

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+AMTLWQP
Sbjct  428  LSPLPSP-TKAMTLWQP  443



>ref|XP_009393115.1| PREDICTED: uncharacterized protein LOC103978888 [Musa acuminata 
subsp. malaccensis]
Length=548

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 159/200 (80%), Gaps = 7/200 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR+ G+ GELSGETFI +N+Q+KGNKRE+IQLG P+F +  ED A   S+ E IP  L
Sbjct  266  NELRLAGRRGELSGETFIFFNKQMKGNKREIIQLGVPLFQSTTEDAA---SNIESIPPAL  322

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN CIINFFDE E+SQP+ KPPHL+ P+STLLLSE+TMAFGR
Sbjct  323  QTVIDHLVHWRLIPESRKPNSCIINFFDEDEHSQPYFKPPHLDNPISTLLLSETTMAFGR  382

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTC--VE  536
            +L  D +GNY+GSL L +KEG+LLVMRGNSA+MARH +C+SPN+R+ ITF K+R+   + 
Sbjct  383  SLVSDHEGNYKGSLTLPIKEGTLLVMRGNSAEMARHVVCASPNKRMIITFVKVRSANHLA  442

Query  537  NNSAEVVPPLTRAMTLWQPG  596
            ++ A + P  T+AMTLWQP 
Sbjct  443  DSPAALQP--TKAMTLWQPA  460



>ref|XP_009412173.1| PREDICTED: uncharacterized protein LOC103993726 [Musa acuminata 
subsp. malaccensis]
Length=561

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR+ G+ GELSGETFI +N+Q+KGNKRE+IQLG P+F +  ++ A   S+ EPIPT L
Sbjct  278  NELRLAGRGGELSGETFIFFNKQMKGNKREIIQLGVPLFQSTTKEAA---SNIEPIPTAL  334

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI E+R+PN CIINFFDE E+SQP+ KPPHL+ P+STLLLS++TMAFGR
Sbjct  335  QTVIDHLVQWRLIPESRKPNSCIINFFDEDEHSQPYFKPPHLDNPISTLLLSDTTMAFGR  394

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVE-N  539
            +L  D +GNY+G L LS+ EGSLLVMRGNSADMARH +C+SPNRR+ ITF K+R      
Sbjct  395  SLVSDHEGNYKGPLTLSINEGSLLVMRGNSADMARHVVCASPNRRIIITFVKVRAASHPT  454

Query  540  NSAEVVPPLTRAMTLWQPG  596
            +S   +   T+ M LWQP 
Sbjct  455  DSPTALQQPTKTMALWQPA  473



>gb|KFK30895.1| hypothetical protein AALP_AA6G039900 [Arabis alpina]
Length=564

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 160/200 (80%), Gaps = 5/200 (3%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIPT  176
            +LR  GQNG+LSGE++I++N+Q+KGNKRELIQLG PIFG+ K++ +   +++   EPIP 
Sbjct  256  DLREAGQNGKLSGESYIMFNKQVKGNKRELIQLGVPIFGHAKDENSNDSNNSVNIEPIPP  315

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +LE VIDH + W L+ E +RPNGC+INFF+EGEYSQPFLKPPHLEQP+STL+LSESTMA+
Sbjct  316  LLESVIDHFVTWRLVPEYKRPNGCVINFFEEGEYSQPFLKPPHLEQPISTLVLSESTMAY  375

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR--TC  530
            GR L+ D++GN++G L LSLK+GSLLVMRGNSADMARH MC S  +RVSITFF++R  T 
Sbjct  376  GRILSSDNEGNFKGPLTLSLKQGSLLVMRGNSADMARHVMCPSQTKRVSITFFRVRPETN  435

Query  531  VENNSAEVVPPLTRAMTLWQ  590
              ++S    P     MT+WQ
Sbjct  436  HHHHSQPNSPHNDGVMTMWQ  455



>gb|KFK37557.1| hypothetical protein AALP_AA4G272300 [Arabis alpina]
Length=464

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 158/205 (77%), Gaps = 14/205 (7%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILE  185
            ELR  G+N ELSGETF+L+N+  K  KRELIQLG PIFGN        + S  PIPT+L+
Sbjct  204  ELREAGRNHELSGETFVLFNKNTKETKRELIQLGIPIFGN--------EHSVAPIPTLLQ  255

Query  186  VVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRT  365
             VID L+QW LI E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG  
Sbjct  256  SVIDQLLQWRLIPEYKRPNGCVINFFDEEEHSQPFQKPPHVDQPISTLVLSESTMVFGHR  315

Query  366  LACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENNS  545
            L  D+DGN+RGSL LSLKEGSLLVMRGNSADMARH MC SPN+RV+ITFFK++     +S
Sbjct  316  LGVDNDGNFRGSLTLSLKEGSLLVMRGNSADMARHVMCPSPNKRVAITFFKLKP----DS  371

Query  546  AEVVP-PLTRAMTLWQPGIPS-SPY  614
            ++V P P   ++ LW+PG P+ +PY
Sbjct  372  SKVQPSPAKNSVALWRPGTPALNPY  396



>ref|XP_003568474.1| PREDICTED: uncharacterized protein LOC100841736 isoform X2 [Brachypodium 
distachyon]
Length=552

 Score =   263 bits (671),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 155/197 (79%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+Q+KGNKRE+IQLG P+F +  E+  C     EPIP +L
Sbjct  252  NEIRQAGRNGELSGETFIFFNKQMKGNKREIIQLGVPLFQHTTEETNCHI---EPIPLVL  308

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+STLLLSE++MAFGR
Sbjct  309  QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPISTLLLSETSMAFGR  368

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  369  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFVRVRPSTPVD  428

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+AMTLWQP
Sbjct  429  LSPLPSP-TKAMTLWQP  444



>ref|XP_010231391.1| PREDICTED: uncharacterized protein LOC100841736 isoform X1 [Brachypodium 
distachyon]
Length=553

 Score =   263 bits (671),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 155/197 (79%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+Q+KGNKRE+IQLG P+F +  E+  C     EPIP +L
Sbjct  253  NEIRQAGRNGELSGETFIFFNKQMKGNKREIIQLGVPLFQHTTEETNCHI---EPIPLVL  309

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+STLLLSE++MAFGR
Sbjct  310  QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPISTLLLSETSMAFGR  369

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  370  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFVRVRPSTPVD  429

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+AMTLWQP
Sbjct  430  LSPLPSP-TKAMTLWQP  445



>gb|EEE63665.1| hypothetical protein OsJ_18483 [Oryza sativa Japonica Group]
Length=370

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 151/195 (77%), Gaps = 4/195 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    E+  C     E IP +L
Sbjct  65   NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEESNCHI---EAIPLVL  121

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+STLLLSE+TMAFGR
Sbjct  122  QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPISTLLLSETTMAFGR  181

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  182  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFVRVRPSTPVD  241

Query  543  SAEVVPPLTRAMTLW  587
             + +  P T+AMTLW
Sbjct  242  LSPLPSP-TKAMTLW  255



>ref|XP_008647787.1| PREDICTED: oxidoreductase, 2OG-Fe oxygenase family protein isoform 
X1 [Zea mays]
 gb|AFW77937.1| hypothetical protein ZEAMMB73_473012 [Zea mays]
Length=573

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 152/197 (77%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    ED  C     EPIP +L
Sbjct  264  NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEDANCH---TEPIPLVL  320

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  +INFFDE E+SQP+ KPPHL+ P+ TLLLSE+TMAFGR
Sbjct  321  QAVIDHLVLWRLIPESRKPNSVVINFFDEDEHSQPYFKPPHLDNPICTLLLSETTMAFGR  380

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  381  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFARVRPSTPVD  440

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+AMT WQP
Sbjct  441  MSPLPSP-TKAMTPWQP  456



>ref|XP_004962145.1| PREDICTED: uncharacterized protein LOC101766885 [Setaria italica]
Length=582

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 153/197 (78%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    E+  C     EPIP +L
Sbjct  271  NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEEANCHI---EPIPLVL  327

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+STLLLSE+TMAFGR
Sbjct  328  QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPISTLLLSETTMAFGR  387

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  388  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFARVRPSTPVD  447

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+AMT WQP
Sbjct  448  LSPLPSP-TKAMTPWQP  463



>ref|XP_009142483.1| PREDICTED: uncharacterized protein LOC103866332 isoform X1 [Brassica 
rapa]
Length=476

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 155/204 (76%), Gaps = 9/204 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+N EL GETF+L+N+  KG KRELIQLG PIFGN  ++      S  PIPT+L
Sbjct  205  NGLREAGRNQELPGETFVLFNKNTKGTKRELIQLGIPIFGNTTDE-----HSVAPIPTLL  259

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            E VIDHL+QW LI E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  260  ESVIDHLLQWRLIPEYKRPNGCVINFFDEEEHSQPFQKPPHVDQPISTLVLSESTMVFGH  319

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
                DSDGN+RGSL L LKEGSLLVMRGNSA+MARH MC S N+RV+ITFFK++    ++
Sbjct  320  RFGVDSDGNFRGSLTLPLKEGSLLVMRGNSANMARHVMCPSLNKRVAITFFKLKP---DS  376

Query  543  SAEVVPPLT-RAMTLWQPGIPSSP  611
            S++   PLT   +TLW+ G P+ P
Sbjct  377  SSKAQAPLTMNHVTLWRQGNPAPP  400



>ref|XP_009142484.1| PREDICTED: uncharacterized protein LOC103866332 isoform X2 [Brassica 
rapa]
Length=475

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 155/204 (76%), Gaps = 9/204 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+N EL GETF+L+N+  KG KRELIQLG PIFGN  ++      S  PIPT+L
Sbjct  204  NGLREAGRNQELPGETFVLFNKNTKGTKRELIQLGIPIFGNTTDE-----HSVAPIPTLL  258

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            E VIDHL+QW LI E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  259  ESVIDHLLQWRLIPEYKRPNGCVINFFDEEEHSQPFQKPPHVDQPISTLVLSESTMVFGH  318

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
                DSDGN+RGSL L LKEGSLLVMRGNSA+MARH MC S N+RV+ITFFK++    ++
Sbjct  319  RFGVDSDGNFRGSLTLPLKEGSLLVMRGNSANMARHVMCPSLNKRVAITFFKLKP---DS  375

Query  543  SAEVVPPLT-RAMTLWQPGIPSSP  611
            S++   PLT   +TLW+ G P+ P
Sbjct  376  SSKAQAPLTMNHVTLWRQGNPAPP  399



>ref|XP_002441065.1| hypothetical protein SORBIDRAFT_09g019740 [Sorghum bicolor]
 gb|EES19495.1| hypothetical protein SORBIDRAFT_09g019740 [Sorghum bicolor]
Length=595

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 152/197 (77%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    E+  C     EPIP +L
Sbjct  286  NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEEANCH---TEPIPLVL  342

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+ TLLLSE+TMAFGR
Sbjct  343  QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPICTLLLSETTMAFGR  402

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  403  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFARVRPSTPVD  462

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+AMT WQP
Sbjct  463  LSPLPSP-TKAMTPWQP  478



>gb|KCW49947.1| hypothetical protein EUGRSUZ_K03407 [Eucalyptus grandis]
Length=546

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 157/205 (77%), Gaps = 5/205 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLA-CQKSSNEPIPTI  179
            +ELR  G+NGEL GETFIL+N+Q+KGN+ ELIQ G P F +++ED     +S   PIP I
Sbjct  237  DELRAAGRNGELPGETFILFNEQMKGNRTELIQFGLPTFEHIEEDTKDSARSKIMPIPAI  296

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L+ VIDHL+ W L+ E +RPNGCIINFFD+GE S+PFLKPPHL+QPVSTL LSES +AFG
Sbjct  297  LQDVIDHLVLWQLLPEYKRPNGCIINFFDKGERSRPFLKPPHLDQPVSTLFLSESRVAFG  356

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVEN  539
            R L  D +G+Y+G L+LSLKEGSLLVMRGNSA +ARHAMC SPN RV+ITFF+IR    N
Sbjct  357  RFLMSDHEGSYKGRLMLSLKEGSLLVMRGNSASVARHAMCPSPNSRVAITFFRIRP---N  413

Query  540  NSAEVVPPLTRAMTLWQPGIPSSPY  614
            ++ +    LT  M LWQP I  SP+
Sbjct  414  SNQDQTKSLTSDMPLWQPSI-RSPF  437



>ref|XP_010038135.1| PREDICTED: uncharacterized protein LOC104426697 [Eucalyptus grandis]
Length=569

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 157/205 (77%), Gaps = 5/205 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLA-CQKSSNEPIPTI  179
            +ELR  G+NGEL GETFIL+N+Q+KGN+ ELIQ G P F +++ED     +S   PIP I
Sbjct  260  DELRAAGRNGELPGETFILFNEQMKGNRTELIQFGLPTFEHIEEDTKDSARSKIMPIPAI  319

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L+ VIDHL+ W L+ E +RPNGCIINFFD+GE S+PFLKPPHL+QPVSTL LSES +AFG
Sbjct  320  LQDVIDHLVLWQLLPEYKRPNGCIINFFDKGERSRPFLKPPHLDQPVSTLFLSESRVAFG  379

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVEN  539
            R L  D +G+Y+G L+LSLKEGSLLVMRGNSA +ARHAMC SPN RV+ITFF+IR    N
Sbjct  380  RFLMSDHEGSYKGRLMLSLKEGSLLVMRGNSASVARHAMCPSPNSRVAITFFRIRP---N  436

Query  540  NSAEVVPPLTRAMTLWQPGIPSSPY  614
            ++ +    LT  M LWQP I  SP+
Sbjct  437  SNQDQTKSLTSDMPLWQPSI-RSPF  460



>ref|XP_008656187.1| PREDICTED: uncharacterized protein LOC103635534 [Zea mays]
 gb|AFW81532.1| hypothetical protein ZEAMMB73_697460 [Zea mays]
Length=584

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 153/197 (78%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+Q+KGNKRE+IQLG P+F    E+  C     EPIP +L
Sbjct  275  NEIRQAGRNGELSGETFIFFNKQMKGNKREIIQLGVPLFQPTTEEANCH---TEPIPLVL  331

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+ TLLLSE+TMAFGR
Sbjct  332  QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPICTLLLSETTMAFGR  391

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C+S NRRVSITF ++R     +
Sbjct  392  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCTSSNRRVSITFARVRPSTPVD  451

Query  543  SAEVVPPLTRAMTLWQP  593
             + +  P T+A+T WQP
Sbjct  452  LSPLPSP-TKALTPWQP  467



>ref|XP_010524003.1| PREDICTED: uncharacterized protein LOC104802219 [Tarenaya hassleriana]
Length=443

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELR  G+N ELSGETF+L+N+  +GNKRELIQLG PIFG+ K++      S EPIP +L
Sbjct  191  NELREAGRNQELSGETFVLFNKNTRGNKRELIQLGVPIFGHAKDE---HSGSIEPIPALL  247

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL++W +I E +RPNGC+I+FFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  248  QNVIDHLLEWRVIPEYKRPNGCVIDFFDEEEHSQPFQKPPHVDQPISTLILSESTMVFGH  307

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             L  D DGN+RGSL LSLKEGSLLVMRGNSA+MA+H  C SPN+RVSITFFK++
Sbjct  308  RLGVDDDGNFRGSLTLSLKEGSLLVMRGNSAEMAKHVTCPSPNKRVSITFFKLK  361



>ref|XP_009402473.1| PREDICTED: uncharacterized protein LOC103986253 [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 155/201 (77%), Gaps = 8/201 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +ELR+ G+ GEL GET+I +N+++KGNKRE+IQLG P+F +  E      S+ EPIP+ L
Sbjct  228  DELRLAGRGGELPGETYIFFNKEMKGNKREIIQLGVPLFQSTTE----AASNIEPIPSAL  283

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI E R+P+ CIINFFDE E+SQP+ KPPHL+ P+STL+LSE+T+AFGR
Sbjct  284  QTVIDHLVQWRLIPETRKPDSCIINFFDEDEHSQPYFKPPHLDNPISTLVLSETTIAFGR  343

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR---TCV  533
            +L  D +GNY+GSL + +K+GSLLVMRGNSADMARH +C+SPN+RV +TF K+R      
Sbjct  344  SLVSDHEGNYKGSLTVPIKQGSLLVMRGNSADMARHVVCASPNKRVIVTFVKVRHAAARQ  403

Query  534  ENNSAEVVPPLTRAMTLWQPG  596
               S   + P T+AMT+WQPG
Sbjct  404  AAASPTALQP-TKAMTVWQPG  423



>gb|EMT23125.1| hypothetical protein F775_27644 [Aegilops tauschii]
Length=412

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 154/228 (68%), Gaps = 35/228 (15%)
 Frame = +3

Query  3    NELRVPGQNGELS-------------------------------GETFILYNQQIKGNKR  89
            NE+R  G+NGELS                               GETFI +N+QIKGNKR
Sbjct  81   NEIRQAGRNGELSEEKLGMNVYINYSNMLDHFSLLDRNSNITSKGETFIFFNKQIKGNKR  140

Query  90   ELIQLGTPIFGNVKEDLACQKSSNEPIPTILEVVIDHLIQWHLISENRRPNGCIINFFDE  269
            E+IQLG P+F +  E+  C     EPIP +L+ VIDHL+ W LI E+R+PN  IINFFDE
Sbjct  141  EIIQLGVPLFQHTTEETNCHI---EPIPVVLQAVIDHLVLWRLIPESRKPNSVIINFFDE  197

Query  270  GEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGN  449
             E+SQP+ KPPHL+ P+STLLLSE+ MAFGR+L  DS+GNY+G L LSLK+GSLLVMRGN
Sbjct  198  DEHSQPYFKPPHLDNPISTLLLSETLMAFGRSLVTDSNGNYKGPLTLSLKQGSLLVMRGN  257

Query  450  SADMARHAMCSSPNRRVSITFFKIRTCVENNSAEVVPPLTRAMTLWQP  593
            SADMARH +C S NRRVSITF ++R     + + +  P T+AMTLWQP
Sbjct  258  SADMARHVVCPSSNRRVSITFVRVRPSTPVDLSPLPSP-TKAMTLWQP  304



>gb|EEC79195.1| hypothetical protein OsI_19903 [Oryza sativa Indica Group]
Length=670

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 154/204 (75%), Gaps = 10/204 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC--QKSSN-----  161
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    E+  C  +K  N     
Sbjct  353  NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEESNCMIEKLDNSTVIC  412

Query  162  --EPIPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLL  335
              E IP +L+ VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+STLLL
Sbjct  413  HIEAIPLVLQAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPISTLLL  472

Query  336  SESTMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFF  515
            SE+TMAFGR+L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF 
Sbjct  473  SETTMAFGRSLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFV  532

Query  516  KIRTCVENNSAEVVPPLTRAMTLW  587
            ++R     + + +  P T+AMTLW
Sbjct  533  RVRPSTPVDLSPLPSP-TKAMTLW  555



>emb|CDY55191.1| BnaCnng28350D [Brassica napus]
Length=468

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 146/192 (76%), Gaps = 9/192 (5%)
 Frame = +3

Query  39   SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILEVVIDHLIQWHL  218
            +GETF+L+N+  KG KRELIQLG PIFGN  ++      S  PIPTILE VIDHL+QW L
Sbjct  209  AGETFVLFNKNTKGTKRELIQLGVPIFGNTTDE-----HSVAPIPTILESVIDHLLQWRL  263

Query  219  ISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTLACDSDGNYRG  398
            I E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSES M FG     D+DG +RG
Sbjct  264  IPEYKRPNGCVINFFDEEEHSQPFQKPPHVDQPISTLVLSESNMVFGHRFGVDTDGTFRG  323

Query  399  SLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENNSAEVVPPLT-RA  575
            SL L LKEGSLLVMRGNSA+MARH MC S N+RV+ITFFK++    ++S +  PPLT   
Sbjct  324  SLTLPLKEGSLLVMRGNSANMARHVMCPSLNKRVAITFFKLK---PDSSCKAQPPLTMNH  380

Query  576  MTLWQPGIPSSP  611
            +TLW+ G P+ P
Sbjct  381  VTLWRQGTPAPP  392



>ref|XP_006398000.1| hypothetical protein EUTSA_v10001455mg [Eutrema salsugineum]
 gb|ESQ39453.1| hypothetical protein EUTSA_v10001455mg [Eutrema salsugineum]
Length=434

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 155/206 (75%), Gaps = 8/206 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+N EL GETF+L+N+  KG KRELIQLG PIFGN  +     + S  PIP +L
Sbjct  167  NGLREAGRNHELPGETFVLFNKNSKGTKRELIQLGFPIFGNTTD-----QHSVAPIPILL  221

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI + +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LS+STM FG 
Sbjct  222  QSVIDHLLQWRLIPDYKRPNGCVINFFDEEEHSQPFQKPPHVDQPISTLVLSDSTMVFGH  281

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             L  D+DGN+RGSL L LK+GSLLVMRGNSADMARH MC SP +RV+ITFFK++   ++ 
Sbjct  282  RLGVDNDGNFRGSLTLPLKQGSLLVMRGNSADMARHVMCPSPTKRVAITFFKLKP--DSC  339

Query  543  SAEVVPPLTRAMTLWQPGIPS-SPYN  617
              +  PP T  +TLW+P  P  +PY+
Sbjct  340  KVQPPPPTTNPVTLWRPDTPPLNPYS  365



>emb|CDX80147.1| BnaA05g00090D [Brassica napus]
Length=445

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 139/177 (79%), Gaps = 8/177 (5%)
 Frame = +3

Query  39   SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILEVVIDHLIQWHL  218
            +GETF+L+N+  KG KRELIQLG PIFGN  ++      S  PIPT+LE VIDHL+QW L
Sbjct  204  AGETFVLFNKNTKGTKRELIQLGIPIFGNTTDE-----HSVAPIPTLLESVIDHLLQWRL  258

Query  219  ISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTLACDSDGNYRG  398
            I E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG     DSDGN+RG
Sbjct  259  IPEYKRPNGCVINFFDEEEHSQPFQKPPHVDQPISTLVLSESTMVFGHRFGVDSDGNFRG  318

Query  399  SLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENNSAEVVPPLT  569
            SL L LKEGSLLVMRGNSA+MARH MC S N+RV+ITFFK++    ++S++   PLT
Sbjct  319  SLTLPLKEGSLLVMRGNSANMARHVMCPSLNKRVAITFFKLKP---DSSSKAQAPLT  372



>ref|XP_006850838.1| hypothetical protein AMTR_s00025p00132640 [Amborella trichopoda]
 gb|ERN12419.1| hypothetical protein AMTR_s00025p00132640 [Amborella trichopoda]
Length=327

 Score =   225 bits (573),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 149/207 (72%), Gaps = 12/207 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NEL + GQ GEL GET+I+ N+Q+  NKRE+IQLG PIFG  KE+ A    + EPIP  L
Sbjct  28   NELHLAGQKGELLGETYIVLNRQLHANKREIIQLGVPIFGLKKEESA---RTVEPIPASL  84

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTL-LLSESTMAFG  359
              VIDHL+QW+LI E  RPN C+IN+F+EG++SQP+LKPPH + P+STL L SE  M FG
Sbjct  85   HAVIDHLVQWNLIPETARPNCCVINYFNEGDFSQPYLKPPHFDLPISTLSLSSECKMVFG  144

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVEN  539
              LA D  GNY GSL+LSLKEGSL+VM  + A++ARHA+CSSP +R++ITF K++    N
Sbjct  145  PVLANDQHGNYNGSLMLSLKEGSLVVMTRHCAEIARHAICSSPTKRITITFLKVQAKPIN  204

Query  540  NSAEVVPPLTR------AMTLWQPGIP  602
             +   +PPL++      A+ L QPGIP
Sbjct  205  QNR--LPPLSQQASTAMAVALSQPGIP  229



>ref|XP_007144595.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
 ref|XP_007144597.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
 gb|ESW16589.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
 gb|ESW16591.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
Length=364

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 126/144 (88%), Gaps = 3/144 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+ V GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +KED+   KS+ EPIP +L
Sbjct  210  NEIHVAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKEDV---KSNIEPIPALL  266

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHLIQW L+ E +RPNGCIINFF+EGE+SQPFLKPPHL+QPVSTLLLSESTMAFGR
Sbjct  267  QGVIDHLIQWQLLPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPVSTLLLSESTMAFGR  326

Query  363  TLACDSDGNYRGSLILSLKEGSLL  434
             L  ++DGNY+G L+LSLK+G +L
Sbjct  327  ILMSENDGNYKGPLMLSLKQGYIL  350



>ref|XP_006655303.1| PREDICTED: uncharacterized protein LOC102710594 [Oryza brachyantha]
Length=217

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    E+  C     E IP +L
Sbjct  37   NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEESNCHI---EAIPLVL  93

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+STLLLSE+TMAFGR
Sbjct  94   QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPISTLLLSETTMAFGR  153

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMAR  467
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMA+
Sbjct  154  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMAQ  188



>gb|KEH43287.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=377

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            +E+   GQNGELSGETFIL+N+Q+KGNKRELIQLG PIFG +KED    KS+ EPIP +L
Sbjct  229  DEIHTAGQNGELSGETFILFNKQMKGNKRELIQLGVPIFGQIKED---TKSNIEPIPALL  285

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDH IQWHL+ E +RPNGCIINFF+EGE+SQPFLKPPHL+QPV+TLLLSESTMAFGR
Sbjct  286  QRVIDHFIQWHLLPEYKRPNGCIINFFEEGEFSQPFLKPPHLDQPVTTLLLSESTMAFGR  345

Query  363  TLACDSDGNYRGSLILSLKEGSL  431
             L  ++DGNY+G L+LSLK+G +
Sbjct  346  ILMSENDGNYKGPLMLSLKKGYI  368



>gb|EYU20291.1| hypothetical protein MIMGU_mgv1a026021mg, partial [Erythranthe 
guttata]
Length=224

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 131/183 (72%), Gaps = 13/183 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN--EPIPT  176
            NELRV GQNG+LSGETF  YNQ  + N RE IQ G P+F  +K D   Q  +   EPIPT
Sbjct  44   NELRVAGQNGKLSGETFGSYNQHTRKN-REFIQFGVPMFELIKVDETNQFPTRYIEPIPT  102

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            +L+ +I+  IQ + I ++RRPNGCIINFFDEGEYS PF+KPPHL+QP+S L+LSES MAF
Sbjct  103  LLQGLIEEAIQRNWIPKDRRPNGCIINFFDEGEYSHPFVKPPHLDQPISILILSESRMAF  162

Query  357  G--------RTLACDSDGNYRGSLILS-LKEGSLLVMRGNSADMARHAMCSSPNRRVSIT  509
            G        RT+  D  GNYR   ILS LKEGSLL++ G S+D   HAMC+SPN+RV IT
Sbjct  163  GDTVLGGTSRTILGDGKGNYRRGFILSPLKEGSLLILNGISSDTV-HAMCASPNKRVIIT  221

Query  510  FFK  518
            FFK
Sbjct  222  FFK  224



>gb|AAT85147.1| hypothetical protein [Oryza sativa Japonica Group]
Length=318

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 125/195 (64%), Gaps = 38/195 (19%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSG                                       E IP +L
Sbjct  47   NEIRQAGRNGELSGHI-------------------------------------EAIPLVL  69

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+ W LI E+R+PN  IINFFDE E+SQP+ KPPHL+ P+STLLLSE+TMAFGR
Sbjct  70   QAVIDHLVLWRLIPESRKPNSVIINFFDEDEHSQPYFKPPHLDNPISTLLLSETTMAFGR  129

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
            +L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S NRRVSITF ++R     +
Sbjct  130  SLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPSSNRRVSITFVRVRPSTPVD  189

Query  543  SAEVVPPLTRAMTLW  587
             + +  P T+AMTLW
Sbjct  190  LSPLPSP-TKAMTLW  203



>ref|XP_010507817.1| PREDICTED: uncharacterized protein LOC104784489 isoform X2 [Camelina 
sativa]
Length=335

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 110/141 (78%), Gaps = 5/141 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+N +LSGETF+L+N+  KG KREL+QLG PIFGN  ++      S EPIP ++
Sbjct  200  NHLREAGRNHQLSGETFVLFNKNSKGTKRELLQLGVPIFGNTTDE-----HSVEPIPPLV  254

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  255  QSVIDHLLQWRLIPEYKRPNGCVINFFDEDEHSQPFQKPPHVDQPISTLVLSESTMVFGH  314

Query  363  TLACDSDGNYRGSLILSLKEG  425
             L  D+DGN+RGSL L LKEG
Sbjct  315  RLGVDNDGNFRGSLTLPLKEG  335



>ref|XP_010507816.1| PREDICTED: uncharacterized protein LOC104784489 isoform X1 [Camelina 
sativa]
Length=339

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+N +LSGETF+L+N+  KG KREL+QLG PIFGN  ++ +   +  EPIP ++
Sbjct  200  NHLREAGRNHQLSGETFVLFNKNSKGTKRELLQLGVPIFGNTTDEHSVVLAV-EPIPPLV  258

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VIDHL+QW LI E +RPNGC+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG 
Sbjct  259  QSVIDHLLQWRLIPEYKRPNGCVINFFDEDEHSQPFQKPPHVDQPISTLVLSESTMVFGH  318

Query  363  TLACDSDGNYRGSLILSLKEG  425
             L  D+DGN+RGSL L LKEG
Sbjct  319  RLGVDNDGNFRGSLTLPLKEG  339



>ref|XP_010497172.1| PREDICTED: uncharacterized protein LOC104774212, partial [Camelina 
sativa]
Length=190

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 5/126 (4%)
 Frame = +3

Query  246  CIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTLACDSDGNYRGSLILSLKEG  425
            C+INFFDE E+SQPF KPPH++QP+STL+LSESTM FG  L  D+DGN+RGSL L LKEG
Sbjct  1    CVINFFDEDEHSQPFQKPPHVDQPISTLVLSESTMVFGHRLGVDNDGNFRGSLTLPLKEG  60

Query  426  SLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENNSAEVVP-PLTRAMTLWQPGIP  602
            SLLVMRGNSADMARH MC SPN+RV+ITFFK++     +S +V P P+T  ++LW+PG P
Sbjct  61   SLLVMRGNSADMARHVMCPSPNKRVTITFFKLKP----DSGKVQPRPITNPVSLWRPGTP  116

Query  603  SSPYNG  620
            + P  G
Sbjct  117  APPACG  122



>gb|EYU20290.1| hypothetical protein MIMGU_mgv1a0197391mg, partial [Erythranthe 
guttata]
Length=192

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 106/166 (64%), Gaps = 9/166 (5%)
 Frame = +3

Query  36   LSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILEVVIDHLIQWH  215
             SGETF  YNQ  +  KRE IQ G P+F  +K D    K   EPIP IL+ +ID  IQW 
Sbjct  31   FSGETFGSYNQHTR-FKREFIQFGVPMFELIKVDET--KRYIEPIPAILQDLIDKTIQWK  87

Query  216  LISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTL----ACDSD  383
             I E+ RPNGC INFFDEGEYS PF KPPHLEQ +S LLLS+S +AFG  L      D  
Sbjct  88   YIPEDMRPNGCRINFFDEGEYSHPFEKPPHLEQSISILLLSKSKLAFGHKLIGDIVADGK  147

Query  384  GNYRGSLILS-LKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            GNYRG    +   EG  LVM G  ++ + HAMC+ P +R++ITFFK
Sbjct  148  GNYRGGFTFNPFPEGHFLVMNGEISE-STHAMCTLPIKRITITFFK  192



>ref|XP_010241461.1| PREDICTED: uncharacterized protein LOC104586031 [Nelumbo nucifera]
 ref|XP_010241536.1| PREDICTED: uncharacterized protein LOC104586031 [Nelumbo nucifera]
 ref|XP_010241609.1| PREDICTED: uncharacterized protein LOC104586031 [Nelumbo nucifera]
Length=696

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 112/176 (64%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC----QKSSNEPI  170
            NELR  G+ G+  G+TF +  + +KG+ RE+IQLG PI     E+ +     +    EPI
Sbjct  304  NELRAAGRKGQFQGQTFAVSKRPMKGHGREMIQLGIPIADAPPEEGSATGTFKDCKMEPI  363

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VIDHL+  HL     +P+ CII+FF+EG++SQP + PP   +PV  L L+E  M
Sbjct  364  PGLLQDVIDHLV--HLQVMTMKPDSCIIDFFNEGDHSQPHMFPPWFGRPVCILFLTECIM  421

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D  G+YRGSL LSL  G+LL M+G SAD ARHA+ S   +R+ +TF K
Sbjct  422  TFGRVIVVDHPGDYRGSLKLSLAAGTLLTMQGKSADFARHAIPSVRKQRIVVTFTK  477



>ref|XP_010271173.1| PREDICTED: uncharacterized protein LOC104607267 [Nelumbo nucifera]
Length=698

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 113/176 (64%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            NELR  G+ G+  G+TF++  + +KG+ RE+IQLG PI     ED +   SS     EPI
Sbjct  305  NELRTAGRKGQFQGQTFVVLKRPMKGHGREMIQLGLPIADAPPEDESTAGSSKDKKMEPI  364

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VID+L+  HL     + + CII+FF+EG++SQP   PP   +PVS L L+E  M
Sbjct  365  PGLLQDVIDNLV--HLQVMTTKADSCIIDFFNEGDHSQPHTFPPWFGRPVSVLFLTECNM  422

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D  G+YRGSL LSL  GS+L M+G SAD A+HA+ S   +R+ +TF K
Sbjct  423  TFGRVIGVDHPGDYRGSLNLSLAAGSVLTMQGKSADFAKHAIPSIRKQRILVTFTK  478



>ref|XP_006849434.1| hypothetical protein AMTR_s00024p00040890 [Amborella trichopoda]
 gb|ERN11015.1| hypothetical protein AMTR_s00024p00040890 [Amborella trichopoda]
Length=655

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 117/176 (66%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIF-GNVKEDLACQKSSN---EPI  170
            NELR  G+ G++ G TF++  + ++G+ RE+IQLG PI+ G V+E+     S +   E I
Sbjct  303  NELRAAGRRGDIQGPTFVVSKRPMRGHGREMIQLGIPIYDGPVEEENTAGTSKDRNVEAI  362

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P  L+ V+D L+ W ++  N +P+ C+INFF+EG++SQPF+ P    +P  +L L+E  M
Sbjct  363  PNELQDVVDRLVCWQVL--NVQPDCCLINFFNEGDHSQPFMPPAWFRRPFCSLFLTECNM  420

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            AFGR +  D  G YRGSL LSL  GSLLV++  SAD+++HA+ S+   R+ ITF K
Sbjct  421  AFGRVIGVDHPGEYRGSLKLSLTPGSLLVLQSKSADLSKHAISSTRKPRILITFVK  476



>ref|XP_006448090.1| hypothetical protein CICLE_v10014588mg [Citrus clementina]
 gb|ESR61330.1| hypothetical protein CICLE_v10014588mg [Citrus clementina]
Length=486

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 128/215 (60%), Gaps = 14/215 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G++ G  +++  + I+G+ RE+IQLG PI     ED     +S     EPI
Sbjct  99   NDLRTAGKRGQIQGPAYVVSKRPIRGHGREVIQLGLPIVDGPPEDEIAAGTSRDRRIEPI  158

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+   +++   +P+ CI++ F+EG++SQP + P    +PV  L L+E  M
Sbjct  159  PSLLQDVIDRLVGLQIMT--VKPDSCIVDVFNEGDHSQPHISPSWFGRPVCILFLTECDM  216

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTC  530
             FGR +  D  G+YRG+L LS+  GSLLVM+G SAD+A+HA+ S   +R+ +TF K    
Sbjct  217  TFGRMIGIDHPGDYRGTLRLSVAPGSLLVMQGKSADIAKHAISSIRKQRILVTFTK----  272

Query  531  VENNSAEVVPPLTRAMTLWQPGIPSSPYNGTPDYR  635
              +   ++ P  T    L  PGI  SP+ G P  R
Sbjct  273  --SQPKKLTP--TDGQRLASPGIAPSPHWGPPPGR  303



>gb|KDO60857.1| hypothetical protein CISIN_1g006789mg [Citrus sinensis]
Length=486

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 128/215 (60%), Gaps = 14/215 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G++ G  +++  + I+G+ RE+IQLG PI     ED     +S     EPI
Sbjct  99   NDLRTAGKRGQIQGPAYVVSKRPIRGHGREVIQLGLPIVDGPPEDEIAGGTSRDRRIEPI  158

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+   +++   +P+ CI++ F+EG++SQP + P    +PV  L L+E  M
Sbjct  159  PSLLQDVIDRLVGLQIMT--VKPDSCIVDVFNEGDHSQPHISPSWFGRPVCILFLTECDM  216

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTC  530
             FGR +  D  G+YRG+L LS+  GSLLVM+G SAD+A+HA+ S   +R+ +TF K    
Sbjct  217  TFGRMIGIDHPGDYRGTLRLSVAPGSLLVMQGKSADIAKHAISSIRKQRILVTFTK----  272

Query  531  VENNSAEVVPPLTRAMTLWQPGIPSSPYNGTPDYR  635
              +   ++ P  T    L  PGI  SP+ G P  R
Sbjct  273  --SQPKKLTP--TDGQRLASPGIAPSPHWGPPPGR  303



>ref|XP_010648423.1| PREDICTED: uncharacterized protein LOC100252594 isoform X2 [Vitis 
vinifera]
Length=704

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 130/209 (62%), Gaps = 9/209 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G+L G+TF++  + +KG+ RE+IQLG PI     ED +   +S     E I
Sbjct  317  NDLRAAGKRGQLQGQTFVVSKRPMKGHGREMIQLGVPIADAPLEDESVVGTSKDRRTESI  376

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VI HL+   +++   +P+ CII+F++EG++SQP + P    +PV  L L+E  M
Sbjct  377  PSLLQDVIGHLVGSQVLT--VKPDACIIDFYNEGDHSQPHIWPTWFGRPVCILFLTECDM  434

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--R  524
             FGR +  D  G+YRGSL LSL  GSLLVM+G SAD A+HA+ S   +R+ +TF K   +
Sbjct  435  TFGRVIGADHPGDYRGSLKLSLVPGSLLVMQGKSADFAKHAIPSLRKQRILVTFTKSQPK  494

Query  525  TCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
              + ++   ++PP  ++ + W P    SP
Sbjct  495  KTMASDGQRLLPPAAQS-SHWVPPPSRSP  522



>ref|XP_006448091.1| hypothetical protein CICLE_v10014588mg [Citrus clementina]
 gb|ESR61331.1| hypothetical protein CICLE_v10014588mg [Citrus clementina]
Length=635

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 128/215 (60%), Gaps = 14/215 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G++ G  +++  + I+G+ RE+IQLG PI     ED     +S     EPI
Sbjct  248  NDLRTAGKRGQIQGPAYVVSKRPIRGHGREVIQLGLPIVDGPPEDEIAAGTSRDRRIEPI  307

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+   +++   +P+ CI++ F+EG++SQP + P    +PV  L L+E  M
Sbjct  308  PSLLQDVIDRLVGLQIMT--VKPDSCIVDVFNEGDHSQPHISPSWFGRPVCILFLTECDM  365

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTC  530
             FGR +  D  G+YRG+L LS+  GSLLVM+G SAD+A+HA+ S   +R+ +TF K    
Sbjct  366  TFGRMIGIDHPGDYRGTLRLSVAPGSLLVMQGKSADIAKHAISSIRKQRILVTFTK----  421

Query  531  VENNSAEVVPPLTRAMTLWQPGIPSSPYNGTPDYR  635
              +   ++ P  T    L  PGI  SP+ G P  R
Sbjct  422  --SQPKKLTP--TDGQRLASPGIAPSPHWGPPPGR  452



>ref|XP_006469304.1| PREDICTED: uncharacterized protein LOC102618872 [Citrus sinensis]
Length=627

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 128/215 (60%), Gaps = 14/215 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G++ G  +++  + I+G+ RE+IQLG PI     ED     +S     EPI
Sbjct  241  NDLRTAGKRGQIQGPAYVVSKRPIRGHGREVIQLGLPIVDGPPEDEIAAGTSRDRRIEPI  300

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+   +++   +P+ CI++ F+EG++SQP + P    +PV  L L+E  M
Sbjct  301  PSLLQDVIDRLVGLQIMT--VKPDSCIVDVFNEGDHSQPHISPSWFGRPVCILFLTECDM  358

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTC  530
             FGR +  D  G+YRG+L LS+  GSLLVM+G SAD+A+HA+ S   +R+ +TF K    
Sbjct  359  TFGRMIGIDHPGDYRGTLRLSVAPGSLLVMQGKSADIAKHAISSIRKQRILVTFTK----  414

Query  531  VENNSAEVVPPLTRAMTLWQPGIPSSPYNGTPDYR  635
              +   ++ P  T    L  PGI  SP+ G P  R
Sbjct  415  --SQPKKLTP--TDGQRLASPGIAPSPHWGLPPGR  445



>gb|KDO60856.1| hypothetical protein CISIN_1g006789mg [Citrus sinensis]
Length=630

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 128/215 (60%), Gaps = 14/215 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G++ G  +++  + I+G+ RE+IQLG PI     ED     +S     EPI
Sbjct  243  NDLRTAGKRGQIQGPAYVVSKRPIRGHGREVIQLGLPIVDGPPEDEIAGGTSRDRRIEPI  302

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+   +++   +P+ CI++ F+EG++SQP + P    +PV  L L+E  M
Sbjct  303  PSLLQDVIDRLVGLQIMT--VKPDSCIVDVFNEGDHSQPHISPSWFGRPVCILFLTECDM  360

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTC  530
             FGR +  D  G+YRG+L LS+  GSLLVM+G SAD+A+HA+ S   +R+ +TF K    
Sbjct  361  TFGRMIGIDHPGDYRGTLRLSVAPGSLLVMQGKSADIAKHAISSIRKQRILVTFTK----  416

Query  531  VENNSAEVVPPLTRAMTLWQPGIPSSPYNGTPDYR  635
              +   ++ P  T    L  PGI  SP+ G P  R
Sbjct  417  --SQPKKLTP--TDGQRLASPGIAPSPHWGPPPGR  447



>gb|KDO60855.1| hypothetical protein CISIN_1g006789mg [Citrus sinensis]
Length=631

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 128/215 (60%), Gaps = 14/215 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G++ G  +++  + I+G+ RE+IQLG PI     ED     +S     EPI
Sbjct  244  NDLRTAGKRGQIQGPAYVVSKRPIRGHGREVIQLGLPIVDGPPEDEIAGGTSRDRRIEPI  303

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+   +++   +P+ CI++ F+EG++SQP + P    +PV  L L+E  M
Sbjct  304  PSLLQDVIDRLVGLQIMT--VKPDSCIVDVFNEGDHSQPHISPSWFGRPVCILFLTECDM  361

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTC  530
             FGR +  D  G+YRG+L LS+  GSLLVM+G SAD+A+HA+ S   +R+ +TF K    
Sbjct  362  TFGRMIGIDHPGDYRGTLRLSVAPGSLLVMQGKSADIAKHAISSIRKQRILVTFTK----  417

Query  531  VENNSAEVVPPLTRAMTLWQPGIPSSPYNGTPDYR  635
              +   ++ P  T    L  PGI  SP+ G P  R
Sbjct  418  --SQPKKLTP--TDGQRLASPGIAPSPHWGPPPGR  448



>ref|XP_004297399.1| PREDICTED: uncharacterized protein LOC101309147 [Fragaria vesca 
subsp. vesca]
Length=682

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 128/215 (60%), Gaps = 14/215 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G+L G+T++L  + +KG+ RE+IQLG PI    +ED      S     E I
Sbjct  298  NDLRTTGRRGQLQGQTYVLSKRPMKGHGREMIQLGIPIADGPQEDEISAGISKDRRMEAI  357

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID LI   ++++  +P+ CII+FF+EG++S P + PP   +PVS L L+E  +
Sbjct  358  PSLLQDVIDRLIGTQVLTD--KPDSCIIDFFNEGDHSHPHMWPPWFGRPVSVLFLTECDL  415

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTC  530
             FG+ L  D  G+YRG+L LSL  GSLL+++G SAD A+HA+ S   +R+ +TF K    
Sbjct  416  TFGKVLGMDHPGDYRGALRLSLTPGSLLLLQGKSADYAKHAIPSIRKQRILVTFTK----  471

Query  531  VENNSAEVVPPLTRAMTLWQPGIPSSPYNGTPDYR  635
              +   +  P  T    L  PG   SPY   P  R
Sbjct  472  --SQPRKSFP--TDGQRLPSPGPSQSPYWSPPPGR  502



>ref|XP_011070538.1| PREDICTED: uncharacterized protein LOC105156173 isoform X1 [Sesamum 
indicum]
Length=652

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 128/215 (60%), Gaps = 10/215 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSS-----NEP  167
            N+LR  G+ G+L G +F++  + +KG+ RE+IQLG PI     ED A   +S      EP
Sbjct  277  NDLRAAGRRGQLQGHSFVISKRPMKGHGREMIQLGVPIADAPPEDEAASGASRKDLKTEP  336

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP  L+ VI+ L+   ++S   +P+ CII+ F+EG++SQP + P    +PV  L L+E  
Sbjct  337  IPASLQDVIEQLLAEQVVST--KPDSCIIDIFNEGDHSQPHIWPQWFGRPVCVLFLTECE  394

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRT  527
            M+FGR +A D  G+YRG+L LSL  GS+LVM+G SAD  RHA+ S   +R+ +T  K + 
Sbjct  395  MSFGRVIAVDHPGDYRGALRLSLTPGSMLVMQGRSADFTRHAIPSLRKQRILVTLVKSQP  454

Query  528  CVENNSAEV--VPPLTRAMTLWQPGIPSSPYNGTP  626
              + N+A+V   P  +   + W P    SP +  P
Sbjct  455  -KKINAADVHRFPSASAPSSNWAPPPSRSPSHIRP  488



>ref|XP_011070539.1| PREDICTED: uncharacterized protein LOC105156173 isoform X2 [Sesamum 
indicum]
Length=650

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 128/215 (60%), Gaps = 10/215 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSS-----NEP  167
            N+LR  G+ G+L G +F++  + +KG+ RE+IQLG PI     ED A   +S      EP
Sbjct  275  NDLRAAGRRGQLQGHSFVISKRPMKGHGREMIQLGVPIADAPPEDEAASGASRKDLKTEP  334

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP  L+ VI+ L+   ++S   +P+ CII+ F+EG++SQP + P    +PV  L L+E  
Sbjct  335  IPASLQDVIEQLLAEQVVST--KPDSCIIDIFNEGDHSQPHIWPQWFGRPVCVLFLTECE  392

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRT  527
            M+FGR +A D  G+YRG+L LSL  GS+LVM+G SAD  RHA+ S   +R+ +T  K + 
Sbjct  393  MSFGRVIAVDHPGDYRGALRLSLTPGSMLVMQGRSADFTRHAIPSLRKQRILVTLVKSQP  452

Query  528  CVENNSAEV--VPPLTRAMTLWQPGIPSSPYNGTP  626
              + N+A+V   P  +   + W P    SP +  P
Sbjct  453  -KKINAADVHRFPSASAPSSNWAPPPSRSPSHIRP  486



>emb|CBI26785.3| unnamed protein product [Vitis vinifera]
Length=672

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 131/210 (62%), Gaps = 10/210 (5%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            N+LR  G+ G+L +G+TF++  + +KG+ RE+IQLG PI     ED +   +S     E 
Sbjct  317  NDLRAAGKRGQLQAGQTFVVSKRPMKGHGREMIQLGVPIADAPLEDESVVGTSKDRRTES  376

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++L+ VI HL+   +++   +P+ CII+F++EG++SQP + P    +PV  L L+E  
Sbjct  377  IPSLLQDVIGHLVGSQVLT--VKPDACIIDFYNEGDHSQPHIWPTWFGRPVCILFLTECD  434

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            M FGR +  D  G+YRGSL LSL  GSLLVM+G SAD A+HA+ S   +R+ +TF K   
Sbjct  435  MTFGRVIGADHPGDYRGSLKLSLVPGSLLVMQGKSADFAKHAIPSLRKQRILVTFTKSQP  494

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
            +  + ++   ++PP  ++ + W P    SP
Sbjct  495  KKTMASDGQRLLPPAAQS-SHWVPPPSRSP  523



>ref|XP_010648465.1| PREDICTED: uncharacterized protein LOC100252594 isoform X3 [Vitis 
vinifera]
Length=699

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 131/210 (62%), Gaps = 10/210 (5%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            N+LR  G+ G+L +G+TF++  + +KG+ RE+IQLG PI     ED +   +S     E 
Sbjct  311  NDLRAAGKRGQLQAGQTFVVSKRPMKGHGREMIQLGVPIADAPLEDESVVGTSKDRRTES  370

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++L+ VI HL+   +++   +P+ CII+F++EG++SQP + P    +PV  L L+E  
Sbjct  371  IPSLLQDVIGHLVGSQVLT--VKPDACIIDFYNEGDHSQPHIWPTWFGRPVCILFLTECD  428

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            M FGR +  D  G+YRGSL LSL  GSLLVM+G SAD A+HA+ S   +R+ +TF K   
Sbjct  429  MTFGRVIGADHPGDYRGSLKLSLVPGSLLVMQGKSADFAKHAIPSLRKQRILVTFTKSQP  488

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
            +  + ++   ++PP  ++ + W P    SP
Sbjct  489  KKTMASDGQRLLPPAAQS-SHWVPPPSRSP  517



>ref|XP_010648352.1| PREDICTED: uncharacterized protein LOC100252594 isoform X1 [Vitis 
vinifera]
 ref|XP_010648386.1| PREDICTED: uncharacterized protein LOC100252594 isoform X1 [Vitis 
vinifera]
Length=705

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 131/210 (62%), Gaps = 10/210 (5%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            N+LR  G+ G+L +G+TF++  + +KG+ RE+IQLG PI     ED +   +S     E 
Sbjct  317  NDLRAAGKRGQLQAGQTFVVSKRPMKGHGREMIQLGVPIADAPLEDESVVGTSKDRRTES  376

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++L+ VI HL+   +++   +P+ CII+F++EG++SQP + P    +PV  L L+E  
Sbjct  377  IPSLLQDVIGHLVGSQVLT--VKPDACIIDFYNEGDHSQPHIWPTWFGRPVCILFLTECD  434

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            M FGR +  D  G+YRGSL LSL  GSLLVM+G SAD A+HA+ S   +R+ +TF K   
Sbjct  435  MTFGRVIGADHPGDYRGSLKLSLVPGSLLVMQGKSADFAKHAIPSLRKQRILVTFTKSQP  494

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
            +  + ++   ++PP  ++ + W P    SP
Sbjct  495  KKTMASDGQRLLPPAAQS-SHWVPPPSRSP  523



>ref|XP_008220943.1| PREDICTED: uncharacterized protein LOC103320980 [Prunus mume]
Length=691

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 122/209 (58%), Gaps = 8/209 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+  +L G+T+++  + +KG+ RE+IQLG PI     ED     +S     EPI
Sbjct  306  NDLRAAGKRRQLQGQTYVVSKRPMKGHGREMIQLGIPIADAPPEDEISAGTSKDRKIEPI  365

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+  H+++   +P+ CII+ ++EG++SQP   P    +PV  L L+E  M
Sbjct  366  PSLLQDVIDRLVGMHVVT--VKPDSCIIDVYNEGDHSQPHTWPSWFGRPVCALYLTECDM  423

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--R  524
             FGR L  D  G+YRGSL LSL  GS+L+M+G SAD A+HA+ S   +R+ +TF K   +
Sbjct  424  TFGRVLLMDHPGDYRGSLRLSLTPGSILLMQGKSADFAKHAIPSIRKQRILVTFTKSQPK  483

Query  525  TCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
                ++      P     + W P    SP
Sbjct  484  KSTTSDGQRFPAPAPAQSSYWGPPPSRSP  512



>ref|XP_009351588.1| PREDICTED: uncharacterized protein LOC103943111 [Pyrus x bretschneideri]
 ref|XP_009351589.1| PREDICTED: uncharacterized protein LOC103943111 [Pyrus x bretschneideri]
Length=690

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 113/176 (64%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LRV G+ G+L G+T+++  + ++G+ RE+IQLG P+     ED     +S     E I
Sbjct  306  NDLRVAGKRGQLQGQTYVVSKRPMRGHGREMIQLGLPVTDAPSEDEISAGTSKDRRIEAI  365

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+   + +   +P+ CII+F++EG++S P   PP   +PV  LLL+E  M
Sbjct  366  PSLLQDVIDRLVGMQVTTV--KPDSCIIDFYNEGDHSHPHTWPPWFGRPVCILLLTECDM  423

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR L  D  G+YRGSL LSL  GSLL+++G S D A+HA+ S   +R+ +TF K
Sbjct  424  TFGRVLVSDHPGDYRGSLKLSLTPGSLLLLQGKSTDFAKHAIPSIRKQRILVTFTK  479



>ref|XP_008365818.1| PREDICTED: uncharacterized protein LOC103429447, partial [Malus 
domestica]
Length=640

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 113/176 (64%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LRV G+ G+  G+T+++  + ++G+ RE+IQLG P+     ED     +S     E I
Sbjct  306  NDLRVAGKRGQFQGQTYVVSKRPMRGHGREMIQLGLPVTDAPSEDEISAGTSKDRRIEAI  365

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+   + +   +P+ CII+F++EG++S P + PP   +PV  LLL+E  M
Sbjct  366  PSLLQDVIDRLVGMQVTTV--KPDSCIIDFYNEGDHSHPHIWPPWFGRPVCVLLLTECDM  423

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR L  D  G+YRG+L LSL  GSLL+++G S D A+HA+ S   +R+ +TF K
Sbjct  424  TFGRVLVSDHPGDYRGALKLSLTPGSLLLLQGKSTDFAKHAIPSIRKQRILVTFTK  479



>emb|CAN65462.1| hypothetical protein VITISV_002198 [Vitis vinifera]
Length=1145

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 128/213 (60%), Gaps = 13/213 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN-------  161
            N+LR  G+ G+L G+TF++  + +KG+ RE+IQLG PI     ED +   +S        
Sbjct  320  NDLRAAGKRGQLQGQTFVVSKRPMKGHGREMIQLGVPIADAPLEDESVVGTSKGMFHNRR  379

Query  162  -EPIPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLS  338
             E IP++L+ VI  L+   +++   +P+ CII+F++EG++SQP + P    +PV  L L+
Sbjct  380  TESIPSLLQDVIGQLVGSQVLT--VKPDACIIDFYNEGDHSQPHIWPTWFGRPVCILFLT  437

Query  339  ESTMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            E  M FGR +  D  G+YRGSL LSL  GSLLVM+G SAD A+HA+ S   +R+ +TF K
Sbjct  438  ECDMTFGRVIGADHPGDYRGSLKLSLVPGSLLVMQGKSADFAKHAIPSLRKQRILVTFTK  497

Query  519  I--RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
               +    ++   ++PP  ++ + W P    SP
Sbjct  498  SQPKKTTASDGQRLLPPAAQS-SHWVPPPSRSP  529



>ref|XP_008381778.1| PREDICTED: uncharacterized protein LOC103444603 [Malus domestica]
Length=690

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 113/176 (64%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LRV G+ G+  G+T+++  + ++G+ RE+IQLG P+     ED     +S     E I
Sbjct  306  NDLRVAGKRGQFQGQTYVVSKRPMRGHGREMIQLGLPVTDAPSEDEISAGTSKDRRIEAI  365

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+   + +   +P+ CII+F++EG++S P + PP   +PV  LLL+E  M
Sbjct  366  PSLLQDVIDRLVGMQVTT--VKPDSCIIDFYNEGDHSHPHIWPPWFGRPVCVLLLTECDM  423

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR L  D  G+YRG+L LSL  GSLL+++G S D A+HA+ S   +R+ +TF K
Sbjct  424  TFGRVLVSDHPGDYRGALKLSLTPGSLLLLQGKSTDFAKHAIPSIRKQRILVTFTK  479



>ref|XP_010906320.1| PREDICTED: uncharacterized protein LOC105033283 isoform X2 [Elaeis 
guineensis]
Length=648

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G  GE  G+TF++  + +KG+ RE+IQLG PI     ED      S     E +
Sbjct  255  NDLRAAGNQGEFQGQTFVVSKRPVKGHGREMIQLGLPIAEGPPEDENTAGVSRDRKVEAV  314

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ ++D + Q  +++   +P+ CII+FF+EG++SQP ++PP   +PV TL L+E  +
Sbjct  315  PSLLQDILDRVEQLQVLT--VKPDYCIIDFFNEGDHSQPHMRPPWYGRPVCTLFLTECDI  372

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D  G+Y+GSL LSL  GSLLVM+G SAD+A+HA+ S   +RV ++F K
Sbjct  373  VFGRVVGGDR-GDYKGSLKLSLAAGSLLVMQGKSADLAKHAIPSLRKQRVLLSFGK  427



>ref|XP_010906319.1| PREDICTED: uncharacterized protein LOC105033283 isoform X1 [Elaeis 
guineensis]
Length=690

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G  GE  G+TF++  + +KG+ RE+IQLG PI     ED      S     E +
Sbjct  297  NDLRAAGNQGEFQGQTFVVSKRPVKGHGREMIQLGLPIAEGPPEDENTAGVSRDRKVEAV  356

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ ++D + Q  +++   +P+ CII+FF+EG++SQP ++PP   +PV TL L+E  +
Sbjct  357  PSLLQDILDRVEQLQVLT--VKPDYCIIDFFNEGDHSQPHMRPPWYGRPVCTLFLTECDI  414

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D  G+Y+GSL LSL  GSLLVM+G SAD+A+HA+ S   +RV ++F K
Sbjct  415  VFGRVVGGDR-GDYKGSLKLSLAAGSLLVMQGKSADLAKHAIPSLRKQRVLLSFGK  469



>ref|XP_009390868.1| PREDICTED: uncharacterized protein LOC103977152 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=654

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PI  170
            NE+R  G  GEL G+T +L  + +KG+ RE+IQ G PI     ED     +S E     I
Sbjct  269  NEMRAAGHRGELPGQTLVLLKRPMKGHGREMIQYGIPITDGPAEDTNTSPTSGERKVGAI  328

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P+ L+ V+D ++Q  ++    +P+ CII+FF EG++SQP   PP   +PV  LLL+E  +
Sbjct  329  PSFLQDVLDRVVQLQVLP--IKPDFCIIDFFSEGDHSQPHTWPPWYGRPVCNLLLTECDI  386

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             +GRT+  D  G+Y GSL LS+  G LLVM+G SAD+A+ A+ S   +R+ +TF K R
Sbjct  387  VYGRTVGSDHRGDYNGSLKLSVNAGCLLVMQGKSADLAKRAIPSLRKQRILVTFGKSR  444



>ref|XP_009390867.1| PREDICTED: uncharacterized protein LOC103977152 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=664

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PI  170
            NE+R  G  GEL G+T +L  + +KG+ RE+IQ G PI     ED     +S E     I
Sbjct  279  NEMRAAGHRGELPGQTLVLLKRPMKGHGREMIQYGIPITDGPAEDTNTSPTSGERKVGAI  338

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P+ L+ V+D ++Q  ++    +P+ CII+FF EG++SQP   PP   +PV  LLL+E  +
Sbjct  339  PSFLQDVLDRVVQLQVLP--IKPDFCIIDFFSEGDHSQPHTWPPWYGRPVCNLLLTECDI  396

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             +GRT+  D  G+Y GSL LS+  G LLVM+G SAD+A+ A+ S   +R+ +TF K R
Sbjct  397  VYGRTVGSDHRGDYNGSLKLSVNAGCLLVMQGKSADLAKRAIPSLRKQRILVTFGKSR  454



>ref|XP_009390865.1| PREDICTED: uncharacterized protein LOC103977152 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390869.1| PREDICTED: uncharacterized protein LOC103977152 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=685

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PI  170
            NE+R  G  GEL G+T +L  + +KG+ RE+IQ G PI     ED     +S E     I
Sbjct  300  NEMRAAGHRGELPGQTLVLLKRPMKGHGREMIQYGIPITDGPAEDTNTSPTSGERKVGAI  359

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P+ L+ V+D ++Q  ++    +P+ CII+FF EG++SQP   PP   +PV  LLL+E  +
Sbjct  360  PSFLQDVLDRVVQLQVLP--IKPDFCIIDFFSEGDHSQPHTWPPWYGRPVCNLLLTECDI  417

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             +GRT+  D  G+Y GSL LS+  G LLVM+G SAD+A+ A+ S   +R+ +TF K R
Sbjct  418  VYGRTVGSDHRGDYNGSLKLSVNAGCLLVMQGKSADLAKRAIPSLRKQRILVTFGKSR  475



>ref|XP_002527549.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34858.1| conserved hypothetical protein [Ricinus communis]
Length=697

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 122/209 (58%), Gaps = 8/209 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G+  G+ +++  + +KG+ RE+IQLG PI     E+     +S     E I
Sbjct  317  NDLRAAGRKGQFQGQAYVVSKRPMKGHGREMIQLGLPIADAPAEEENAAGTSKDRKIESI  376

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            PT+L+ VI+  +   +++   +P+ CII+ ++EG++SQP + PP   +P+S L L+E  +
Sbjct  377  PTLLQEVIERFVSMQIMT--MKPDSCIIDIYNEGDHSQPHMWPPWFGKPISVLFLTECDL  434

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--R  524
             FGR +  D  G+YRGSL L L  GSLLVM+G + D A+HA+ +   +RV +TF K   +
Sbjct  435  TFGRVITADHPGDYRGSLKLPLAPGSLLVMQGKATDFAKHAIPAIRKQRVLLTFTKSQPK  494

Query  525  TCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
              V+++   +  P     + W P    SP
Sbjct  495  KFVQSDGQRLTSPAASPSSHWGPPPSRSP  523



>ref|XP_009148855.1| PREDICTED: uncharacterized protein LOC103872267 [Brassica rapa]
Length=602

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 115/191 (60%), Gaps = 2/191 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+ G+L  E ++ Y +  +G+ RE+IQLG PI   + +D + +    EPIP+ L
Sbjct  284  NNLRTAGRRGQLQTEAYVGYKRPNRGHGREMIQLGLPIADTMPDDESIKGRRIEPIPSFL  343

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +I    +P+ CII+FF+EG++SQP +  P   +PV  L LSE    FGR
Sbjct  344  SDIIERLVTKQIIP--VKPDACIIDFFNEGDHSQPHMLAPWFGRPVGILSLSECDFTFGR  401

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             +  D  G+Y+GSL LSL  GS+L++ G SAD+A+ A+ S P +R+ ITF K +      
Sbjct  402  VIVSDHPGDYKGSLKLSLTPGSVLLVEGKSADLAKFAIHSIPKQRILITFTKSQPRNSIT  461

Query  543  SAEVVPPLTRA  575
             +   PP +R+
Sbjct  462  GSNWAPPPSRS  472



>ref|XP_009390866.1| PREDICTED: uncharacterized protein LOC103977152 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=682

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PI  170
            NE+R  G  GEL G+T +L  + +KG+ RE+IQ G PI     ED     +S E     I
Sbjct  297  NEMRAAGHRGELPGQTLVLLKRPMKGHGREMIQYGIPITDGPAEDTNTSPTSGERKVGAI  356

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P+ L+ V+D ++Q  ++    +P+ CII+FF EG++SQP   PP   +PV  LLL+E  +
Sbjct  357  PSFLQDVLDRVVQLQVLP--IKPDFCIIDFFSEGDHSQPHTWPPWYGRPVCNLLLTECDI  414

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             +GRT+  D  G+Y GSL LS+  G LLVM+G SAD+A+ A+ S   +R+ +TF K R
Sbjct  415  VYGRTVGSDHRGDYNGSLKLSVNAGCLLVMQGKSADLAKRAIPSLRKQRILVTFGKSR  472



>ref|XP_010553484.1| PREDICTED: uncharacterized protein LOC104823550 isoform X2 [Tarenaya 
hassleriana]
Length=633

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 129/214 (60%), Gaps = 11/214 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIP  173
            N++RV G+ G+L G++++   + ++G  RELIQLG PI   V   + C+  ++   EPIP
Sbjct  307  NDMRVSGKRGQLQGQSYVANKRPMRGRGRELIQLGLPI---VDSPVDCEAPTDRKVEPIP  363

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
            T+L  VI+ L+   +     +P+ CII+F++EG++SQP +  P   +PV  +LLSE  + 
Sbjct  364  TVLHDVIERLVAMQIAP--MKPDACIIDFYNEGDHSQPNMFLPWFGRPVCIMLLSECDVT  421

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCV  533
            FGR +  D  G+Y+GSL LSL  GS+LV++G SAD+A+ A+ S+  +RV +TF K +   
Sbjct  422  FGRVIVSDHPGDYKGSLKLSLTPGSVLVVQGKSADLAKLAIDSTRKQRVLVTFVKSQPRK  481

Query  534  ENNSAEVVPPLTRAMT---LWQPGIPSSPYNGTP  626
                +   PP +R+++      P  P   Y+  P
Sbjct  482  SITGSNWGPPPSRSLSNHHFRHPSGPPKHYHSIP  515



>ref|XP_007225122.1| hypothetical protein PRUPE_ppa002630mg [Prunus persica]
 gb|EMJ26321.1| hypothetical protein PRUPE_ppa002630mg [Prunus persica]
Length=650

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 121/209 (58%), Gaps = 8/209 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+  +L G+T+++  + +KG+ RE+IQLG PI     ED     +S     EPI
Sbjct  265  NDLRAAGKRRQLQGQTYVVSKRPMKGHGREMIQLGIPIADAPPEDEISAGTSKDRKIEPI  324

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID L+  H+++   +P+ CII+ ++EG++SQP   P    +PV  L L+E  M
Sbjct  325  PSLLQDVIDRLVGMHVMT--VKPDSCIIDVYNEGDHSQPHTWPSWFGRPVCALYLTECDM  382

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--R  524
             FGR L  D  G+YRGSL LSL  GS+L+M+G SAD A+HA+ S   +R+ +T  K   +
Sbjct  383  TFGRLLLMDHPGDYRGSLRLSLTPGSILLMQGKSADFAKHAIPSIRKQRILVTLTKSQPK  442

Query  525  TCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
                ++      P     + W P    SP
Sbjct  443  KSTTSDGQRFPAPAPAQSSYWGPPPSRSP  471



>ref|XP_010553471.1| PREDICTED: uncharacterized protein LOC104823550 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010553478.1| PREDICTED: uncharacterized protein LOC104823550 isoform X1 [Tarenaya 
hassleriana]
Length=635

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 129/214 (60%), Gaps = 11/214 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIP  173
            N++RV G+ G+L G++++   + ++G  RELIQLG PI   V   + C+  ++   EPIP
Sbjct  309  NDMRVSGKRGQLQGQSYVANKRPMRGRGRELIQLGLPI---VDSPVDCEAPTDRKVEPIP  365

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
            T+L  VI+ L+   +     +P+ CII+F++EG++SQP +  P   +PV  +LLSE  + 
Sbjct  366  TVLHDVIERLVAMQIAP--MKPDACIIDFYNEGDHSQPNMFLPWFGRPVCIMLLSECDVT  423

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCV  533
            FGR +  D  G+Y+GSL LSL  GS+LV++G SAD+A+ A+ S+  +RV +TF K +   
Sbjct  424  FGRVIVSDHPGDYKGSLKLSLTPGSVLVVQGKSADLAKLAIDSTRKQRVLVTFVKSQPRK  483

Query  534  ENNSAEVVPPLTRAMT---LWQPGIPSSPYNGTP  626
                +   PP +R+++      P  P   Y+  P
Sbjct  484  SITGSNWGPPPSRSLSNHHFRHPSGPPKHYHSIP  517



>ref|XP_010553493.1| PREDICTED: uncharacterized protein LOC104823550 isoform X3 [Tarenaya 
hassleriana]
Length=631

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 129/214 (60%), Gaps = 11/214 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIP  173
            N++RV G+ G+L G++++   + ++G  RELIQLG PI   V   + C+  ++   EPIP
Sbjct  305  NDMRVSGKRGQLQGQSYVANKRPMRGRGRELIQLGLPI---VDSPVDCEAPTDRKVEPIP  361

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
            T+L  VI+ L+   +     +P+ CII+F++EG++SQP +  P   +PV  +LLSE  + 
Sbjct  362  TVLHDVIERLVAMQIAP--MKPDACIIDFYNEGDHSQPNMFLPWFGRPVCIMLLSECDVT  419

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCV  533
            FGR +  D  G+Y+GSL LSL  GS+LV++G SAD+A+ A+ S+  +RV +TF K +   
Sbjct  420  FGRVIVSDHPGDYKGSLKLSLTPGSVLVVQGKSADLAKLAIDSTRKQRVLVTFVKSQPRK  479

Query  534  ENNSAEVVPPLTRAMT---LWQPGIPSSPYNGTP  626
                +   PP +R+++      P  P   Y+  P
Sbjct  480  SITGSNWGPPPSRSLSNHHFRHPSGPPKHYHSIP  513



>gb|KDP38170.1| hypothetical protein JCGZ_04813 [Jatropha curcas]
Length=691

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 122/209 (58%), Gaps = 8/209 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G+ SG+T+++  + +KG+ RE+IQLG PI     ED     +S     E I
Sbjct  313  NDLRASGRRGQFSGQTYVVSKRPMKGHGREMIQLGLPIADAPAEDENAAGTSKDRRVESI  372

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            PT+L+ VI+  +   +++   +P+ CII+ ++EG++SQP + PP   +P+S L L+E  +
Sbjct  373  PTLLQDVIERFVNMQIMA--VKPDSCIIDLYNEGDHSQPNMWPPWFGKPISVLFLTECDL  430

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--R  524
             FGR +  D  G+Y+GSL L L  GSLLVM+G S D A+HA+ +   +R+ +TF K   +
Sbjct  431  TFGRVITADQPGDYKGSLKLPLAPGSLLVMQGKSTDYAKHAIPAIRKQRMIVTFTKSQPK  490

Query  525  TCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
               +++   +V         W P    SP
Sbjct  491  KYAQSDGQRLVSSAAAPSPHWGPAPSRSP  519



>gb|KJB30648.1| hypothetical protein B456_005G153400 [Gossypium raimondii]
Length=653

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 124/209 (59%), Gaps = 9/209 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G+  G+T++   + +KG+ RE+IQLG PI     +D     +S     E I
Sbjct  304  NDLRAAGKRGQFQGQTYVASKKPMKGHGREMIQLGLPIADAPLDDEISAGTSKDRRIEAI  363

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+  ID L+   +++   +P+ CII+ ++EG++S P + PP   +P+  + L+E  +
Sbjct  364  PALLQDAIDRLVDSQVMTA--KPDSCIIDVYNEGDHSMPRMWPPWFGKPICVMFLTECDI  421

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--R  524
             FGR ++ D  G++RGSL LSL  GSLLVM G SAD A+HA+ S   +R+ +TF K   +
Sbjct  422  TFGRMISVDPPGDFRGSLKLSLAPGSLLVMHGKSADFAKHALPSVRKQRILVTFTKYQPK  481

Query  525  TCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
              + +N     PPL+++ + W P    SP
Sbjct  482  KSMSDNPRLPSPPLSQS-SQWVPSPSRSP  509



>gb|KJB30646.1| hypothetical protein B456_005G153400 [Gossypium raimondii]
Length=682

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 125/209 (60%), Gaps = 9/209 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G+  G+T++   + +KG+ RE+IQLG PI     +D     +S     E I
Sbjct  304  NDLRAAGKRGQFQGQTYVASKKPMKGHGREMIQLGLPIADAPLDDEISAGTSKDRRIEAI  363

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+  ID L+   +++   +P+ CII+ ++EG++S P + PP   +P+  + L+E  +
Sbjct  364  PALLQDAIDRLVDSQVMTA--KPDSCIIDVYNEGDHSMPRMWPPWFGKPICVMFLTECDI  421

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITF--FKIR  524
             FGR ++ D  G++RGSL LSL  GSLLVM G SAD A+HA+ S   +R+ +TF  ++ +
Sbjct  422  TFGRMISVDPPGDFRGSLKLSLAPGSLLVMHGKSADFAKHALPSVRKQRILVTFTKYQPK  481

Query  525  TCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
              + +N     PPL+++ + W P    SP
Sbjct  482  KSMSDNPRLPSPPLSQS-SQWVPSPSRSP  509



>ref|XP_002311547.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE88914.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=675

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 112/175 (64%), Gaps = 5/175 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKED---LACQKSSNEPIP  173
            NELR  G+ G+  G+T+IL  + +KG+ RE+IQLG PI     ED       K + E IP
Sbjct  296  NELRATGRRGQCQGQTYILSKRPMKGHGREMIQLGLPIADAPAEDENATGTSKGTVESIP  355

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
             +L+ VI+H +   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  + 
Sbjct  356  ALLQDVIEHFVAMQVMT--MKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECELT  413

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            FG+ +     G+Y+GSL LS+  GSLLVM+G S+D+A+HA+     +R+ +TF K
Sbjct  414  FGKVIDTLHHGDYKGSLKLSVAPGSLLVMQGKSSDLAKHAIPMIKKQRMLVTFTK  468



>ref|XP_008795329.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795330.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795332.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795333.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795334.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795335.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
Length=687

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ GE  G+TF++  + +KG+ RE+IQLG PI     ED      S     E +
Sbjct  298  NDLRAAGRRGEFQGQTFVVSKRPVKGHGREMIQLGLPIAEGPPEDENTAGMSRDRKVEAV  357

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P+ L+ ++D ++Q  +++   +P+ CII+FF+EG++SQP ++PP   +PV TL L+E  +
Sbjct  358  PSSLQDILDRVVQLQVLT--VKPDYCIIDFFNEGDHSQPHMRPPWYGRPVCTLFLTECDI  415

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D  G+YRGSL LSL  GSLLVM+G SAD+A+HA+ S   + V ++F K
Sbjct  416  VFGRVVGGDR-GDYRGSLKLSLAAGSLLVMQGKSADLAKHAIPSLRKQCVLLSFGK  470



>ref|XP_009117880.1| PREDICTED: uncharacterized protein LOC103842949 [Brassica rapa]
 ref|XP_009117881.1| PREDICTED: uncharacterized protein LOC103842949 [Brassica rapa]
Length=495

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 109/175 (62%), Gaps = 5/175 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---EPIP  173
            N LR  G+ G+L  E ++ Y +  +G+ RE+IQLG PI   + +D    K  +   EPIP
Sbjct  220  NNLRNAGRRGQLQSEAYVSYKRPNRGHGREMIQLGLPIADTMPDDDESAKVKDRGIEPIP  279

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
            + +  +I+ L+   +I    +P+ CII+FF+EG++SQP +  P   +PV  L LSE    
Sbjct  280  SFISDIIERLVSKQIIP--VKPDACIIDFFNEGDHSQPHMFVPWFGRPVGVLSLSECDFT  337

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            FGR +  D  G+Y+GSL LSL  GSLL++ GNSAD+A+ A+ S P +R+ ITF K
Sbjct  338  FGRVIVSDYPGDYKGSLKLSLTPGSLLLVEGNSADLAKFAIHSIPKKRILITFTK  392



>ref|XP_008789249.1| PREDICTED: uncharacterized protein LOC103706794 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008789250.1| PREDICTED: uncharacterized protein LOC103706794 isoform X1 [Phoenix 
dactylifera]
Length=688

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 113/176 (64%), Gaps = 8/176 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G  GE  G+TF++  + +KG+ RE+IQLG PI     ED    ++S     E +
Sbjct  301  NDLRAAGHRGEFQGQTFVVSKRPVKGHGREMIQLGLPIIKGPLEDENSAETSRDWKVEAV  360

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ ++D ++   L     +P+ CII+FF+EG++S P + PP   +PV +L L+E  +
Sbjct  361  PSLLQDILDCIV---LKVLTVKPDYCIIDFFNEGDHSHPHMWPPWYGRPVCSLFLTECDI  417

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D  G+YRGSL LSL  GSLLVM+G SAD+A+HA+ S   +RV +TF K
Sbjct  418  VFGRVVGGDR-GDYRGSLKLSLSAGSLLVMQGKSADLAKHAIPSLCKQRVLLTFGK  472



>ref|XP_004142291.1| PREDICTED: uncharacterized protein LOC101210274 [Cucumis sativus]
 ref|XP_004156139.1| PREDICTED: uncharacterized LOC101210274 [Cucumis sativus]
Length=684

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKED---LACQKSSN-EPI  170
            N+LR  G+ G+  G+T+++  + +KG+ RE+IQLG PI     ED   L   K    EPI
Sbjct  308  NDLRASGKRGQFQGQTYVVSKRPMKGHGREMIQLGFPIADAPHEDDNSLGLSKDRRIEPI  367

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ +ID L+   +++   +P+ CII+F++EG++SQP + P    +PV  LLL+E  +
Sbjct  368  PSLLQDLIDRLVGDQVMTV--KPDSCIIDFYNEGDHSQPHVWPSWFGRPVGVLLLTECEI  425

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D  GNYRG++ LSL  G+LLV++G SAD A+HA+ +   +R+ +T  K
Sbjct  426  TFGRVIGTDHSGNYRGAMKLSLTPGNLLVVQGKSADFAKHALPAIRKQRILVTLTK  481



>gb|ABK95394.1| unknown [Populus trichocarpa]
Length=694

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 112/176 (64%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PI  170
            NELR  G+ G+  G+T+IL  + +KG+ RE+IQLG PI     ED     +S E     I
Sbjct  314  NELRATGRRGQCQGQTYILSKRPMKGHGREMIQLGLPIADAPAEDENATGTSKERRVESI  373

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VI+H +   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  +
Sbjct  374  PALLQDVIEHFVAMQVMT--MKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECEL  431

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FG+ +     G+Y+GSL LS+  GSLLVM+G S+D+A+HA+     +R+ +TF K
Sbjct  432  TFGKVIDTLHHGDYKGSLKLSVAPGSLLVMQGKSSDLAKHAIPMIKKQRMLVTFTK  487



>ref|XP_006379789.1| hypothetical protein POPTR_0008s13830g [Populus trichocarpa]
 gb|ERP57586.1| hypothetical protein POPTR_0008s13830g [Populus trichocarpa]
Length=693

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 112/176 (64%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PI  170
            NELR  G+ G+  G+T+IL  + +KG+ RE+IQLG PI     ED     +S E     I
Sbjct  313  NELRATGRRGQCQGQTYILSKRPMKGHGREMIQLGLPIADAPAEDENATGTSKERRVESI  372

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VI+H +   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  +
Sbjct  373  PALLQDVIEHFVAMQVMT--MKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECEL  430

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FG+ +     G+Y+GSL LS+  GSLLVM+G S+D+A+HA+     +R+ +TF K
Sbjct  431  TFGKVIDTLHHGDYKGSLKLSVAPGSLLVMQGKSSDLAKHAIPMIKKQRMLVTFTK  486



>ref|XP_007153188.1| hypothetical protein PHAVU_003G014200g [Phaseolus vulgaris]
 gb|ESW25182.1| hypothetical protein PHAVU_003G014200g [Phaseolus vulgaris]
Length=691

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 129/217 (59%), Gaps = 17/217 (8%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFG---NVKEDLACQKSSN-EP  167
            N++RV G+ G+  G +TF++  + IKG  RE+IQLG PI     +V       K    E 
Sbjct  318  NDMRVAGKRGQFQGSQTFVVSKRPIKGRGREMIQLGVPIADAPPDVDNVTGLSKDKKVES  377

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ E +I+ L    +++   +P+ CI++FF+EG++SQP   PP   +PV  L L+E  
Sbjct  378  IPSLFEDIIERLAASQVMT--VKPDACIVDFFNEGDHSQPNSCPPWFGRPVYMLFLTECD  435

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            + FGRT+  D  G+YRG++ LSL  GSLLVM+G S D+A+HA+ S   +R+ +TF K   
Sbjct  436  ITFGRTIVSDHPGDYRGAVKLSLVPGSLLVMQGKSTDLAKHALPSIHKQRILVTFTKSQP  495

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSPYNGTPDY  632
            +T + N+S  + P +T   + W P     P   TP++
Sbjct  496  KTSLPNDSQRLSPAVT---SHWAP-----PQGRTPNH  524



>ref|XP_008454723.1| PREDICTED: uncharacterized protein LOC103495063 isoform X2 [Cucumis 
melo]
Length=686

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKED---LACQKSSN-EPI  170
            N+LR  G+ G+  G+T+++  +  KG+ RE+IQLG PI     ED   LA  K    EPI
Sbjct  310  NDLRASGKRGQFQGQTYVVSKRPTKGHGREMIQLGFPIADAPYEDDNSLALSKDRRIEPI  369

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ +ID L+   +++   +P+ CII+F++EG++SQP + P    +PV  LLL+E  +
Sbjct  370  PSLLQDLIDRLVGDQVMT--VKPDSCIIDFYNEGDHSQPHVWPSWFGRPVGVLLLTECEI  427

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D  GNYRG++ LSL  G+LLV++G SAD A+HA+ +   +R+ +T  K
Sbjct  428  TFGRVIGTDHSGNYRGAIKLSLTPGNLLVVQGKSADFAKHAIPAIRKQRILVTLTK  483



>ref|XP_008360022.1| PREDICTED: uncharacterized protein LOC103423718 [Malus domestica]
Length=687

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 109/176 (62%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LRV G+ G+  G+T+++  + ++G+ RE+IQLG P+     ED     +S     E I
Sbjct  302  NDLRVAGKRGQFQGQTYVVSKRPMRGHGREMIQLGLPVIDXPSEDEISSGTSKDRRIEAI  361

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ VID +    + +   +P+ CII+F++EG++S P   PP   +P+  L L+E  M
Sbjct  362  PSLLQDVIDRIAGMQVTT--VKPDSCIIDFYNEGDHSHPHTWPPWFGRPICVLFLTECDM  419

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR L  D  G+YRG L LSL  GSLL+++G S D A+HA+ S   +RV +TF K
Sbjct  420  TFGRVLVSDHPGDYRGPLKLSLTPGSLLLLQGKSTDFAKHAIPSIRKQRVLVTFTK  475



>ref|XP_010476539.1| PREDICTED: uncharacterized protein LOC104755774 isoform X1 [Camelina 
sativa]
Length=626

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 114/191 (60%), Gaps = 2/191 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR+ G+ G+L  E ++ Y +  +G+ RE+IQLG PI     +D + +    EPIP+ L
Sbjct  293  NNLRLSGRRGQLQSEAYVGYKRPNRGHGREMIQLGLPIADTPPDDESIKDRRIEPIPSAL  352

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +IS   +P+ CII+FF EG++SQP +  P   +PV  L L E    FGR
Sbjct  353  SDIIERLVSKQIIS--VKPDACIIDFFSEGDHSQPHMYVPWFGRPVCVLSLFECDFTFGR  410

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             +  D  G+Y+GSL LSL  GS+L++ G SA++A++A+ S+  +RV ITF K +      
Sbjct  411  VIVSDHPGDYKGSLKLSLTPGSVLLVEGKSANLAKYAVHSTRKQRVLITFIKSKPRNSTT  470

Query  543  SAEVVPPLTRA  575
                 PP +R+
Sbjct  471  GTNWGPPPSRS  481



>ref|XP_010476540.1| PREDICTED: uncharacterized protein LOC104755774 isoform X2 [Camelina 
sativa]
Length=615

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 114/191 (60%), Gaps = 2/191 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR+ G+ G+L  E ++ Y +  +G+ RE+IQLG PI     +D + +    EPIP+ L
Sbjct  282  NNLRLSGRRGQLQSEAYVGYKRPNRGHGREMIQLGLPIADTPPDDESIKDRRIEPIPSAL  341

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +IS   +P+ CII+FF EG++SQP +  P   +PV  L L E    FGR
Sbjct  342  SDIIERLVSKQIIS--VKPDACIIDFFSEGDHSQPHMYVPWFGRPVCVLSLFECDFTFGR  399

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             +  D  G+Y+GSL LSL  GS+L++ G SA++A++A+ S+  +RV ITF K +      
Sbjct  400  VIVSDHPGDYKGSLKLSLTPGSVLLVEGKSANLAKYAVHSTRKQRVLITFIKSKPRNSTT  459

Query  543  SAEVVPPLTRA  575
                 PP +R+
Sbjct  460  GTNWGPPPSRS  470



>ref|XP_009607025.1| PREDICTED: uncharacterized protein LOC104101279 [Nicotiana tomentosiformis]
Length=638

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 111/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC----QKSSNEPI  170
            N+LR  G+ G+LS +TFI+  + +KG+ RE+IQLG PI     ED A     ++   E I
Sbjct  280  NDLRASGRRGQLSAQTFIVSKRPMKGHGREMIQLGLPIADAPPEDEAAFATFKERKMEVI  339

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P + + VI+ L    +++   +P+ C I+ F+EG++SQP + P    +PV+ L L+E  M
Sbjct  340  PGLFQDVIERLSAMQVLTA--KPDACTIDIFNEGDHSQPHMWPYWYGRPVAMLFLTECEM  397

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             FG+ +  D  G+YRGSL LS   GS+LVM+G S D ARHA+ S   +R+ +TF K++
Sbjct  398  TFGKMIGVDHPGDYRGSLKLSFAPGSVLVMQGKSTDFARHAIPSIRKQRILVTFTKVQ  455



>ref|XP_010939980.1| PREDICTED: uncharacterized protein LOC105058678 [Elaeis guineensis]
Length=707

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 111/179 (62%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEPI  170
            N+LR  G+ GE  G T ++  + +KG+ RE+IQLG PI     ED      C++   E I
Sbjct  302  NDLRAAGRRGEFRGRTIVMSKRPMKGHGREMIQLGLPITEGSLEDENTAGTCKERKVEDI  361

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +++ + DHL+Q  +I    +P+ C I+FFDEG++  P  +PP   +P+ +L L+E  +
Sbjct  362  PGLVQDMFDHLVQLQIIPG--KPDFCTIDFFDEGDHLHPHTRPPWYGRPLCSLFLAECDI  419

Query  351  AFGRTLACDSD-GNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             FGR +  D   G+YRGSL L L +G+LLVM+G SAD+A+HA+     +R+ +TF K R
Sbjct  420  VFGRAIGGDHRVGDYRGSLKLCLAKGALLVMQGTSADLAKHAIPPLRKQRIFLTFGKSR  478



>ref|XP_009772695.1| PREDICTED: uncharacterized protein LOC104223045 [Nicotiana sylvestris]
Length=633

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 111/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC----QKSSNEPI  170
            N+LR  G+ G+LS +TFI+  + +KG+ RE+IQLG PI     ED A     ++   E I
Sbjct  281  NDLRASGRRGQLSAQTFIISKRPMKGHGREMIQLGLPIADAPPEDEAAFATFKERKMEVI  340

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++ +  I+ L    +++   +P+ C I+ F+EG++SQP + P    +PV+ L L+E  M
Sbjct  341  PSLFQDAIERLSAMQVLTA--KPDACTIDIFNEGDHSQPHMWPYWYGRPVAMLFLTECEM  398

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             FG+ +  D  G+YRGSL LS   GS+LVM+G S D ARHA+ S   +R+ +TF K++
Sbjct  399  TFGKMIGADHPGDYRGSLKLSFAPGSVLVMQGRSTDFARHAIPSIRKQRILVTFTKVQ  456



>ref|XP_008798368.1| PREDICTED: uncharacterized protein LOC103713273 [Phoenix dactylifera]
Length=709

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 110/177 (62%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEPI  170
            NELR  G+ GE  G+T +L  + ++G+ RE+IQLG PI     ED      C++   E I
Sbjct  305  NELRAAGRRGEFQGQTIVLSKRPMRGHGREMIQLGIPITDGSPEDENTAGTCKERKVEGI  364

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +++ V DHL+Q  +I    +P+ C I+FF+EG++S P   PP   +PV +L L+E  +
Sbjct  365  PNLVQDVFDHLVQLQIIP--VKPDFCTIDFFNEGDHSHPHTWPPWYGRPVCSLFLTECDI  422

Query  351  AFGRTLACDS-DGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D   G+YRG L LSL  G+LLVM+G SAD+A+HA+ S   + + +TF K
Sbjct  423  VFGRAIGGDHRGGDYRGPLKLSLAMGALLVMQGKSADLAKHAIPSLRKQCIFLTFGK  479



>emb|CDY45282.1| BnaA06g09520D [Brassica napus]
Length=601

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (60%), Gaps = 5/191 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+ G+L  E ++ Y +  +G+ RE+IQLG PI   + +D   +    EPIP+ L
Sbjct  286  NNLRTAGRRGQLQTEAYVGYKRPNRGHGREMIQLGLPIADTMPDD---ESRRIEPIPSFL  342

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +I    +P+ CII+FF+EG++SQP +  P   +PV  L LSE    FGR
Sbjct  343  SDIIERLVTKQIIP--VKPDACIIDFFNEGDHSQPHMLAPWFGRPVGILSLSECDFTFGR  400

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             +  D  G+Y+GSL LSL  GS+L++ G SAD+A+ A+ S P +R+ ITF K +      
Sbjct  401  VIVSDHPGDYKGSLKLSLTPGSVLLVEGKSADLAKFAIHSIPKQRILITFTKSQPRNSIT  460

Query  543  SAEVVPPLTRA  575
             +   PP +R+
Sbjct  461  GSNWAPPPSRS  471



>ref|XP_006583757.1| PREDICTED: uncharacterized protein LOC100781773 [Glycine max]
Length=664

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 123/210 (59%), Gaps = 12/210 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFG---NVKEDLACQKSSN-EP  167
            N+LRV G+ G+  G +TF++  + +KG+ RE+IQLG PI     +V       K    E 
Sbjct  292  NDLRVAGKRGQFQGNQTFVVSKRPMKGHGREMIQLGVPIADAPPDVDNVTGISKDKKVES  351

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ + +I+ L    +++   +P+ CI++FF+EGE+S P   PP   +PV TL L+E  
Sbjct  352  IPSLFQDIIERLAASQVMT--VKPDACIVDFFNEGEHSHPNNWPPWFGRPVYTLFLTECD  409

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            M FGR +  D  G +RG++ LSL  GSLLVM+G S D A+HA+ S   +R+ ITF K   
Sbjct  410  MTFGRIIVSDHPGEFRGAVRLSLVPGSLLVMQGKSTDFAKHALPSIHKQRIIITFTKSQP  469

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
            +  + N+S  + PP   A + W P    SP
Sbjct  470  KCSLPNDSQRLAPP---AASHWAPPQSRSP  496



>gb|KJB30647.1| hypothetical protein B456_005G153400 [Gossypium raimondii]
Length=683

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 126/210 (60%), Gaps = 10/210 (5%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            N+LR  G+ G+  +G+T++   + +KG+ RE+IQLG PI     +D     +S     E 
Sbjct  304  NDLRAAGKRGQFQAGQTYVASKKPMKGHGREMIQLGLPIADAPLDDEISAGTSKDRRIEA  363

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP +L+  ID L+   +++   +P+ CII+ ++EG++S P + PP   +P+  + L+E  
Sbjct  364  IPALLQDAIDRLVDSQVMTA--KPDSCIIDVYNEGDHSMPRMWPPWFGKPICVMFLTECD  421

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITF--FKI  521
            + FGR ++ D  G++RGSL LSL  GSLLVM G SAD A+HA+ S   +R+ +TF  ++ 
Sbjct  422  ITFGRMISVDPPGDFRGSLKLSLAPGSLLVMHGKSADFAKHALPSVRKQRILVTFTKYQP  481

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
            +  + +N     PPL+++ + W P    SP
Sbjct  482  KKSMSDNPRLPSPPLSQS-SQWVPSPSRSP  510



>ref|XP_009110517.1| PREDICTED: uncharacterized protein LOC103836054 [Brassica rapa]
 ref|XP_009110518.1| PREDICTED: uncharacterized protein LOC103836054 [Brassica rapa]
Length=580

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 115/191 (60%), Gaps = 4/191 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+ G+L  + F+ Y +  +G+ RE+IQLG PI     +D + +    EPIP+ L
Sbjct  259  NNLRNAGRRGQLQSDAFVGYKRPNRGHGREMIQLGLPIADARPDDESIKDRRIEPIPSFL  318

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +I    +P+ CII+FF+EG++SQP + PP   +PV  L LSE  + FGR
Sbjct  319  SDIIERLVSNQIIP--VKPDACIIDFFNEGDHSQPHMFPPWFGRPVGILSLSECDLTFGR  376

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             +  D  G+Y+GSL LSL  G +LV+ G SAD+A+ A+ S   +R+ ITF K +    N 
Sbjct  377  VIVSDQPGDYKGSLKLSLSPGLVLVVEGKSADLAKFAIHSIRKQRILITFTKSQPG--NG  434

Query  543  SAEVVPPLTRA  575
                 PPL+R+
Sbjct  435  LNCCPPPLSRS  445



>ref|XP_006307004.1| hypothetical protein CARUB_v10008596mg [Capsella rubella]
 gb|EOA39902.1| hypothetical protein CARUB_v10008596mg [Capsella rubella]
Length=619

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 115/191 (60%), Gaps = 2/191 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR+ G+ G+L  E ++ Y +  +G+ RE+IQLG PI     +D + +    EPIP+ L
Sbjct  287  NNLRLSGRRGQLQSEAYVGYKRPNRGHGREMIQLGLPIADTPPDDESIKDRRIEPIPSSL  346

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +I    +P+ CII+FF EG++SQP +  P   +PV  L LSE    FGR
Sbjct  347  SDIIERLMTKQIIP--VKPDACIIDFFSEGDHSQPHMFVPWFGRPVCVLSLSECDFTFGR  404

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             +  D  G+Y+GSL LSL  GS+L++ G SA++A++A+ S+  +R+ ITF K +      
Sbjct  405  VIVSDHPGDYKGSLKLSLTPGSVLMVEGKSANLAKYAVHSTRKQRILITFIKSKPRSSIT  464

Query  543  SAEVVPPLTRA  575
             A   PP +R+
Sbjct  465  GANWGPPPSRS  475



>ref|XP_010458983.1| PREDICTED: uncharacterized protein LOC104740153 [Camelina sativa]
Length=625

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 115/191 (60%), Gaps = 2/191 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR+ G+ G+L  E ++ Y +  +G+ RE+IQLG PI     ED + +    EPIP+ L
Sbjct  289  NNLRLSGRRGQLQSEAYVGYKRPNRGHGREMIQLGLPIADTPPEDESIKDRRVEPIPSAL  348

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +I    +P+ CII+FF EG++SQP +  P   +PV  L L E    FGR
Sbjct  349  SDIIERLVSKQIIP--VKPDACIIDFFSEGDHSQPHMYVPWFGRPVCVLSLFECDFTFGR  406

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             +  D  G+Y+GSL LSL  GS+L++ G SA++A++A+ S+  +RV ITF K +     +
Sbjct  407  VIVSDHPGDYKGSLKLSLTPGSVLLVEGKSANLAKYAVHSTRKQRVLITFIKSKPRNSIS  466

Query  543  SAEVVPPLTRA  575
             +   PP +R+
Sbjct  467  GSNWGPPPSRS  477



>emb|CDY41098.1| BnaC05g10890D [Brassica napus]
Length=589

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 114/191 (60%), Gaps = 5/191 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+ G+L  E ++ Y +  +G+ RE+IQLG PI   + +D   +    EPIP+ L
Sbjct  275  NNLRTSGRRGQLQSEAYVGYKRPNRGHGREMIQLGLPIADTMPDD---ESRRIEPIPSFL  331

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +I    +P+ CII+FF+EG++SQP +  P   +PV  L LSE    FGR
Sbjct  332  SDIIERLVTKQIIP--VKPDACIIDFFNEGDHSQPHMLAPWFGRPVGILSLSECDFTFGR  389

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             +  D  G+Y+GSL LSL  GS+L++ G S+D+A+ A+ S P +R+ ITF K +      
Sbjct  390  VIVSDHPGDYKGSLKLSLTPGSVLLVEGKSSDLAKFAIHSIPKQRILITFTKSQPRNSIT  449

Query  543  SAEVVPPLTRA  575
             +   PP +R+
Sbjct  450  GSNWAPPPSRS  460



>ref|XP_011021727.1| PREDICTED: uncharacterized protein LOC105123720 isoform X1 [Populus 
euphratica]
Length=695

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 110/176 (63%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIF---GNVKEDLACQKSSN-EPI  170
            NELR  G+ G+  G+T+IL  + +KG+ RE+IQ G PI       + +    K    E I
Sbjct  317  NELRAAGRRGQFQGQTYILSKRPMKGHGREMIQFGLPIADAPAETENETGISKDRRVESI  376

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VID L+   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  +
Sbjct  377  PAMLQEVIDRLVGMQVMT--VKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECEL  434

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +     G+YRGSL LSL  GSLLVM+G S+D+A+HA+     +R+ ITF K
Sbjct  435  TFGREIETVHHGDYRGSLKLSLVPGSLLVMQGKSSDVAKHAIPMIRKQRMLITFTK  490



>ref|XP_011021728.1| PREDICTED: uncharacterized protein LOC105123720 isoform X2 [Populus 
euphratica]
Length=694

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 110/176 (63%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIF---GNVKEDLACQKSSN-EPI  170
            NELR  G+ G+  G+T+IL  + +KG+ RE+IQ G PI       + +    K    E I
Sbjct  316  NELRAAGRRGQFQGQTYILSKRPMKGHGREMIQFGLPIADAPAETENETGISKDRRVESI  375

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VID L+   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  +
Sbjct  376  PAMLQEVIDRLVGMQVMT--VKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECEL  433

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +     G+YRGSL LSL  GSLLVM+G S+D+A+HA+     +R+ ITF K
Sbjct  434  TFGREIETVHHGDYRGSLKLSLVPGSLLVMQGKSSDVAKHAIPMIRKQRMLITFTK  489



>ref|XP_008454722.1| PREDICTED: uncharacterized protein LOC103495063 isoform X1 [Cucumis 
melo]
Length=690

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 115/180 (64%), Gaps = 10/180 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKED---LACQKSSN----  161
            N+LR  G+ G+  G+T+++  +  KG+ RE+IQLG PI     ED   LA  K +     
Sbjct  310  NDLRASGKRGQFQGQTYVVSKRPTKGHGREMIQLGFPIADAPYEDDNSLALSKVNFTDRR  369

Query  162  -EPIPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLS  338
             EPIP++L+ +ID L+   +++   +P+ CII+F++EG++SQP + P    +PV  LLL+
Sbjct  370  IEPIPSLLQDLIDRLVGDQVMT--VKPDSCIIDFYNEGDHSQPHVWPSWFGRPVGVLLLT  427

Query  339  ESTMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            E  + FGR +  D  GNYRG++ LSL  G+LLV++G SAD A+HA+ +   +R+ +T  K
Sbjct  428  ECEITFGRVIGTDHSGNYRGAIKLSLTPGNLLVVQGKSADFAKHAIPAIRKQRILVTLTK  487



>ref|XP_011021729.1| PREDICTED: uncharacterized protein LOC105123720 isoform X3 [Populus 
euphratica]
Length=689

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 110/176 (63%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIF---GNVKEDLACQKSSN-EPI  170
            NELR  G+ G+  G+T+IL  + +KG+ RE+IQ G PI       + +    K    E I
Sbjct  311  NELRAAGRRGQFQGQTYILSKRPMKGHGREMIQFGLPIADAPAETENETGISKDRRVESI  370

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VID L+   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  +
Sbjct  371  PAMLQEVIDRLVGMQVMT--VKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECEL  428

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +     G+YRGSL LSL  GSLLVM+G S+D+A+HA+     +R+ ITF K
Sbjct  429  TFGREIETVHHGDYRGSLKLSLVPGSLLVMQGKSSDVAKHAIPMIRKQRMLITFTK  484



>ref|XP_011021730.1| PREDICTED: uncharacterized protein LOC105123720 isoform X4 [Populus 
euphratica]
Length=688

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 110/176 (63%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIF---GNVKEDLACQKSSN-EPI  170
            NELR  G+ G+  G+T+IL  + +KG+ RE+IQ G PI       + +    K    E I
Sbjct  310  NELRAAGRRGQFQGQTYILSKRPMKGHGREMIQFGLPIADAPAETENETGISKDRRVESI  369

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VID L+   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  +
Sbjct  370  PAMLQEVIDRLVGMQVMT--VKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECEL  427

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +     G+YRGSL LSL  GSLLVM+G S+D+A+HA+     +R+ ITF K
Sbjct  428  TFGREIETVHHGDYRGSLKLSLVPGSLLVMQGKSSDVAKHAIPMIRKQRMLITFTK  483



>ref|XP_010105545.1| hypothetical protein L484_019288 [Morus notabilis]
 gb|EXC05040.1| hypothetical protein L484_019288 [Morus notabilis]
Length=681

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 117/209 (56%), Gaps = 8/209 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEPI  170
            N+LR  G+ G    +T+++  + +KG+ RE IQLG PI     ED       +    E I
Sbjct  297  NDLRSAGERGHFQSQTYVVSKRPMKGHGREKIQLGLPIADAPVEDEISAGTLKDRRTEAI  356

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ V + L+   + +   +P+ CII+F++EG++SQP L P    +PV  L L+E  M
Sbjct  357  PPLLQDVAERLVSMQVAT--VKPDSCIIDFYNEGDHSQPHLWPSWFGRPVCVLFLTECDM  414

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--R  524
             FGR  A D  G+YRG+L LSLK GSLL M+G SAD A+HA+ S   +R+ +TF K   +
Sbjct  415  TFGRVFAIDHPGDYRGALKLSLKPGSLLAMQGKSADFAKHAIPSLRRQRILVTFTKSQPK  474

Query  525  TCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
              + ++   +  P     + W P    SP
Sbjct  475  KSMPSDGQRMPSPGVAPSSHWGPQPSRSP  503



>ref|XP_009380066.1| PREDICTED: uncharacterized protein LOC103968538 [Musa acuminata 
subsp. malaccensis]
Length=692

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PI  170
            NE+R  G  GEL G+T  +  + ++G+ RE++Q G PI     ED     +S E     I
Sbjct  303  NEMRAAGHRGELPGQTLAILKRPMRGHGREMLQFGIPISEGPAEDENTTVTSGERRVEAI  362

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+ V D+L+Q  ++    +P+ CII+FF+EG++SQP   PP   +PV  LLL+E  +
Sbjct  363  PSLLQDVFDNLVQLQVLP--VKPDYCIIDFFNEGDHSQPRTWPPWYGRPVCNLLLTECDI  420

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             +GR +  D  G+Y GSL LSL  G+LLVM+G SAD+A+ A+ +   +R  +TF K R
Sbjct  421  VYGRAVESDHRGDYNGSLKLSLTAGALLVMQGKSADLAKRAIPALRKQRFLLTFGKSR  478



>ref|XP_007158786.1| hypothetical protein PHAVU_002G181800g [Phaseolus vulgaris]
 gb|ESW30780.1| hypothetical protein PHAVU_002G181800g [Phaseolus vulgaris]
Length=630

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 125/210 (60%), Gaps = 11/210 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            N+LR+ G+ G+L G + +++  + +KG+ RE+IQLG PI     E      +S     EP
Sbjct  264  NDLRISGKKGQLQGNQAYVVSRRPMKGHGREMIQLGVPIADAPVEGENMTGASKVMNVEP  323

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ E +I+ ++   +++   +P+ CI++F++EG++SQP   P    +PV TL L+E  
Sbjct  324  IPSLFEDIIERMVSSQVMTT--KPDCCIVDFYNEGDHSQPHSWPSWFGRPVYTLFLTECE  381

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            M FGR +A +  G+YRGSL LSL  GSLL M+G S D A+HA+ S   +R+ +TF K   
Sbjct  382  MTFGRLIASEHPGDYRGSLKLSLVPGSLLAMQGKSCDFAKHALPSIRKQRILVTFTKSQP  441

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
            +  V +++  +   L  A + W P    SP
Sbjct  442  KKSVPSDAQRLY--LPAASSQWGPPPSRSP  469



>ref|XP_007045468.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
2 [Theobroma cacao]
 ref|XP_007045470.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY01300.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY01302.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
2 [Theobroma cacao]
Length=680

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 111/177 (63%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            N+LR  G+ G+L G+T++   + +KG+ RE+IQLG PI     +D     +S     E I
Sbjct  301  NDLRAAGKRGQLQGQTYVAAKRPMKGHGREMIQLGLPIADAPLDDENAAGTSKDRRIEGI  360

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+  I+ L+   +++   +P+ CII+ ++EG++SQP + PP   +PV  + L+E  +
Sbjct  361  PPLLQDTIERLVNLQVMT--VKPDSCIIDVYNEGDHSQPRMWPPWFGKPVCIMFLTECDI  418

Query  351  AFGRT-LACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR  +  D  G+YRGSL LSL  GSLLVM+G SAD A+HA+ S   +R+ +TF K
Sbjct  419  TFGRVVIVADHPGDYRGSLKLSLAPGSLLVMQGKSADFAKHALPSVRKQRILVTFTK  475



>ref|XP_006355042.1| PREDICTED: uncharacterized protein LOC102600383 [Solanum tuberosum]
Length=638

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC----QKSSNEPI  170
            N+LR  G+ G+L  + FI+  + +KG+ RE++QLG PI     E+ A     +    E I
Sbjct  289  NDLRAAGRRGQLPAQAFIVSKRPMKGHGREMVQLGLPIVDAPPEEEAAISTYKDRKTEAI  348

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P + + VID L     +S   +P+ C+I+ F+EG++SQP L P    +P+S L L++  M
Sbjct  349  PGLFQDVIDQLSAMQALS--VKPDACVIDIFNEGDHSQPHLWPYWYGRPISMLFLTDCEM  406

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             FG+ +  D  G+YRGSL LSL  GS+LVM+G S + A++A+ S+  +R+ +TF K++
Sbjct  407  TFGKVIGVDHPGDYRGSLKLSLAPGSVLVMQGRSTEFAKYAIPSTRKQRILVTFTKLQ  464



>ref|XP_007158785.1| hypothetical protein PHAVU_002G181800g [Phaseolus vulgaris]
 gb|ESW30779.1| hypothetical protein PHAVU_002G181800g [Phaseolus vulgaris]
Length=671

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 125/210 (60%), Gaps = 11/210 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            N+LR+ G+ G+L G + +++  + +KG+ RE+IQLG PI     E      +S     EP
Sbjct  305  NDLRISGKKGQLQGNQAYVVSRRPMKGHGREMIQLGVPIADAPVEGENMTGASKVMNVEP  364

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ E +I+ ++   +++   +P+ CI++F++EG++SQP   P    +PV TL L+E  
Sbjct  365  IPSLFEDIIERMVSSQVMT--TKPDCCIVDFYNEGDHSQPHSWPSWFGRPVYTLFLTECE  422

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            M FGR +A +  G+YRGSL LSL  GSLL M+G S D A+HA+ S   +R+ +TF K   
Sbjct  423  MTFGRLIASEHPGDYRGSLKLSLVPGSLLAMQGKSCDFAKHALPSIRKQRILVTFTKSQP  482

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
            +  V +++  +   L  A + W P    SP
Sbjct  483  KKSVPSDAQRLY--LPAASSQWGPPPSRSP  510



>ref|XP_004236917.1| PREDICTED: uncharacterized protein LOC101261013 [Solanum lycopersicum]
Length=641

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 111/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC----QKSSNEPI  170
            N+LR  G+ G+L  + FI+  + +KG+ RE++QLG PI     E+ +     +    E I
Sbjct  292  NDLRAAGRRGQLPAQAFIVSKRPMKGHGREMVQLGLPIVDAPPEEESAISTYKDRKTEAI  351

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VID L     +S   +P+ C+I+ F+EG++SQP L P    +P+STL L++  M
Sbjct  352  PGLLQDVIDQLSAMQALS--VKPDACVIDIFNEGDHSQPHLWPYWYGRPISTLFLTDCEM  409

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             FG+ +  D  G+YRGSL LSL  GS+LVM+G S + A++A+ S   +R+ +TF K++
Sbjct  410  TFGKVIGVDHPGDYRGSLKLSLAPGSVLVMQGRSTEFAKYAIPSIRKQRMLVTFTKLQ  467



>ref|XP_006662146.1| PREDICTED: uncharacterized protein LOC102714587 [Oryza brachyantha]
Length=550

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 103/172 (60%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE +       L G+T ++  + +KG+ RE+IQLG PI G   ED   +    +PIP +L
Sbjct  171  NEAKTKRHEAVLEGQTVVVAKRPMKGHGREIIQLGLPITGGPPEDAQLRDVKVDPIPGVL  230

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + + D L+   ++  N  P+ C+I+FF EG+YS P   PP   +PV TL L++  M FG 
Sbjct  231  QDLFDRLVHQKVVPSN--PDYCVIDFFGEGDYSHPHHPPPWYGRPVCTLCLTDCDMVFGH  288

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +A DS G++ G L LSL  GS+LV  G SAD+A+ A+ ++  +RV ++F K
Sbjct  289  VIAADSRGDHVGPLKLSLTTGSVLVFEGKSADIAKRALPATCKQRVLLSFGK  340



>emb|CDY33746.1| BnaA09g45520D [Brassica napus]
Length=498

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 106/178 (60%), Gaps = 8/178 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN------E  164
            N LR  G+ G+L  E ++ Y +  +G+ RE+IQLG PI   + +D    K         E
Sbjct  220  NNLRNAGRRGQLQSEAYVSYKRPNRGHGREMIQLGLPIADTMPDDDESIKVKGKFYRRIE  279

Query  165  PIPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSES  344
            PIP+ +  +I+ L+   +I    +P+ CII+FF+EG++SQP +  P   +PV  L LSE 
Sbjct  280  PIPSFISDIIERLVSNQIIP--VKPDACIIDFFNEGDHSQPHMFVPWFGRPVGILSLSEC  337

Query  345  TMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
               FGR +  D  G+Y GSL L L  GSLL++ GNSAD+A+ A+ S P +R+ ITF K
Sbjct  338  EFTFGRVIVSDYPGDYMGSLKLYLTPGSLLLVEGNSADLAKFAIHSIPKKRILITFTK  395



>emb|CDX81664.1| BnaC08g39370D [Brassica napus]
Length=502

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 106/172 (62%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+ G+L  E ++ Y +  +G+ RE+IQLG PI   + +D   ++   EPIP+ L
Sbjct  218  NNLRNAGRRGQLQSEAYVSYKRPNRGHGREMIQLGLPIADTMPDDDENRRI--EPIPSFL  275

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +I    +P+ CII+FF+EG++SQP +  P   +PV  L LSE    FGR
Sbjct  276  SDIIERLVSKQIIP--VKPDACIIDFFNEGDHSQPHMFVPWFGRPVGVLSLSECEFTFGR  333

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +     G+Y GSL LSL  GSLL++ G SAD+A+ A+ S P +R+ ITF K
Sbjct  334  VIVSAYPGDYMGSLKLSLTPGSLLLVEGKSADLAKFAIHSIPKKRILITFTK  385



>ref|XP_008787901.1| PREDICTED: uncharacterized protein LOC103705814 [Phoenix dactylifera]
Length=709

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 110/179 (61%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEPI  170
            N+LR  G  GE  G T ++  + ++G+ RE+IQLG PI     ED      C++   E I
Sbjct  304  NDLRSAGCRGEFQGRTMVMSKRPMRGHGREMIQLGLPITEGHPEDENTAGTCKERKVEGI  363

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P+++  V DHL+Q  +I    +P+ C I+FFDEG++  P   PP   +P+ +L L+E  +
Sbjct  364  PSLVRNVFDHLVQLQIIP--VKPDFCTIDFFDEGDHLHPHTWPPWYGRPLCSLFLTECDI  421

Query  351  AFGRTLACDS-DGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             FGR +  D   G+YRGSL LSL +GSLLV++G SAD+A+ A+ S   +R+ +TF K R
Sbjct  422  VFGRAIRGDHRGGDYRGSLKLSLAKGSLLVVQGKSADLAKRAIPSIRKQRIFLTFGKSR  480



>ref|XP_011024628.1| PREDICTED: uncharacterized protein LOC105125743 isoform X2 [Populus 
euphratica]
Length=693

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 110/176 (63%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PI  170
            NELR  G+ G   G+T+IL  + +KG+ RE+IQLG PI     ED     +S E     I
Sbjct  312  NELRDTGRRGHCQGQTYILSKRPMKGHGREMIQLGLPIADAPAEDENATGTSKERRVESI  371

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VI+  +   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  +
Sbjct  372  PALLQDVIEQFVAMQVMT--MKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECEL  429

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FG+ +     G+Y+GSL LS+  GSLL+M+G S+D+A+HA+     +R+ +TF K
Sbjct  430  TFGKVIDTLHHGDYKGSLKLSVAPGSLLLMQGKSSDLAKHAIPMIRKQRMLVTFTK  485



>ref|XP_011024645.1| PREDICTED: uncharacterized protein LOC105125743 isoform X4 [Populus 
euphratica]
Length=692

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 110/176 (63%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PI  170
            NELR  G+ G   G+T+IL  + +KG+ RE+IQLG PI     ED     +S E     I
Sbjct  311  NELRDTGRRGHCQGQTYILSKRPMKGHGREMIQLGLPIADAPAEDENATGTSKERRVESI  370

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +L+ VI+  +   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  +
Sbjct  371  PALLQDVIEQFVAMQVMT--MKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECEL  428

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FG+ +     G+Y+GSL LS+  GSLL+M+G S+D+A+HA+     +R+ +TF K
Sbjct  429  TFGKVIDTLHHGDYKGSLKLSVAPGSLLLMQGKSSDLAKHAIPMIRKQRMLVTFTK  484



>ref|XP_010936869.1| PREDICTED: uncharacterized protein LOC105056388 isoform X2 [Elaeis 
guineensis]
Length=696

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 108/177 (61%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEPI  170
            NELR  G+ GE  G+T ++  +  +G+ RE+IQLG PI     ED      C++   E I
Sbjct  293  NELRAAGRRGEFQGQTIVMSKRPTRGHGREMIQLGIPITEGPPEDENTAGTCKERKVEGI  352

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +++ V D L+Q  +I    +P+ C I+FF+EG++S P+  PP   +PV +L L+E  +
Sbjct  353  PNLVQDVFDRLVQLQIIPS--KPDFCTIDFFNEGDHSHPYTWPPWYGRPVCSLFLTECDI  410

Query  351  AFGRTLACDSD-GNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D   G+YRG L LSL  G+LLV+ G SAD+A+HA+ S   + + +TF K
Sbjct  411  VFGRAIGGDHRVGDYRGPLKLSLAMGALLVIEGKSADLAKHAIPSLRKQCIFLTFGK  467



>ref|XP_010936866.1| PREDICTED: uncharacterized protein LOC105056388 isoform X1 [Elaeis 
guineensis]
 ref|XP_010936867.1| PREDICTED: uncharacterized protein LOC105056388 isoform X1 [Elaeis 
guineensis]
Length=708

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 108/177 (61%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEPI  170
            NELR  G+ GE  G+T ++  +  +G+ RE+IQLG PI     ED      C++   E I
Sbjct  305  NELRAAGRRGEFQGQTIVMSKRPTRGHGREMIQLGIPITEGPPEDENTAGTCKERKVEGI  364

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P +++ V D L+Q  +I    +P+ C I+FF+EG++S P+  PP   +PV +L L+E  +
Sbjct  365  PNLVQDVFDRLVQLQIIPS--KPDFCTIDFFNEGDHSHPYTWPPWYGRPVCSLFLTECDI  422

Query  351  AFGRTLACDSD-GNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FGR +  D   G+YRG L LSL  G+LLV+ G SAD+A+HA+ S   + + +TF K
Sbjct  423  VFGRAIGGDHRVGDYRGPLKLSLAMGALLVIEGKSADLAKHAIPSLRKQCIFLTFGK  479



>ref|NP_563957.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 ref|NP_849663.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE29212.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE29213.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
Length=601

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 110/172 (64%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    LRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILEV  188
            LR+ G+ G+L  E ++ Y +  +G+ RE+IQLG PI     +D + +    EPIP+ L  
Sbjct  283  LRLAGRRGQLQSEAYVGYKRPNRGHGREMIQLGLPIADTPPDDDSIKDRRIEPIPSALSD  342

Query  189  VIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTL  368
            +I+ L+   +I    +P+ CII+FF EG++SQP +  P   +P+S L LSE    FGR +
Sbjct  343  IIERLVSKQIIP--VKPDACIIDFFSEGDHSQPHMFVPWFGRPISVLSLSECDYTFGRVI  400

Query  369  ACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
              ++ G+Y+GSL LSL  GS+L++ G SA++A++A+ ++  +R+ I+F K +
Sbjct  401  VSENPGDYKGSLKLSLTPGSVLLVEGKSANLAKYAIHATRKQRILISFIKSK  452



>dbj|BAH19958.1| AT1G14710 [Arabidopsis thaliana]
Length=601

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 110/172 (64%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    LRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILEV  188
            LR+ G+ G+L  E ++ Y +  +G+ RE+IQLG PI     +D + +    EPIP+ L  
Sbjct  283  LRLAGRRGQLQSEAYVGYKRPNRGHGREMIQLGLPIADTPPDDDSIKDRRIEPIPSALSD  342

Query  189  VIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTL  368
            +I+ L+   +I    +P+ CII+FF EG++SQP +  P   +P+S L LSE    FGR +
Sbjct  343  IIERLVSKQIIP--VKPDACIIDFFSEGDHSQPHMFVPWFGRPISVLSLSECDYTFGRVI  400

Query  369  ACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
              ++ G+Y+GSL LSL  GS+L++ G SA++A++A+ ++  +R+ I+F K +
Sbjct  401  VSENPGDYKGSLKLSLTPGSVLLVEGKSANLAKYAIHATRKQRILISFIKSK  452



>ref|XP_007045471.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
5 [Theobroma cacao]
 gb|EOY01303.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
5 [Theobroma cacao]
Length=572

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 112/178 (63%), Gaps = 8/178 (4%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            N+LR  G+ G+L +G+T++   + +KG+ RE+IQLG PI     +D     +S     E 
Sbjct  192  NDLRAAGKRGQLQAGQTYVAAKRPMKGHGREMIQLGLPIADAPLDDENAAGTSKDRRIEG  251

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP +L+  I+ L+   +++   +P+ CII+ ++EG++SQP + PP   +PV  + L+E  
Sbjct  252  IPPLLQDTIERLVNLQVMT--VKPDSCIIDVYNEGDHSQPRMWPPWFGKPVCIMFLTECD  309

Query  348  MAFGRT-LACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            + FGR  +  D  G+YRGSL LSL  GSLLVM+G SAD A+HA+ S   +R+ +TF K
Sbjct  310  ITFGRVVIVADHPGDYRGSLKLSLAPGSLLVMQGKSADFAKHALPSVRKQRILVTFTK  367



>ref|XP_006580091.1| PREDICTED: uncharacterized protein LOC100809865 isoform X2 [Glycine 
max]
Length=641

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 112/177 (63%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEP  167
            N+LRV G+ G+L G + +I+  + +KG+ RE+IQLG PI     E      A +  + EP
Sbjct  267  NDLRVSGKKGQLQGSQAYIVSRRPMKGHGREMIQLGVPIADAPAEGENMTGASKDMNVEP  326

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ + +I+ ++   +++   +P+ CI++F++EG++SQP   P    +PV  L L+E  
Sbjct  327  IPSLFQDIIERMVSSQVMT--VKPDCCIVDFYNEGDHSQPHSWPSWYGRPVYILFLTECE  384

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            M FGR +A +  G+YRG + LSL  GSLLVM G S+D A+HA+ S   +R+ +TF K
Sbjct  385  MTFGRVIASEHPGDYRGGIKLSLVPGSLLVMEGKSSDFAKHALPSVRKQRILVTFTK  441



>ref|XP_009404147.1| PREDICTED: uncharacterized protein LOC103987543 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=619

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 106/175 (61%), Gaps = 6/175 (3%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PIP  173
            E R  G   EL G+T +   + +KG+ RE+IQ G PI    +ED     SS E     IP
Sbjct  284  ETRAAGHRKELPGQTLVTLKRPMKGHGREMIQFGIPINEGPQEDENTTVSSGEKKVAAIP  343

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
            ++L+V++  L+Q  ++    +P+ CII+ F+EG++SQP   PP   +PV  LLL++  + 
Sbjct  344  SVLQVMLHSLVQLQVLP--VKPDFCIIDLFNEGDHSQPHTWPPWYGRPVCNLLLTDCDIV  401

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            +GR +  D  GNY GSL LSL  G+LLVM G SAD+A+ A+ S   +R+ +TF K
Sbjct  402  YGRAVGSDHRGNYNGSLKLSLTAGALLVMEGKSADLAKRAIPSLRKQRILLTFGK  456



>ref|XP_009404146.1| PREDICTED: uncharacterized protein LOC103987543 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 106/175 (61%), Gaps = 6/175 (3%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PIP  173
            E R  G   EL G+T +   + +KG+ RE+IQ G PI    +ED     SS E     IP
Sbjct  292  ETRAAGHRKELPGQTLVTLKRPMKGHGREMIQFGIPINEGPQEDENTTVSSGEKKVAAIP  351

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
            ++L+V++  L+Q  ++    +P+ CII+ F+EG++SQP   PP   +PV  LLL++  + 
Sbjct  352  SVLQVMLHSLVQLQVLP--VKPDFCIIDLFNEGDHSQPHTWPPWYGRPVCNLLLTDCDIV  409

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            +GR +  D  GNY GSL LSL  G+LLVM G SAD+A+ A+ S   +R+ +TF K
Sbjct  410  YGRAVGSDHRGNYNGSLKLSLTAGALLVMEGKSADLAKRAIPSLRKQRILLTFGK  464



>ref|XP_009404148.1| PREDICTED: uncharacterized protein LOC103987543 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 106/175 (61%), Gaps = 6/175 (3%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----PIP  173
            E R  G   EL G+T +   + +KG+ RE+IQ G PI    +ED     SS E     IP
Sbjct  281  ETRAAGHRKELPGQTLVTLKRPMKGHGREMIQFGIPINEGPQEDENTTVSSGEKKVAAIP  340

Query  174  TILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMA  353
            ++L+V++  L+Q  ++    +P+ CII+ F+EG++SQP   PP   +PV  LLL++  + 
Sbjct  341  SVLQVMLHSLVQLQVLP--VKPDFCIIDLFNEGDHSQPHTWPPWYGRPVCNLLLTDCDIV  398

Query  354  FGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            +GR +  D  GNY GSL LSL  G+LLVM G SAD+A+ A+ S   +R+ +TF K
Sbjct  399  YGRAVGSDHRGNYNGSLKLSLTAGALLVMEGKSADLAKRAIPSLRKQRILLTFGK  453



>ref|XP_003524142.1| PREDICTED: uncharacterized protein LOC100809865 isoform X1 [Glycine 
max]
Length=681

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 112/177 (63%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEP  167
            N+LRV G+ G+L G + +I+  + +KG+ RE+IQLG PI     E      A +  + EP
Sbjct  307  NDLRVSGKKGQLQGSQAYIVSRRPMKGHGREMIQLGVPIADAPAEGENMTGASKDMNVEP  366

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ + +I+ ++   +++   +P+ CI++F++EG++SQP   P    +PV  L L+E  
Sbjct  367  IPSLFQDIIERMVSSQVMT--VKPDCCIVDFYNEGDHSQPHSWPSWYGRPVYILFLTECE  424

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            M FGR +A +  G+YRG + LSL  GSLLVM G S+D A+HA+ S   +R+ +TF K
Sbjct  425  MTFGRVIASEHPGDYRGGIKLSLVPGSLLVMEGKSSDFAKHALPSVRKQRILVTFTK  481



>dbj|BAK00235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=202

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = +3

Query  306  LEQPVSTLLLSESTMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSS  485
            L+ P+STLLLSE++MAFGR+L  DS+GNY+G L LSLK+GSLLVMRGNSADMARH +C S
Sbjct  1    LDNPISTLLLSETSMAFGRSLVTDSNGNYKGPLTLSLKQGSLLVMRGNSADMARHVVCPS  60

Query  486  PNRRVSITFFKIRTCVENNSAEVVPPLTRAMTLWQP  593
             NRRVSITF ++R     + + +  P T+AMTLWQP
Sbjct  61   SNRRVSITFVRVRPSTPVDLSPLPSP-TKAMTLWQP  95



>ref|XP_010032034.1| PREDICTED: uncharacterized protein LOC104421688 isoform X5 [Eucalyptus 
grandis]
 gb|KCW51420.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=666

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 106/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+ G+  G T++   + +KG+ RE+IQLG P+     E      S +  IP +L
Sbjct  294  NDLRAAGRKGQYQGHTYVASKRPMKGHGREMIQLGVPVADAPVEVENVGISRDRTIPALL  353

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+ ++   +++   +P+ CII+FF+E ++SQP   P    +PV  L L+E  M FG+
Sbjct  354  QDVIERVVGMQIMT--VKPDSCIIDFFNEVDHSQPHTWPHWYGRPVCVLFLTECDMTFGK  411

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +  +  G+Y+G+L LSL  GSLLVM+G S+D ARHA+ S   +R+ ITF K
Sbjct  412  VITANQPGDYKGALKLSLAPGSLLVMQGKSSDFARHAIPSLRKQRILITFTK  463



>ref|XP_007045467.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007045469.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY01299.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY01301.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
Length=681

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 112/178 (63%), Gaps = 8/178 (4%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            N+LR  G+ G+L +G+T++   + +KG+ RE+IQLG PI     +D     +S     E 
Sbjct  301  NDLRAAGKRGQLQAGQTYVAAKRPMKGHGREMIQLGLPIADAPLDDENAAGTSKDRRIEG  360

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP +L+  I+ L+   +++   +P+ CII+ ++EG++SQP + PP   +PV  + L+E  
Sbjct  361  IPPLLQDTIERLVNLQVMT--VKPDSCIIDVYNEGDHSQPRMWPPWFGKPVCIMFLTECD  418

Query  348  MAFGRT-LACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            + FGR  +  D  G+YRGSL LSL  GSLLVM+G SAD A+HA+ S   +R+ +TF K
Sbjct  419  ITFGRVVIVADHPGDYRGSLKLSLAPGSLLVMQGKSADFAKHALPSVRKQRILVTFTK  476



>ref|XP_010032033.1| PREDICTED: uncharacterized protein LOC104421688 isoform X4 [Eucalyptus 
grandis]
 gb|KCW51417.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=690

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 106/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+ G+  G T++   + +KG+ RE+IQLG P+     E      S +  IP +L
Sbjct  318  NDLRAAGRKGQYQGHTYVASKRPMKGHGREMIQLGVPVADAPVEVENVGISRDRTIPALL  377

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+ ++   +++   +P+ CII+FF+E ++SQP   P    +PV  L L+E  M FG+
Sbjct  378  QDVIERVVGMQIMT--VKPDSCIIDFFNEVDHSQPHTWPHWYGRPVCVLFLTECDMTFGK  435

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +  +  G+Y+G+L LSL  GSLLVM+G S+D ARHA+ S   +R+ ITF K
Sbjct  436  VITANQPGDYKGALKLSLAPGSLLVMQGKSSDFARHAIPSLRKQRILITFTK  487



>ref|XP_010032035.1| PREDICTED: uncharacterized protein LOC104421688 isoform X6 [Eucalyptus 
grandis]
 gb|KCW51416.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=663

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 106/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+ G+  G T++   + +KG+ RE+IQLG P+     E      S +  IP +L
Sbjct  291  NDLRAAGRKGQYQGHTYVASKRPMKGHGREMIQLGVPVADAPVEVENVGISRDRTIPALL  350

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+ ++   +++   +P+ CII+FF+E ++SQP   P    +PV  L L+E  M FG+
Sbjct  351  QDVIERVVGMQIMT--VKPDSCIIDFFNEVDHSQPHTWPHWYGRPVCVLFLTECDMTFGK  408

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +  +  G+Y+G+L LSL  GSLLVM+G S+D ARHA+ S   +R+ ITF K
Sbjct  409  VITANQPGDYKGALKLSLAPGSLLVMQGKSSDFARHAIPSLRKQRILITFTK  460



>ref|XP_010032032.1| PREDICTED: uncharacterized protein LOC104421688 isoform X3 [Eucalyptus 
grandis]
Length=693

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 106/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+ G+  G T++   + +KG+ RE+IQLG P+     E      S +  IP +L
Sbjct  321  NDLRAAGRKGQYQGHTYVASKRPMKGHGREMIQLGVPVADAPVEVENVGISRDRTIPALL  380

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+ ++   +++   +P+ CII+FF+E ++SQP   P    +PV  L L+E  M FG+
Sbjct  381  QDVIERVVGMQIMT--VKPDSCIIDFFNEVDHSQPHTWPHWYGRPVCVLFLTECDMTFGK  438

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +  +  G+Y+G+L LSL  GSLLVM+G S+D ARHA+ S   +R+ ITF K
Sbjct  439  VITANQPGDYKGALKLSLAPGSLLVMQGKSSDFARHAIPSLRKQRILITFTK  490



>ref|XP_010032031.1| PREDICTED: uncharacterized protein LOC104421688 isoform X2 [Eucalyptus 
grandis]
 gb|KCW51419.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=705

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 106/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+ G+  G T++   + +KG+ RE+IQLG P+     E      S +  IP +L
Sbjct  333  NDLRAAGRKGQYQGHTYVASKRPMKGHGREMIQLGVPVADAPVEVENVGISRDRTIPALL  392

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+ ++   +++   +P+ CII+FF+E ++SQP   P    +PV  L L+E  M FG+
Sbjct  393  QDVIERVVGMQIMT--VKPDSCIIDFFNEVDHSQPHTWPHWYGRPVCVLFLTECDMTFGK  450

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +  +  G+Y+G+L LSL  GSLLVM+G S+D ARHA+ S   +R+ ITF K
Sbjct  451  VITANQPGDYKGALKLSLAPGSLLVMQGKSSDFARHAIPSLRKQRILITFTK  502



>ref|XP_010032030.1| PREDICTED: uncharacterized protein LOC104421688 isoform X1 [Eucalyptus 
grandis]
Length=708

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 106/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+ G+  G T++   + +KG+ RE+IQLG P+     E      S +  IP +L
Sbjct  336  NDLRAAGRKGQYQGHTYVASKRPMKGHGREMIQLGVPVADAPVEVENVGISRDRTIPALL  395

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+ ++   +++   +P+ CII+FF+E ++SQP   P    +PV  L L+E  M FG+
Sbjct  396  QDVIERVVGMQIMT--VKPDSCIIDFFNEVDHSQPHTWPHWYGRPVCVLFLTECDMTFGK  453

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +  +  G+Y+G+L LSL  GSLLVM+G S+D ARHA+ S   +R+ ITF K
Sbjct  454  VITANQPGDYKGALKLSLAPGSLLVMQGKSSDFARHAIPSLRKQRILITFTK  505



>gb|KHN25979.1| hypothetical protein glysoja_018833 [Glycine soja]
Length=685

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 111/181 (61%), Gaps = 11/181 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN------  161
            N+LRV G+ G+L G + +I+  + +KG+ RE+IQLG PI     E      +S       
Sbjct  307  NDLRVSGKKGQLQGSQAYIVSRRPMKGHGREMIQLGVPIADAPAEGENMTGASKGKLYYM  366

Query  162  --EPIPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLL  335
              EPIP++ + +I+ ++   +++   +P+ CI++F++EG++SQP   P    +PV  L L
Sbjct  367  NVEPIPSLFQDIIERMVSSQVMT--VKPDCCIVDFYNEGDHSQPHSWPSWYGRPVYILFL  424

Query  336  SESTMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFF  515
            +E  M FGR +A +  G+YRG + LSL  GSLLVM G S+D A+HA+ S   +R+ +TF 
Sbjct  425  TECEMTFGRVIASEHPGDYRGGIKLSLVPGSLLVMEGKSSDFAKHALPSVRKQRILVTFT  484

Query  516  K  518
            K
Sbjct  485  K  485



>ref|XP_006605475.1| PREDICTED: uncharacterized protein LOC100814525 [Glycine max]
Length=626

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 114/188 (61%), Gaps = 9/188 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFG---NVKEDLACQKSSN-EP  167
            N+LRV G+ G+  G +TF++  + +KG+ RE+IQLG PI     +V       K    E 
Sbjct  288  NDLRVAGKRGQFQGNQTFVVSKRPMKGHGREMIQLGVPIADAPPDVDNVTGISKDKKVES  347

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ + +I  L+   +++   +P+ CI++FF+EGE+S P   PP   +P+  L L+E  
Sbjct  348  IPSLFQDIIKRLVASQVMT--VKPDACIVDFFNEGEHSHPNNWPPWFGRPLYILFLTECD  405

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            M FGR +  D  G +RG++ LSL  GSLLVM+G S D A+HA+ S   +R+ +TF K   
Sbjct  406  MTFGRIIVSDHPGEFRGAVTLSLVPGSLLVMQGKSTDFAKHALPSIHKQRIIVTFTKSQP  465

Query  522  RTCVENNS  545
            R+ + N+S
Sbjct  466  RSSLPNDS  473



>gb|KEH40698.1| hydroxyproline-rich glycoprotein family protein [Medicago truncatula]
Length=658

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 111/174 (64%), Gaps = 5/174 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGE-TFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN-EPIPT  176
            N+LRV G+ G+  G  T+++  + I+G+ RE+IQLG PI  +V    A  K  N E +P+
Sbjct  291  NDLRVAGRKGQFQGSPTYVVNKRPIRGHGREMIQLGVPI-ADVDNVTASFKDKNVESMPS  349

Query  177  ILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAF  356
            + + +I+ +    ++S   +P+ CI++F++EG++S P + P    +PV TL L+E  M F
Sbjct  350  LFQDIIERMAASQVMS--VKPDACIVDFYNEGDHSTPNIWPSSFGRPVYTLFLTECDMTF  407

Query  357  GRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            GRT   +  G+Y+ ++ LSL  GSLLVM+G SAD A+HA+ S   +R+ +TF K
Sbjct  408  GRTFVSEHFGDYKSNVKLSLGPGSLLVMQGKSADFAKHAIPSIHKQRILVTFAK  461



>ref|XP_006604416.1| PREDICTED: uncharacterized protein LOC100776159 isoform X2 [Glycine 
max]
Length=318

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = +3

Query  6    ELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILE  185
            E+    QNGELSGETFIL+N+Q+KGNKRELIQLG PIF  +K+D    KS+ EPIP +L 
Sbjct  224  EIHAAAQNGELSGETFILFNKQMKGNKRELIQLGVPIFRQIKDD---NKSNIEPIPALLH  280

Query  186  VVIDHLIQWHLISENRRPNGCIINFFDEGEYS  281
             VIDHLIQW LI E +RPNGCIINFF+E  +S
Sbjct  281  DVIDHLIQWKLIPEYKRPNGCIINFFEEVSFS  312



>ref|XP_011024636.1| PREDICTED: uncharacterized protein LOC105125743 isoform X3 [Populus 
euphratica]
Length=693

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 111/177 (63%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----P  167
            NELR  G+ G   +G+T+IL  + +KG+ RE+IQLG PI     ED     +S E     
Sbjct  311  NELRDTGRRGHCQAGQTYILSKRPMKGHGREMIQLGLPIADAPAEDENATGTSKERRVES  370

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP +L+ VI+  +   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  
Sbjct  371  IPALLQDVIEQFVAMQVMT--MKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECE  428

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            + FG+ +     G+Y+GSL LS+  GSLL+M+G S+D+A+HA+     +R+ +TF K
Sbjct  429  LTFGKVIDTLHHGDYKGSLKLSVAPGSLLLMQGKSSDLAKHAIPMIRKQRMLVTFTK  485



>ref|XP_011024620.1| PREDICTED: uncharacterized protein LOC105125743 isoform X1 [Populus 
euphratica]
Length=694

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 111/177 (63%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNE----P  167
            NELR  G+ G   +G+T+IL  + +KG+ RE+IQLG PI     ED     +S E     
Sbjct  312  NELRDTGRRGHCQAGQTYILSKRPMKGHGREMIQLGLPIADAPAEDENATGTSKERRVES  371

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP +L+ VI+  +   +++   +P+ CII+ ++EG++SQP + PP   +PVS L L+E  
Sbjct  372  IPALLQDVIEQFVAMQVMT--MKPDSCIIDIYNEGDHSQPHMWPPWFGKPVSVLFLTECE  429

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            + FG+ +     G+Y+GSL LS+  GSLL+M+G S+D+A+HA+     +R+ +TF K
Sbjct  430  LTFGKVIDTLHHGDYKGSLKLSVAPGSLLLMQGKSSDLAKHAIPMIRKQRMLVTFTK  486



>emb|CDY52029.1| BnaA08g31420D [Brassica napus]
Length=586

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 114/203 (56%), Gaps = 16/203 (8%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKS---------  155
            N LR  G+ G+L  + F+ Y +  +G+ RE+IQLG PI     +D   +           
Sbjct  253  NNLRNAGRRGQLQSDAFVGYKRPNRGHGREMIQLGLPIADTRPDDETIKGKVLFLIVSVD  312

Query  156  ---SNEPIPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVST  326
                 EPIP+ L  +I+ L+   +I    +P+ CII+FF+EG++SQP + PP   +PV  
Sbjct  313  WYRRIEPIPSFLSDIIERLVSNQIIP--VKPDACIIDFFNEGDHSQPHMFPPWFGRPVGI  370

Query  327  LLLSESTMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSI  506
            L LSE  + FGR +  D  G+Y+GSL LSL  G +LV+ G SAD+A+ A+ S   +R+ I
Sbjct  371  LSLSECDLTFGRVIVSDQPGDYKGSLKLSLSPGLVLVVEGKSADLAKFAIHSIRKQRILI  430

Query  507  TFFKIRTCVENNSAEVVPPLTRA  575
            TF K +     N     PPL+R+
Sbjct  431  TFTKSQPGNGLNWGP--PPLSRS  451



>ref|XP_006585073.1| PREDICTED: uncharacterized protein LOC100794176 [Glycine max]
Length=683

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 127/210 (60%), Gaps = 11/210 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEP  167
            N+LRV G+ G+L G + +I+  + +KG+ RE+IQLG  I     E      A +  + E 
Sbjct  310  NDLRVSGKKGQLQGSQAYIVSRRPMKGHGREMIQLGVRIADAPAEGENMTGASKDMNVES  369

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ + +I+ ++   +++   +P+ CI++F++EG++SQP   P    +PV  L L+E  
Sbjct  370  IPSLFQDIIERMVSSQVMT--VKPDCCIVDFYNEGDHSQPHSWPSWYGRPVYVLFLTECE  427

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            M FGR +A +  G+YRGS+ LSL  GSLLVM+G S+D A+HA+ S+  +R+ +TF K   
Sbjct  428  MTFGRVIASEHPGDYRGSIKLSLVPGSLLVMQGKSSDFAKHALPSTRKQRILVTFTKSQP  487

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
            R  + +++ ++   +  A + W P    SP
Sbjct  488  RKSLSSDAQQLASAV--ASSHWGPPPSRSP  515



>gb|KJB60863.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=616

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 105/178 (59%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            NELR  G+ G    +T++   + +KG+ RE+IQLG PI     +     ++S     E I
Sbjct  249  NELRAAGKRGHFQVQTYVASKKPMKGHGREMIQLGLPIADAPLDGETAARTSKDRRIEAI  308

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+  I+ L+   +I+   +P+ CII+ ++EG++S P + PP    P   L L+E  +
Sbjct  309  PSLLQDTIERLVDLQVITA--KPDSCIIDVYNEGDHSPPRMWPPWFGNPTFVLFLTECDI  366

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             FGR +  D  G+++GSL LSL  GSLLVM G SAD A+HA+ S    R+ +TF K +
Sbjct  367  TFGRVIGVDHPGDFKGSLKLSLSPGSLLVMEGKSADFAKHALPSVRKHRMLVTFTKYQ  424



>gb|KHN28877.1| hypothetical protein glysoja_025671 [Glycine soja]
Length=679

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 127/210 (60%), Gaps = 11/210 (5%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDL----ACQKSSNEP  167
            N+LRV G+ G+L G + +I+  + +KG+ RE+IQLG  I     E      A +  + E 
Sbjct  306  NDLRVSGKKGQLQGSQAYIVSRRPMKGHGREMIQLGVRIADAPAEGENMTGASKDMNVES  365

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ + +I+ ++   +++   +P+ CI++F++EG++SQP   P    +PV  L L+E  
Sbjct  366  IPSLFQDIIERMVSSQVMT--VKPDCCIVDFYNEGDHSQPHSWPSWYGRPVYVLFLTECE  423

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKI--  521
            M FGR +A +  G+YRGS+ LSL  GSLLVM+G S+D A+HA+ S+  +R+ +TF K   
Sbjct  424  MTFGRVIASEHPGDYRGSIKLSLVPGSLLVMQGKSSDFAKHALPSTRKQRILVTFTKSQP  483

Query  522  RTCVENNSAEVVPPLTRAMTLWQPGIPSSP  611
            R  + +++ ++   +  A + W P    SP
Sbjct  484  RKSLSSDAQQLASAV--ASSHWGPPPSRSP  511



>gb|KJB60862.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=645

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 105/178 (59%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            NELR  G+ G    +T++   + +KG+ RE+IQLG PI     +     ++S     E I
Sbjct  278  NELRAAGKRGHFQVQTYVASKKPMKGHGREMIQLGLPIADAPLDGETAARTSKDRRIEAI  337

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+  I+ L+   +I+   +P+ CII+ ++EG++S P + PP    P   L L+E  +
Sbjct  338  PSLLQDTIERLVDLQVITA--KPDSCIIDVYNEGDHSPPRMWPPWFGNPTFVLFLTECDI  395

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             FGR +  D  G+++GSL LSL  GSLLVM G SAD A+HA+ S    R+ +TF K +
Sbjct  396  TFGRVIGVDHPGDFKGSLKLSLSPGSLLVMEGKSADFAKHALPSVRKHRMLVTFTKYQ  453



>gb|KJB60864.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=661

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 105/178 (59%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPI  170
            NELR  G+ G    +T++   + +KG+ RE+IQLG PI     +     ++S     E I
Sbjct  294  NELRAAGKRGHFQVQTYVASKKPMKGHGREMIQLGLPIADAPLDGETAARTSKDRRIEAI  353

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P++L+  I+ L+   +I+   +P+ CII+ ++EG++S P + PP    P   L L+E  +
Sbjct  354  PSLLQDTIERLVDLQVITA--KPDSCIIDVYNEGDHSPPRMWPPWFGNPTFVLFLTECDI  411

Query  351  AFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             FGR +  D  G+++GSL LSL  GSLLVM G SAD A+HA+ S    R+ +TF K +
Sbjct  412  TFGRVIGVDHPGDFKGSLKLSLSPGSLLVMEGKSADFAKHALPSVRKHRMLVTFTKYQ  469



>gb|KJB60865.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=646

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 105/179 (59%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN-----EP  167
            NELR  G+ G    +T++   + +KG+ RE+IQLG PI     +     ++S      E 
Sbjct  278  NELRAAGKRGHFQVQTYVASKKPMKGHGREMIQLGLPIADAPLDGETAARTSKVDRRIEA  337

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++L+  I+ L+   +I+   +P+ CII+ ++EG++S P + PP    P   L L+E  
Sbjct  338  IPSLLQDTIERLVDLQVITA--KPDSCIIDVYNEGDHSPPRMWPPWFGNPTFVLFLTECD  395

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
            + FGR +  D  G+++GSL LSL  GSLLVM G SAD A+HA+ S    R+ +TF K +
Sbjct  396  ITFGRVIGVDHPGDFKGSLKLSLSPGSLLVMEGKSADFAKHALPSVRKHRMLVTFTKYQ  454



>ref|XP_004513244.1| PREDICTED: uncharacterized protein LOC101507475 [Cicer arietinum]
Length=657

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 113/177 (64%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            N++R+ G+ G+  G +T+++  + ++G+ RE+IQLG PI    +++     S+     EP
Sbjct  293  NDMRIAGKKGQFQGNQTYVVSKRPMRGHGREMIQLGLPIVDAPQDEDNMTASTKGKKIEP  352

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ + +I+ +    +++   +P+ CI++F++EG++S P   P    +PV  L L+E  
Sbjct  353  IPSLFQDIIERMATSQVMT--VKPDACIVDFYNEGDHSTPNSWPSWFGRPVYMLFLTECD  410

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            M FG T+  D+ G+YRG+L LSL  GSLLVM+G S D A++A+ S P +R+ +TF K
Sbjct  411  MTFGTTIVSDNPGDYRGTLKLSLVPGSLLVMQGKSTDCAKYAIPSIPKQRILVTFAK  467



>ref|XP_004513243.1| PREDICTED: uncharacterized protein LOC101506929 isoform X2 [Cicer 
arietinum]
Length=663

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 110/177 (62%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIF---GNVKEDLACQKSSN-EP  167
            N+LRV G+ G+L G +T+++  + ++G  RE+IQLG PI     +V    A  K  N E 
Sbjct  291  NDLRVAGRKGQLQGNQTYVVSKRPMRGRGREMIQLGVPIAYASPDVDNVTASTKDKNMES  350

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ E +I+ +    ++  N +P+ CI++F++EG++S P   P    +PV  L L+E  
Sbjct  351  IPSLFEDIIERMAASQVM--NVKPDACIVDFYNEGDHSMPNSWPSWFGRPVYMLFLTECD  408

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            M FGRT+  +  G+YRG++ LSL  GSLL M+G S D A+HA+ S   +R+ +TF K
Sbjct  409  MTFGRTIVSEHPGDYRGTIKLSLVPGSLLSMQGRSTDFAKHAIPSIHKQRILVTFTK  465



>ref|XP_004513242.1| PREDICTED: uncharacterized protein LOC101506929 isoform X1 [Cicer 
arietinum]
Length=669

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 110/177 (62%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIF---GNVKEDLACQKSSN-EP  167
            N+LRV G+ G+L G +T+++  + ++G  RE+IQLG PI     +V    A  K  N E 
Sbjct  297  NDLRVAGRKGQLQGNQTYVVSKRPMRGRGREMIQLGVPIAYASPDVDNVTASTKDKNMES  356

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++ E +I+ +    ++  N +P+ CI++F++EG++S P   P    +PV  L L+E  
Sbjct  357  IPSLFEDIIERMAASQVM--NVKPDACIVDFYNEGDHSMPNSWPSWFGRPVYMLFLTECD  414

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            M FGRT+  +  G+YRG++ LSL  GSLL M+G S D A+HA+ S   +R+ +TF K
Sbjct  415  MTFGRTIVSEHPGDYRGTIKLSLVPGSLLSMQGRSTDFAKHAIPSIHKQRILVTFTK  471



>emb|CDX84011.1| BnaC08g16340D [Brassica napus]
Length=518

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 101/172 (59%), Gaps = 17/172 (10%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR  G+ G+L  + F+ Y +  +G+ RE+IQL   I               EPIP+ L
Sbjct  233  NNLRNAGRRGQLQSDAFVGYKRPNRGHGREMIQLERRI---------------EPIPSFL  277

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+    I    +P+ CII+FF+EG++SQP + PP   +PV  L LSE  + FGR
Sbjct  278  SDIIERLVSNQFIPV--KPDSCIIDFFNEGDHSQPHMFPPWFGRPVGILSLSECDLTFGR  335

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +  D  G+Y+GSL LSL  GS+LV+ G SAD+A+ A+ S   +R+ ITF K
Sbjct  336  VIVSDQPGDYKGSLKLSLTPGSVLVVEGKSADLAKFAIHSIRKQRILITFTK  387



>gb|KJB60866.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=646

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 105/179 (59%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN----EP  167
            NELR  G+ G     +T++   + +KG+ RE+IQLG PI     +     ++S     E 
Sbjct  278  NELRAAGKRGHFQAVQTYVASKKPMKGHGREMIQLGLPIADAPLDGETAARTSKDRRIEA  337

Query  168  IPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSEST  347
            IP++L+  I+ L+   +I+   +P+ CII+ ++EG++S P + PP    P   L L+E  
Sbjct  338  IPSLLQDTIERLVDLQVITA--KPDSCIIDVYNEGDHSPPRMWPPWFGNPTFVLFLTECD  395

Query  348  MAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
            + FGR +  D  G+++GSL LSL  GSLLVM G SAD A+HA+ S    R+ +TF K +
Sbjct  396  ITFGRVIGVDHPGDFKGSLKLSLSPGSLLVMEGKSADFAKHALPSVRKHRMLVTFTKYQ  454



>ref|XP_006380086.1| hypothetical protein POPTR_0008s21780g [Populus trichocarpa]
 gb|ERP57883.1| hypothetical protein POPTR_0008s21780g [Populus trichocarpa]
Length=143

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 23/111 (21%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NELRV GQ GELSGETFIL+N++++GNKREL+QLG PIFG++KE+ A + S+ EPIP +L
Sbjct  46   NELRVAGQKGELSGETFILFNKRMQGNKRELLQLGVPIFGHIKEE-AARNSNIEPIPALL  104

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLL  335
            + VIDHL                       EYSQPFLKPPHL+QP+STL++
Sbjct  105  QGVIDHL----------------------EEYSQPFLKPPHLDQPISTLVM  133



>ref|XP_002892824.1| hypothetical protein ARALYDRAFT_471658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69083.1| hypothetical protein ARALYDRAFT_471658 [Arabidopsis lyrata subsp. 
lyrata]
Length=614

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 125/220 (57%), Gaps = 15/220 (7%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N LR+ G+  +L    ++ Y +  +G+ RE+IQLG PI     +D        EPIP+ L
Sbjct  284  NNLRLAGRRDQLR-SAYVGYKRPNRGHGREMIQLGLPIADTPPDD---DNRRIEPIPSAL  339

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
              +I+ L+   +I    +P+ CII+FF+EG++SQP +  P   +P+S L LSE    FGR
Sbjct  340  SDIIERLVSKQIIPV--KPDACIIDFFNEGDHSQPHMFVPWFGRPISVLSLSECDYTFGR  397

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIRTCVENN  542
             +  D+ G+Y+GSL LSL  GS+L++ G SA++A++A+ S+  +R+ I+F K +      
Sbjct  398  VIVSDNPGDYKGSLKLSLTPGSVLLVEGKSANLAKYAIHSTRKQRILISFIKSKPRNSIT  457

Query  543  SAEVVPPLTRAMTLWQ---------PGIPSSPYNGTPDYR  635
             +   PP +R+   ++         P IPS+    TP +R
Sbjct  458  GSNWGPPPSRSPNHFRHPTGPPIHYPVIPSTGVLPTPSHR  497



>gb|EAY77528.1| hypothetical protein OsI_32569 [Oryza sativa Indica Group]
Length=595

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 104/172 (60%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE +   +   L G+T ++  + +KG+ RE+IQLG PI     ED   ++   +PIP +L
Sbjct  215  NEAKTMRRKPGLEGQTVVVAKRPMKGHGREIIQLGLPITEGPPEDEHLREVKVDPIPGVL  274

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + + D L+   ++  +  P+ C+I+ F+EG+YS P   PP   +P+ TL L++  M FG 
Sbjct  275  QNLFDSLVHQKVVPSS--PDYCVIDIFNEGDYSHPHHHPPWYGRPICTLCLTDCDMVFGH  332

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +A DS G++ G L LSL  GS+LV  G SAD+A+ A+ ++  +R+ ++F K
Sbjct  333  VIAADSRGDHAGPLKLSLSTGSVLVFEGKSADIAKRALPATSKQRILLSFGK  384



>ref|NP_001064055.1| Os10g0116900 [Oryza sativa Japonica Group]
 gb|AAL34938.1|AC079037_11 Unknown protein [Oryza sativa]
 gb|ABB46634.2| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF25969.1| Os10g0116900 [Oryza sativa Japonica Group]
 gb|EAZ15124.1| hypothetical protein OsJ_30537 [Oryza sativa Japonica Group]
 dbj|BAH00288.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 104/172 (60%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE +   +   L G+T ++  + +KG+ RE+IQLG PI     ED   ++   +PIP +L
Sbjct  215  NEAKTMRRKPGLEGQTVVVAKRPMKGHGREIIQLGLPITEGPPEDEHLREVKVDPIPGVL  274

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + + D L+   ++  +  P+ C+I+ F+EG+YS P   PP   +P+ TL L++  M FG 
Sbjct  275  QNLFDSLVHQKVVPSS--PDYCVIDIFNEGDYSHPHHHPPWYGRPICTLCLTDCDMVFGH  332

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +A DS G++ G L LSL  GS+LV  G SAD+A+ A+ ++  +R+ ++F K
Sbjct  333  VIAADSRGDHAGPLKLSLSTGSVLVFEGKSADIAKRALPATSKQRILLSFGK  384



>gb|KGN49670.1| hypothetical protein Csa_5G056090 [Cucumis sativus]
Length=354

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 99/153 (65%), Gaps = 6/153 (4%)
 Frame = +3

Query  72   IKGNKRELIQLGTPIFGNVKED---LACQKSSN-EPIPTILEVVIDHLIQWHLISENRRP  239
            +KG+ RE+IQLG PI     ED   L   K    EPIP++L+ +ID L+   +++   +P
Sbjct  1    MKGHGREMIQLGFPIADAPHEDDNSLGLSKDRRIEPIPSLLQDLIDRLVGDQVMTV--KP  58

Query  240  NGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTLACDSDGNYRGSLILSLK  419
            + CII+F++EG++SQP + P    +PV  LLL+E  + FGR +  D  GNYRG++ LSL 
Sbjct  59   DSCIIDFYNEGDHSQPHVWPSWFGRPVGVLLLTECEITFGRVIGTDHSGNYRGAMKLSLT  118

Query  420  EGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             G+LLV++G SAD A+HA+ +   +R+ +T  K
Sbjct  119  PGNLLVVQGKSADFAKHALPAIRKQRILVTLTK  151



>gb|AAP51882.2| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
Length=596

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 100/160 (63%), Gaps = 2/160 (1%)
 Frame = +3

Query  39   SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTILEVVIDHLIQWHL  218
            +G+T ++  + +KG+ RE+IQLG PI     ED   ++   +PIP +L+ + D L+   +
Sbjct  228  AGQTVVVAKRPMKGHGREIIQLGLPITEGPPEDEHLREVKVDPIPGVLQNLFDSLVHQKV  287

Query  219  ISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTLACDSDGNYRG  398
            +  +  P+ C+I+ F+EG+YS P   PP   +P+ TL L++  M FG  +A DS G++ G
Sbjct  288  VPSS--PDYCVIDIFNEGDYSHPHHHPPWYGRPICTLCLTDCDMVFGHVIAADSRGDHAG  345

Query  399  SLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             L LSL  GS+LV  G SAD+A+ A+ ++  +R+ ++F K
Sbjct  346  PLKLSLSTGSVLVFEGKSADIAKRALPATSKQRILLSFGK  385



>gb|EPS61205.1| hypothetical protein M569_13593, partial [Genlisea aurea]
Length=275

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 105/178 (59%), Gaps = 8/178 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLAC----QKSSNEPI  170
             +LR  G+ GEL G+ F++  + +KG+ R +IQLGTP       +L+          EP+
Sbjct  96   KDLRASGRKGELQGQAFVVSKRPMKGHGRVMIQLGTPPTFFPNHNLSFPPFPADIKTEPL  155

Query  171  PTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTM  350
            P  L+ V + L+   +IS   +P+ CI++ FDEG++SQP   P  L +PV  L L++  M
Sbjct  156  PESLQDVTERLLAKEIIS--IKPDSCIVDIFDEGDHSQPHSWPHWLGRPVCVLFLTDCEM  213

Query  351  AFGR--TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             FG+  T+A    G+YRG+L LSL  G LL++ G SAD A+HA+ S   +R+ +T  K
Sbjct  214  VFGKSLTVADHPGGDYRGALKLSLHPGDLLLVEGKSADFAKHAIPSVRKQRILVTLTK  271



>gb|KCW51418.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=700

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 102/172 (59%), Gaps = 7/172 (4%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            N+LR  G+ G+  G T++   + +KG+ RE+IQLG P+     E      S +  IP +L
Sbjct  333  NDLRAAGRKGQYQGHTYVASKRPMKGHGREMIQLGVPVADAPVEVENVGISRDRTIPALL  392

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGR  362
            + VI+ ++   +++   +P+ CII+FF+E     P   P    +PV  L L+E  M FG+
Sbjct  393  QDVIERVVGMQIMT--VKPDSCIIDFFNE-----PHTWPHWYGRPVCVLFLTECDMTFGK  445

Query  363  TLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             +  +  G+Y+G+L LSL  GSLLVM+G S+D ARHA+ S   +R+ ITF K
Sbjct  446  VITANQPGDYKGALKLSLAPGSLLVMQGKSSDFARHAIPSLRKQRILITFTK  497



>gb|AAF79247.1|AC006917_32 F10B6.11 [Arabidopsis thaliana]
Length=625

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 111/196 (57%), Gaps = 26/196 (13%)
 Frame = +3

Query  9    LRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSN---------  161
            LR+ G+ G+L  E ++ Y +  +G+ RE+IQLG PI     +D + +  S          
Sbjct  283  LRLAGRRGQLQSEAYVGYKRPNRGHGREMIQLGLPIADTPPDDDSIKGKSFKMLFTYNFC  342

Query  162  ---------------EPIPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLK  296
                           EPIP+ L  +I+ L+   +I    +P+ CII+FF EG++SQP + 
Sbjct  343  VLVNMRYGLYADRRIEPIPSALSDIIERLVSKQIIP--VKPDACIIDFFSEGDHSQPHMF  400

Query  297  PPHLEQPVSTLLLSESTMAFGRTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAM  476
             P   +P+S L LSE    FGR +  ++ G+Y+GSL LSL  GS+L++ G SA++A++A+
Sbjct  401  VPWFGRPISVLSLSECDYTFGRVIVSENPGDYKGSLKLSLTPGSVLLVEGKSANLAKYAI  460

Query  477  CSSPNRRVSITFFKIR  524
             ++  +R+ I+F K +
Sbjct  461  HATRKQRILISFIKSK  476



>gb|KEH40700.1| hydroxyproline-rich glycoprotein family protein [Medicago truncatula]
Length=653

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 113/179 (63%), Gaps = 10/179 (6%)
 Frame = +3

Query  3    NELRVPGQNGELSG-ETFILYNQQIKGNKRELIQLGTPIFGNVKEDL-----ACQKSSNE  164
            N+LRV G+ G+  G +T++   + + G+ RE+IQLG PI  +   D+     + ++ + E
Sbjct  287  NDLRVSGRRGQFQGSQTYVASRRPVGGHGREMIQLGVPI-ADAPPDMDNLTTSTKEKNIE  345

Query  165  PIPTILEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSES  344
             IP++L+ +I+ +    +++   +P+  I++F++EG+YS P   P    +PV TL L+E 
Sbjct  346  SIPSLLQDIIERMTASQVMT--VKPDASIVDFYNEGDYSMPNSWPSWFGRPVYTLFLTEC  403

Query  345  TMAFGRTLACDSD-GNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
             + FGRT+      G+YRGSL LSL  GS++VM+GN+AD A+HA+ S   +R+ ITF K
Sbjct  404  DITFGRTIVSRHHPGDYRGSLKLSLIPGSIIVMQGNAADCAKHAIPSIHKQRILITFAK  462



>emb|CDP05487.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 104/187 (56%), Gaps = 15/187 (8%)
 Frame = +3

Query  72   IKGNKRELIQLGTPIFGNVKEDLACQKSSN------------EPIPTILEVVIDHLIQWH  215
            +KG+ RE+IQ G PI     ED A   +S             EPIP++ E +I+ L+   
Sbjct  1    MKGHGREMIQFGPPIADAPPEDEASSGTSKGICYNENLYRKMEPIPSLFEDIIERLVALQ  60

Query  216  LISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTLACDSDGNYR  395
            ++S   +P+ CI++ F+EG++SQP   P    +PV  L L++  M FG+ +  D  G+YR
Sbjct  61   VVS--VKPDSCIVDIFNEGDHSQPHTWPHWFGRPVCVLFLTDCEMTFGKVIGIDHPGDYR  118

Query  396  GSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR-TCVENNSAEVVPPLTR  572
            GSL LSL  GSL+++ G S+D ARHA+ S   +R+ +T  K +   + ++ A+  P    
Sbjct  119  GSLRLSLTPGSLMLLDGRSSDFARHAIPSIRKQRILVTLTKSQPKKITSSDAQRFPSSAP  178

Query  573  AMTLWQP  593
              + W P
Sbjct  179  VPSHWVP  185



>gb|EEC79196.1| hypothetical protein OsI_19904 [Oryza sativa Indica Group]
Length=236

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 66/89 (74%), Gaps = 3/89 (3%)
 Frame = +3

Query  3    NELRVPGQNGELSGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTIL  182
            NE+R  G+NGELSGETFI +N+QIKGNKRE+IQLG P+F    E+  C     E IP +L
Sbjct  65   NEIRQAGRNGELSGETFIFFNKQIKGNKREIIQLGVPLFQPTTEESNCHI---EAIPLVL  121

Query  183  EVVIDHLIQWHLISENRRPNGCIINFFDE  269
            + VIDHL+ W LI E+R+PN  IINFFDE
Sbjct  122  QAVIDHLVLWRLIPESRKPNSVIINFFDE  150



>ref|XP_006649704.1| PREDICTED: uncharacterized protein LOC102720214 [Oryza brachyantha]
Length=637

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 107/173 (62%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTI  179
            NE +   + G L +G+T I+  + +KG+ RE+IQLG PI     ED   +++  E +P +
Sbjct  255  NETKASCRRGGLEAGQTVIVGKRPMKGHGREIIQLGIPIIEGPPEDDYPRETKVEAVPGL  314

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L  + D L Q  +I    +P+ C+I++++EG+YS P   PP   +P  TL L++  M FG
Sbjct  315  LHDLFDRLCQKEVIPT--KPDYCVIDYYNEGDYSHPHQSPPWYGRPFCTLCLTDCDMVFG  372

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            R ++ +  G++RG L LSL  GSLLV+ G SAD+A+ A+ ++  +R+ ++F K
Sbjct  373  RVISGER-GDHRGPLKLSLSTGSLLVLEGKSADVAKRAIPAARKQRILLSFGK  424



>gb|KJB60867.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=345

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 93/155 (60%), Gaps = 6/155 (4%)
 Frame = +3

Query  72   IKGNKRELIQLGTPIFGNVKEDLACQKSSN----EPIPTILEVVIDHLIQWHLISENRRP  239
            +KG+ RE+IQLG PI     +     ++S     E IP++L+  I+ L+   +I+   +P
Sbjct  1    MKGHGREMIQLGLPIADAPLDGETAARTSKDRRIEAIPSLLQDTIERLVDLQVITA--KP  58

Query  240  NGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFGRTLACDSDGNYRGSLILSLK  419
            + CII+ ++EG++S P + PP    P   L L+E  + FGR +  D  G+++GSL LSL 
Sbjct  59   DSCIIDVYNEGDHSPPRMWPPWFGNPTFVLFLTECDITFGRVIGVDHPGDFKGSLKLSLS  118

Query  420  EGSLLVMRGNSADMARHAMCSSPNRRVSITFFKIR  524
             GSLLVM G SAD A+HA+ S    R+ +TF K +
Sbjct  119  PGSLLVMEGKSADFAKHALPSVRKHRMLVTFTKYQ  153



>ref|NP_001049502.1| Os03g0238800 [Oryza sativa Japonica Group]
 dbj|BAF11416.1| Os03g0238800, partial [Oryza sativa Japonica Group]
Length=563

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTI  179
            NE +   + G L +G+T I+  + +KG+ RE+IQLG PI     ED   +++  E +P +
Sbjct  261  NETKASFRRGGLEAGQTVIIGKRPMKGHGREIIQLGIPIVEGPPEDDYPRETKVEAVPGL  320

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L  + D L Q  +I    +P+ C+I++++EG+YS P   PP   +P  T  L++  M FG
Sbjct  321  LHDLFDRLCQKEIIPT--KPDYCVIDYYNEGDYSHPHQSPPWYGRPFCTFCLTDCDMVFG  378

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            R ++ +  G++RG L LSL  GSLLV+ G SAD+A+ A+ ++  +R+ ++F K
Sbjct  379  RVISGER-GDHRGPLKLSLSTGSLLVLHGKSADVAKRAIPAACKQRILLSFGK  430



>gb|EEE58665.1| hypothetical protein OsJ_10079 [Oryza sativa Japonica Group]
Length=626

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTI  179
            NE +   + G L +G+T I+  + +KG+ RE+IQLG PI     ED   +++  E +P +
Sbjct  229  NETKASFRRGGLEAGQTVIIGKRPMKGHGREIIQLGIPIVEGPPEDDYPRETKVEAVPGL  288

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L  + D L Q  +I    +P+ C+I++++EG+YS P   PP   +P  T  L++  M FG
Sbjct  289  LHDLFDRLCQKEIIPT--KPDYCVIDYYNEGDYSHPHQSPPWYGRPFCTFCLTDCDMVFG  346

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            R ++ +  G++RG L LSL  GSLLV+ G SAD+A+ A+ ++  +R+ ++F K
Sbjct  347  RVISGER-GDHRGPLKLSLSTGSLLVLHGKSADVAKRAIPAACKQRILLSFGK  398



>gb|EEC74839.1| hypothetical protein OsI_10686 [Oryza sativa Indica Group]
Length=658

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTI  179
            NE +   + G L +G+T I+  + +KG+ RE+IQLG PI     ED   +++  E +P +
Sbjct  261  NETKASFRRGGLEAGQTVIIGKRPMKGHGREIIQLGIPIVEGPPEDDYPRETKVEAVPGL  320

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L  + D L Q  +I    +P+ C+I++++EG+YS P   PP   +P  T  L++  M FG
Sbjct  321  LHDLFDRLCQKEIIPT--KPDYCVIDYYNEGDYSHPHQSPPWYGRPFCTFCLTDCDMVFG  378

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            R ++ +  G++RG L LSL  GSLLV+ G SAD+A+ A+ ++  +R+ ++F K
Sbjct  379  RVISGER-GDHRGPLKLSLSTGSLLVLHGKSADVAKRAIPAACKQRILLSFGK  430



>gb|ABF94870.1| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
Length=658

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTI  179
            NE +   + G L +G+T I+  + +KG+ RE+IQLG PI     ED   +++  E +P +
Sbjct  261  NETKASFRRGGLEAGQTVIIGKRPMKGHGREIIQLGIPIVEGPPEDDYPRETKVEAVPGL  320

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L  + D L Q  +I    +P+ C+I++++EG+YS P   PP   +P  T  L++  M FG
Sbjct  321  LHDLFDRLCQKEIIPT--KPDYCVIDYYNEGDYSHPHQSPPWYGRPFCTFCLTDCDMVFG  378

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            R ++ +  G++RG L LSL  GSLLV+ G SAD+A+ A+ ++  +R+ ++F K
Sbjct  379  RVISGER-GDHRGPLKLSLSTGSLLVLHGKSADVAKRAIPAACKQRILLSFGK  430



>ref|XP_002468197.1| hypothetical protein SORBIDRAFT_01g041520 [Sorghum bicolor]
 gb|EER95195.1| hypothetical protein SORBIDRAFT_01g041520 [Sorghum bicolor]
Length=631

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 103/173 (60%), Gaps = 3/173 (2%)
 Frame = +3

Query  3    NELRVPGQNGEL-SGETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTI  179
            NE +   + G L +G+T I+  +  KG+ RE++QLG PI     +D   +++  E IP +
Sbjct  233  NETKASYRRGGLEAGQTVIIAKRPTKGHGREIVQLGVPIIEGPPDDENQRETRVEAIPGL  292

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L  + D L Q  +I    +P+ C+I+ F EG+YS P   PP   +P+ TL L++  M FG
Sbjct  293  LHDLFDRLSQQEVIP--FKPDYCVIDIFSEGDYSHPHQSPPWYGRPLCTLCLTDCDMVFG  350

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            R+++    G++RG L LSL  GSLL+M+G S + A+ A+ ++  +RV + F K
Sbjct  351  RSISVGERGDHRGPLKLSLATGSLLLMQGKSVECAKRAIPATRKQRVILNFGK  403



>ref|XP_003558397.1| PREDICTED: uncharacterized protein LOC100828230 [Brachypodium 
distachyon]
Length=669

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 103/173 (60%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    NELRVPGQNGELS-GETFILYNQQIKGNKRELIQLGTPIFGNVKEDLACQKSSNEPIPTI  179
            NE +   + G    G+T ++  + +KG+   +IQLG PI     ED   +++  EP+P +
Sbjct  264  NETKTSSRRGGFEVGQTVVVGKRPLKGHGSVIIQLGVPIIDGPLEDENPRETRVEPVPGL  323

Query  180  LEVVIDHLIQWHLISENRRPNGCIINFFDEGEYSQPFLKPPHLEQPVSTLLLSESTMAFG  359
            L  + D L Q  ++    +P+ C+I+F+ EGEYS P   P    +P+ TL L+E  M FG
Sbjct  324  LHDLFDRLFQQEIMPS--KPDYCVIDFYHEGEYSHPQQAPSWYGRPLCTLCLTECDMVFG  381

Query  360  RTLACDSDGNYRGSLILSLKEGSLLVMRGNSADMARHAMCSSPNRRVSITFFK  518
            R +  +  G++RG L LSL  GSL+V++G S+D+A+ A+C++   R+ +TF K
Sbjct  382  RVILGER-GDFRGPLKLSLSTGSLIVLQGKSSDVAKRAICATRKPRILLTFGK  433



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125