BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G19

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AII99843.1|  thiosulfate/3-mercaptopyruvate sulfurtransferase ...    108   1e-24   Nicotiana tabacum [American tobacco]
ref|XP_009607756.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...    108   2e-24   
ref|XP_009791376.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...    107   5e-24   Nicotiana sylvestris
ref|XP_009607755.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...    104   4e-23   Nicotiana tomentosiformis
ref|XP_002264748.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...    103   8e-23   Vitis vinifera
emb|CDP13580.1|  unnamed protein product                                101   4e-22   Coffea canephora [robusta coffee]
gb|KDP25080.1|  hypothetical protein JCGZ_22615                       99.8    2e-21   Jatropha curcas
ref|XP_009341701.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  95.1    7e-20   Pyrus x bretschneideri [bai li]
ref|XP_007211437.1|  hypothetical protein PRUPE_ppa007180mg           94.4    2e-19   Prunus persica
ref|XP_008226128.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  92.0    9e-19   Prunus mume [ume]
gb|EYU33788.1|  hypothetical protein MIMGU_mgv1a008159mg              91.7    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_008383139.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  90.9    2e-18   Malus domestica [apple tree]
ref|XP_002513368.1|  thiosulfate sulfertansferase, putative           90.5    4e-18   
ref|XP_008372008.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  90.1    4e-18   
ref|XP_009777861.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  89.7    6e-18   Nicotiana sylvestris
ref|XP_009361846.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  89.7    7e-18   Pyrus x bretschneideri [bai li]
ref|XP_009587459.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  89.4    7e-18   Nicotiana tomentosiformis
gb|KFK42300.1|  hypothetical protein AALP_AA2G238100                  89.0    1e-17   Arabis alpina [alpine rockcress]
ref|XP_008364248.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  87.4    4e-17   
ref|XP_004306581.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  87.0    5e-17   Fragaria vesca subsp. vesca
ref|XP_008356158.1|  PREDICTED: uncharacterized protein LOC103419846  88.2    7e-17   
ref|XP_004232812.2|  PREDICTED: LOW QUALITY PROTEIN: thiosulfate/...  86.7    7e-17   
ref|XP_007022597.1|  Mercaptopyruvate sulfurtransferase 1 isoform 2   86.3    1e-16   
ref|XP_010243916.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  85.5    2e-16   Nelumbo nucifera [Indian lotus]
gb|AAD19957.1|  thiosulfate sulfurtransferase                         85.5    2e-16   Datisca glomerata
gb|KJB83963.1|  hypothetical protein B456_013G142500                  85.1    3e-16   Gossypium raimondii
gb|KJB83962.1|  hypothetical protein B456_013G142500                  84.3    5e-16   Gossypium raimondii
gb|KJB83961.1|  hypothetical protein B456_013G142500                  84.3    5e-16   Gossypium raimondii
ref|XP_011022084.1|  PREDICTED: LOW QUALITY PROTEIN: thiosulfate/...  84.0    7e-16   Populus euphratica
ref|XP_006305135.1|  hypothetical protein CARUB_v10009502mg           81.6    2e-15   
gb|ACI96074.1|  mercaptopyruvate sulfurtransferase 1                  82.4    2e-15   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_006302392.1|  hypothetical protein CARUB_v10020460mg           82.0    3e-15   
gb|ACN58229.1|  thiosulfate:cyanide sulfurtransferase-like protein    81.3    4e-15   Solanum lycopersicum
emb|CAB64716.1|  3-mercaptopyruvate sulfurtransferase                 81.6    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565203.1|  mercaptopyruvate sulfurtransferase 1                81.6    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007022596.1|  Mercaptopyruvate sulfurtransferase 1 isoform 1   81.6    6e-15   
ref|XP_002887774.1|  hypothetical protein ARALYDRAFT_895827           81.3    7e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_006416816.1|  hypothetical protein EUTSA_v10007910mg           80.9    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_006347118.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  79.7    1e-14   Solanum tuberosum [potatoes]
ref|XP_010537790.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  80.5    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_002892908.1|  hypothetical protein ARALYDRAFT_471843           79.3    2e-14   
gb|ACO57704.1|  mercapto-pyruvate sulfurtransferase 1                 80.1    2e-14   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009104542.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  80.1    2e-14   Brassica rapa
emb|CDX79307.1|  BnaC06g19960D                                        79.7    2e-14   
gb|ABK94242.1|  unknown                                               79.7    2e-14   Populus trichocarpa [western balsam poplar]
gb|KDO61605.1|  hypothetical protein CISIN_1g017338mg                 78.2    3e-14   Citrus sinensis [apfelsine]
gb|KDO61604.1|  hypothetical protein CISIN_1g017338mg                 78.2    3e-14   Citrus sinensis [apfelsine]
ref|XP_004149966.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  79.3    3e-14   
ref|XP_004160468.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  79.3    3e-14   
ref|XP_010324183.1|  PREDICTED: mercaptopyruvate sulfurtransferas...  79.3    4e-14   Solanum lycopersicum
ref|XP_010324184.1|  PREDICTED: mercaptopyruvate sulfurtransferas...  79.0    5e-14   Solanum lycopersicum
ref|XP_007211436.1|  hypothetical protein PRUPE_ppa007180mg           77.8    6e-14   
gb|KDO61603.1|  hypothetical protein CISIN_1g017338mg                 78.2    6e-14   Citrus sinensis [apfelsine]
ref|XP_006475339.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  78.2    8e-14   Citrus sinensis [apfelsine]
ref|XP_006422246.1|  hypothetical protein CICLE_v10005196mg           78.2    8e-14   Citrus clementina [clementine]
ref|XP_002310670.2|  hypothetical protein POPTR_0007s08020g           77.0    8e-14   
gb|KGN57573.1|  hypothetical protein Csa_3G215610                     79.0    8e-14   Cucumis sativus [cucumbers]
gb|ACT33453.1|  mercapto-pyruvate sulfurtransferase 1                 78.2    9e-14   Brassica napus [oilseed rape]
ref|XP_008346125.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  76.3    9e-14   
emb|CDX87398.1|  BnaA07g34750D                                        77.8    1e-13   
ref|XP_009106646.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  77.4    1e-13   Brassica rapa
ref|NP_001234274.1|  mercaptopyruvate sulfurtransferase-like protein  77.4    1e-13   Solanum lycopersicum
ref|XP_008456097.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  77.4    2e-13   Cucumis melo [Oriental melon]
ref|XP_010094713.1|  hypothetical protein L484_003021                 77.4    2e-13   Morus notabilis
ref|XP_010429794.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  77.0    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010497860.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  76.3    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_011086349.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  75.1    1e-12   Sesamum indicum [beniseed]
gb|ACB59214.1|  cytoplasmic thiosulfate:cyanide sulfur transferase    74.7    1e-12   Brassica oleracea
emb|CDY33328.1|  BnaC05g12550D                                        74.7    1e-12   Brassica napus [oilseed rape]
emb|CDY35094.1|  BnaA06g11040D                                        74.7    1e-12   Brassica napus [oilseed rape]
ref|XP_010476757.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  74.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002307187.2|  thiosulfate sulfurtransferase family protein     73.6    2e-12   
ref|XP_006853294.1|  hypothetical protein AMTR_s00032p00026180        74.3    2e-12   Amborella trichopoda
ref|XP_011007217.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  73.9    3e-12   Populus euphratica
gb|AFK34139.1|  unknown                                               73.6    3e-12   Lotus japonicus
ref|XP_004488787.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  73.6    4e-12   Cicer arietinum [garbanzo]
ref|XP_010417543.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  73.2    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010472766.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  73.2    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010459188.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  72.8    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010539576.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  72.0    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_009149076.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  72.0    1e-11   Brassica rapa
ref|XP_010539575.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  72.0    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_003546810.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  72.0    2e-11   Glycine max [soybeans]
gb|KCW71382.1|  hypothetical protein EUGRSUZ_F04458                   71.6    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010064077.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  71.6    2e-11   Eucalyptus grandis [rose gum]
ref|XP_006346030.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  71.2    2e-11   Solanum tuberosum [potatoes]
ref|XP_006389908.1|  hypothetical protein EUTSA_v10018699mg           71.2    3e-11   Eutrema salsugineum [saltwater cress]
ref|XP_007022598.1|  Mercaptopyruvate sulfurtransferase 1 isoform 3   69.7    5e-11   
ref|XP_006305134.1|  hypothetical protein CARUB_v10009502mg           68.6    5e-11   
ref|XP_006416815.1|  hypothetical protein EUTSA_v10007910mg           69.7    5e-11   Eutrema salsugineum [saltwater cress]
ref|XP_003531486.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  69.7    7e-11   Glycine max [soybeans]
gb|EPS72023.1|  hypothetical protein M569_02734                       69.7    8e-11   Genlisea aurea
ref|XP_007149204.1|  hypothetical protein PHAVU_005G050400g           68.9    2e-10   Phaseolus vulgaris [French bean]
ref|XP_006305133.1|  hypothetical protein CARUB_v10009502mg           68.6    2e-10   
ref|NP_001077848.1|  mercaptopyruvate sulfurtransferase 1             67.8    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KCW71383.1|  hypothetical protein EUGRSUZ_F04458                   66.6    6e-10   Eucalyptus grandis [rose gum]
gb|KDO61602.1|  hypothetical protein CISIN_1g017338mg                 65.9    1e-09   Citrus sinensis [apfelsine]
ref|XP_011095713.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  65.9    1e-09   Sesamum indicum [beniseed]
ref|NP_563998.1|  thiosulfate/3-mercaptopyruvate sulfurtransferase 2  65.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00796.1|  thiosulfate sulfurtransferase like protein           65.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAD34697.1|AC006341_25  Similar to gb|AF109156 thiosulfate sul...  65.9    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849675.1|  thiosulfate/3-mercaptopyruvate sulfurtransferase 2  65.9    1e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAB88023.1|  3-mercaptopyruvate sulfurtransferase                 65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010497864.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  64.7    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_003637743.1|  Mercaptopyruvate sulfurtransferase-like protein  60.8    8e-08   
emb|CDX88520.1|  BnaC06g39640D                                        60.5    1e-07   
ref|XP_008787354.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  60.1    2e-07   Phoenix dactylifera
gb|EEC69648.1|  hypothetical protein OsI_39055                        59.7    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010669991.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  59.7    2e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001067237.1|  Os12g0608600                                     58.9    3e-07   
gb|EAY83836.1|  hypothetical protein OsI_39053                        58.9    3e-07   Oryza sativa Indica Group [Indian rice]
gb|EAZ21169.1|  hypothetical protein OsJ_36817                        58.9    4e-07   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA47453.1|  TPA: hypothetical protein ZEAMMB73_269466            58.2    5e-07   
ref|XP_008669586.1|  PREDICTED: uncharacterized protein LOC100275...  58.2    6e-07   
dbj|BAJ97390.1|  predicted protein                                    58.2    6e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008669588.1|  PREDICTED: uncharacterized protein LOC100275...  58.2    6e-07   Zea mays [maize]
dbj|BAJ87778.1|  predicted protein                                    58.2    7e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010923778.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  57.8    7e-07   Elaeis guineensis
ref|XP_003577689.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  57.8    8e-07   Brachypodium distachyon [annual false brome]
ref|XP_010237052.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  57.8    8e-07   Brachypodium distachyon [annual false brome]
ref|XP_008807177.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  57.4    1e-06   Phoenix dactylifera
ref|XP_004963128.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  57.4    1e-06   Setaria italica
ref|XP_010926888.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  56.2    2e-06   
ref|XP_010669992.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  56.2    3e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009393284.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  54.3    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419015.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  52.0    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN26865.1|  3-mercaptopyruvate sulfurtransferase                  52.0    8e-05   Glycine soja [wild soybean]
ref|XP_009419014.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  52.0    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK24999.1|  unknown                                               51.6    1e-04   Picea sitchensis
ref|XP_002956187.1|  hypothetical protein VOLCADRAFT_107126           51.6    1e-04   Volvox carteri f. nagariensis
ref|XP_008653485.1|  PREDICTED: uncharacterized protein LOC103633...  50.8    2e-04   
ref|XP_008653486.1|  PREDICTED: uncharacterized protein LOC103633...  50.8    2e-04   
ref|XP_008653484.1|  PREDICTED: uncharacterized protein LOC103633...  50.8    2e-04   
gb|AFW66412.1|  thiosulfate transferase                               49.7    5e-04   
ref|XP_004951799.1|  PREDICTED: thiosulfate/3-mercaptopyruvate su...  49.3    5e-04   Setaria italica
gb|AFW66409.1|  hypothetical protein ZEAMMB73_693495                  48.9    8e-04   
gb|AFW66411.1|  thiosulfate transferase                               48.9    9e-04   
ref|XP_008676730.1|  PREDICTED: hypothetical protein isoform X4       48.5    0.001   Zea mays [maize]



>gb|AII99843.1| thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial-like 
protein [Nicotiana tabacum]
Length=376

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 76/116 (66%), Gaps = 16/116 (14%)
 Frame = +3

Query  234  MASSVIARTLFATR----SVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQ  401
            MAS +++RTLFA R    S FY P              F S+F  +P YSQA+ ++ SY+
Sbjct  1    MASGLLSRTLFAHRFLKSSTFYKPQF------------FLSAFNKKPFYSQAAPTYFSYK  48

Query  402  VASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V  SV C +ASS  G + +FS  +++TNEPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  49   VVGSVTCCVASSRVGTRSTFSTLAVSTNEPVVSVDWLHANLKEPDVKVLDASWYMP  104



>ref|XP_009607756.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X2 [Nicotiana tomentosiformis]
Length=372

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 77/116 (66%), Gaps = 20/116 (17%)
 Frame = +3

Query  234  MASSVIARTLFATR----SVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQ  401
            MA+ +++RTLFA R    S FY P             QF   F+++P YSQA+ ++ SY+
Sbjct  1    MAAGLLSRTLFAHRLLKPSTFYKP-------------QF---FISKPFYSQAAPTYYSYK  44

Query  402  VASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V  SV C +ASS  G + +FS  +++TNEPVVSVDWLH  L++PDMKVLDASWYMP
Sbjct  45   VVGSVTCCVASSRIGIRTTFSTLAVSTNEPVVSVDWLHANLKNPDMKVLDASWYMP  100



>ref|XP_009791376.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Nicotiana sylvestris]
Length=376

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (65%), Gaps = 16/116 (14%)
 Frame = +3

Query  234  MASSVIARTLFATR----SVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQ  401
            MAS +++RTLFA R    S FY P              F S+F  +P YSQA+ ++ SY+
Sbjct  1    MASGLLSRTLFAHRFLKSSTFYKPQF------------FLSAFNKKPFYSQAAPTYFSYK  48

Query  402  VASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V  SV C + SS  G + +FS  +++TNEPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  49   VVGSVTCCVVSSRVGTRSTFSTLAVSTNEPVVSVDWLHANLKEPDVKVLDASWYMP  104



>ref|XP_009607755.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Nicotiana tomentosiformis]
Length=373

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 75/116 (65%), Gaps = 19/116 (16%)
 Frame = +3

Query  234  MASSVIARTLFATR----SVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQ  401
            MA+ +++RTLFA R    S FY P             QF  S   +P YSQA+ ++ SY+
Sbjct  1    MAAGLLSRTLFAHRLLKPSTFYKP-------------QFFIS--KKPFYSQAAPTYYSYK  45

Query  402  VASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V  SV C +ASS  G + +FS  +++TNEPVVSVDWLH  L++PDMKVLDASWYMP
Sbjct  46   VVGSVTCCVASSRIGIRTTFSTLAVSTNEPVVSVDWLHANLKNPDMKVLDASWYMP  101



>ref|XP_002264748.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial [Vitis vinifera]
 emb|CAN69823.1| hypothetical protein VITISV_030676 [Vitis vinifera]
 emb|CBI24191.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 75/113 (66%), Gaps = 8/113 (7%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLN-RPLYSQASFSHLSYQVAS  410
            MA+++ ARTLF  R +        SS  L++K Q  +SF N RP YS+ +  +L Y+ + 
Sbjct  1    MAAALFARTLFGNRLI-------RSSLALYQKPQIFTSFFNKRPFYSRPNAVYLVYRSSG  53

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
               C MASS SG + SFS  S++ NEPVVSVDWLH  +R+PD+KVLDASWYMP
Sbjct  54   FSTCAMASSTSGTRSSFSTQSVSPNEPVVSVDWLHANIREPDLKVLDASWYMP  106



>emb|CDP13580.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQ-FKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS+V+AR L + R      L  S+SS L RK   F S F  RP  S  + SH SY  ++
Sbjct  1    MASAVLARALSSHRF-----LVQSTSSPLSRKTHLFTSFFSKRPFNSDPASSHWSYNKST  55

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            ++ CRM SS++ +Q+SFS  SL   EPVVSVDWLH  LR+PDMKVLDASWYMP
Sbjct  56   TLFCRMVSSVAASQVSFSNMSLHPTEPVVSVDWLHANLREPDMKVLDASWYMP  108



>gb|KDP25080.1| hypothetical protein JCGZ_22615 [Jatropha curcas]
Length=376

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 72/113 (64%), Gaps = 8/113 (7%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQ-FKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS+V  RTL   R V        SS TL  K Q F S F  RP + QA   + S++ + 
Sbjct  1    MASAVFTRTLLGHRFVH-------SSRTLSHKTQLFTSLFNKRPFHVQADPLYTSHRTSG  53

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V+  MASS+ G + +FS  SL+TNEPVVSVDWLH  LR+PDMKVLDASWYMP
Sbjct  54   WVSRVMASSVVGTKANFSTQSLSTNEPVVSVDWLHANLREPDMKVLDASWYMP  106



>ref|XP_009341701.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Pyrus x bretschneideri]
Length=381

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVAS  410
            MASS+ ARTL   R      L  SSS +L +K QF +S +++   + QA  ++  Y+ ++
Sbjct  1    MASSLFARTLLGHR------LFHSSSHSLCQKPQFFTSLVHKGAEFLQAKPAYTKYRTSA  54

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS++GA+  FS  S++TNEPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  55   RVPHVMASSVAGARADFSTQSVSTNEPVVSVDWLHANLKEPDLKVLDASWYMP  107



>ref|XP_007211437.1| hypothetical protein PRUPE_ppa007180mg [Prunus persica]
 gb|EMJ12636.1| hypothetical protein PRUPE_ppa007180mg [Prunus persica]
Length=379

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVAS  410
            MASS+  RTL     +F+     S+S +L +K Q  SS  NR + + +A  ++  Y+ + 
Sbjct  1    MASSLFTRTLLGHHRLFH-----SASHSLCQKPQIFSSLFNRGIEHLRADPAYTKYKASG  55

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS++GA+  F+  S++TNEPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  56   WVPRAMASSVAGARAEFTTQSVSTNEPVVSVDWLHANLKEPDLKVLDASWYMP  108



>ref|XP_008226128.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial [Prunus mume]
Length=379

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVAS  410
            MASS+  RTL     +F+     S+S +L +K Q  SS  +R + + +A  ++  Y+ + 
Sbjct  1    MASSLFTRTLLGHHRLFH-----SASHSLCQKPQILSSLFSRGIAHLRADPAYTKYKASG  55

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS++GA+  F+  S++TNEPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  56   WVPRAMASSVAGARAEFTTQSVSTNEPVVSVDWLHANLKEPDLKVLDASWYMP  108



>gb|EYU33788.1| hypothetical protein MIMGU_mgv1a008159mg [Erythranthe guttata]
 gb|EYU33789.1| hypothetical protein MIMGU_mgv1a008159mg [Erythranthe guttata]
Length=383

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 70/112 (63%), Gaps = 1/112 (1%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS V++R LFA RS+ +   SSSS      +  F S F   P       SHL  +   S
Sbjct  1    MASGVLSRVLFARRSLQFLSPSSSSLLFQQSRF-FSSVFGKIPFRPWPVSSHLVSKNPGS  59

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V+C M+SS   +Q SFS  SL+ NEPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  60   VSCNMSSSAVASQDSFSVQSLSANEPVVSVDWLHANLREPDVKVLDASWYMP  111



>ref|XP_008383139.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Malus domestica]
Length=381

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 76/113 (67%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVAS  410
            MASS+ ARTL   R      L  SSS +L +K QF +S +++   + +A  ++  Y+ ++
Sbjct  1    MASSLFARTLLGHR------LFHSSSHSLCQKPQFFTSLVHKGTEFLRAKPAYTKYRTSA  54

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS++G +  FS  S++TNEPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  55   WVPHVMASSVAGTRADFSTQSVSTNEPVVSVDWLHANLKEPDLKVLDASWYMP  107



>ref|XP_002513368.1| thiosulfate sulfertansferase, putative [Ricinus communis]
 gb|EEF48771.1| thiosulfate sulfertansferase, putative [Ricinus communis]
Length=376

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQ-FKSSFLNRPLYSQASFSHLSYQVAS  410
            MA++   RTL   R +         S +L  K+Q F S F  RP Y +A   H S++ + 
Sbjct  1    MAAAAFTRTLLGHRFIH-------CSQSLSLKIQTFPSLFNKRPFYIRADPVHTSHRTSG  53

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   +AS++ G + S+S  SL  NEPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  54   WVPRVIASTMVGTKASYSTQSLPANEPVVSVDWLHANLREPDLKVLDASWYMP  106



>ref|XP_008372008.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Malus domestica]
Length=381

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 74/113 (65%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVAS  410
            MASS+ ARTL   R      L  SSS +L +K QF +S  N+   +  A  ++  Y+ ++
Sbjct  1    MASSLFARTLLGHR------LFHSSSHSLCQKPQFFTSLFNKGTEHFXADPTYRXYRTSA  54

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS++GA+  FS  S++T EPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  55   WVPRVMASSVAGARADFSTQSVSTKEPVVSVDWLHANLKEPDLKVLDASWYMP  107



>ref|XP_009777861.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like 
[Nicotiana sylvestris]
Length=379

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFK-SSFLNRPLYSQASFSHLSYQVAS  410
            MAS+V++++LFA R      L SSS+S L    +F  S+F  +P + QA+  + S +V  
Sbjct  1    MASAVLSKSLFANRF-----LKSSSTSFLCPNPRFSLSAFTRKPFHLQAAPIYYSNKVID  55

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            S   RMASS  GAQ SFS  +++TNE VVSVDWLH  LRDPD+KVLDASWY+P
Sbjct  56   SF-TRMASSTVGAQPSFSTLAMSTNESVVSVDWLHANLRDPDLKVLDASWYLP  107



>ref|XP_009361846.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Pyrus x bretschneideri]
Length=381

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVAS  410
            MASS+ ARTL   R      L  SS  +L +K QF +S  N+   + +A  ++  Y+ ++
Sbjct  1    MASSLFARTLLGHR------LFHSSPHSLCQKPQFFTSLFNKGTEHFRADPTYTKYRTSA  54

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             +   MASS++GA+  F+  S++T EPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  55   WIPRVMASSVAGARADFTTQSVSTKEPVVSVDWLHANLKEPDLKVLDASWYMP  107



>ref|XP_009587459.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=354

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 78/113 (69%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFK-SSFLNRPLYSQASFSHLSYQVAS  410
            MAS+V++++LFA R      L SSS+S L  K +F  S+F  +P + QA+  + S +V  
Sbjct  1    MASAVLSKSLFAYRF-----LKSSSTSLLCPKPRFSLSAFTRKPFHLQAAPIYYSNKVID  55

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            S   RMASS  GAQ SFS  +++TNE VVSVDWLH  LR+PD+KVLDASWY+P
Sbjct  56   SF-TRMASSTVGAQPSFSTLAMSTNESVVSVDWLHANLREPDLKVLDASWYLP  107



>gb|KFK42300.1| hypothetical protein AALP_AA2G238100 [Arabis alpina]
Length=381

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS++ +R+  A    F  PL         + L F +S   R  YSQ S S  +   ++S
Sbjct  1    MASTLFSRSFLAASHRFITPLLPQ------KSLTFAASLSKRAFYSQLSGSGSTVYNSTS  54

Query  414  VACR-MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             A R MAS+  G+++ +S +S +TNEPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  55   WARRAMASTGVGSKVGYSTSSASTNEPVVSVDWLHANLKEPDLKVLDASWYMP  107



>ref|XP_008364248.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Malus domestica]
Length=381

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVAS  410
            MASS+ ARTL   R         SSS +L +K QF +S  N+   +  A  ++  Y+ ++
Sbjct  1    MASSLFARTLLGHRLX------HSSSHSLCQKPQFFTSLFNKGTEHFXADXTYXXYRTSA  54

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS++GA+  FS  S++T EPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  55   WVPRVMASSVAGARADFSTQSVSTKEPVVSVDWLHANLKEPDLKVLDASWYMP  107



>ref|XP_004306581.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Fragaria vesca subsp. vesca]
Length=380

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 11/115 (10%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRP---LYSQASFSHLSYQV  404
            MAS++ ARTL   R      L  SS+  L +K Q  +S LN+    L + ++F+   Y++
Sbjct  1    MASALFARTLLGHR------LFHSSARPLSQKPQILTSLLNKGSDLLRADSTFT--KYRI  52

Query  405  ASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +  V   MAS+++G +  FS  S +TNEPVVSVDWLH  L++PD+KV+DASWYMP
Sbjct  53   SGLVPRVMASTVAGVKADFSTQSASTNEPVVSVDWLHANLKEPDLKVVDASWYMP  107



>ref|XP_008356158.1| PREDICTED: uncharacterized protein LOC103419846 [Malus domestica]
Length=502

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVAS  410
            MASS+ ARTL   R         SSS +L +K QF +S  N+   +  A  ++  Y+ ++
Sbjct  1    MASSLFARTLLGHRLX------HSSSHSLCQKPQFFTSLFNKGTEHFXADXTYXXYRTSA  54

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS++GA+  FS  S++T EPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  55   WVPRVMASSVAGARADFSTQSVSTKEPVVSVDWLHANLKEPDLKVLDASWYMP  107



>ref|XP_004232812.2| PREDICTED: LOW QUALITY PROTEIN: thiosulfate/3-mercaptopyruvate 
sulfurtransferase 1, mitochondrial [Solanum lycopersicum]
Length=368

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +3

Query  324  RKLQFKSSFLN---RPLYSQASFSHLSYQVASSVACRMASSLSGAQISFSPASLTTNEPV  494
            RK++   +  N   +P  S A+ ++  Y+V       MASS+ GAQ SFS  +++TNEPV
Sbjct  14   RKIETTQTNTNGGRKPFRSLAAPTYXIYKVKGYFTRCMASSMVGAQPSFSTLAISTNEPV  73

Query  495  VSVDWLHTKLRDPDMKVLDASWYMP  569
            VSVDWLH  +RDPD+KVLDASWYMP
Sbjct  74   VSVDWLHANIRDPDLKVLDASWYMP  98



>ref|XP_007022597.1| Mercaptopyruvate sulfurtransferase 1 isoform 2 [Theobroma cacao]
 gb|EOY14122.1| Mercaptopyruvate sulfurtransferase 1 isoform 2 [Theobroma cacao]
Length=376

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 7/112 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MASS+++RTL   R      L   SSS   + L F S F  R L+ QA  ++  Y+ +  
Sbjct  1    MASSLLSRTLLGHR------LGQFSSSLTHKPLIFSSLFNTRQLHVQAEPTYTPYKTSGR  54

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             +  MAS++   +I+FS  SL+TN+ VVSVDWLH  LR+PDMKVLDASWYMP
Sbjct  55   PSRFMASAID-RRINFSTQSLSTNDTVVSVDWLHANLREPDMKVLDASWYMP  105



>ref|XP_010243916.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Nelumbo nucifera]
Length=375

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 9/113 (8%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYS-QASFSHLSYQVAS  410
            MAS ++ R+L   R++        SS    +K Q  SSF+NR  +  Q   S L   +  
Sbjct  1    MASPLLRRSLGGLRAI-------RSSIAYSQKPQIYSSFVNRNAFCRQVDISSLLPNIGL  53

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +  C MASS+SG++ +FS  S++T EPVVSVDWLH  LR PD+KVLDASWYMP
Sbjct  54   A-RCAMASSISGSKAAFSTQSVSTKEPVVSVDWLHANLRVPDVKVLDASWYMP  105



>gb|AAD19957.1| thiosulfate sulfurtransferase [Datisca glomerata]
Length=375

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 72/115 (63%), Gaps = 12/115 (10%)
 Frame = +3

Query  234  MASSVIARTLFATRSV---FYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQV  404
            MAS++ ++ L  +R +   FY      S ++LF K QF     + P Y+       +Y+ 
Sbjct  1    MASTLFSKALSGSRLIRPSFYLTNYPQSFTSLFNKRQFH--LRSNPAYT-------AYKT  51

Query  405  ASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +  ++  MASS++G ++ FS  SL TNEPVVS DWLH+ L++PD++VLDASWYMP
Sbjct  52   SDRISSVMASSVAGTRLEFSTQSLPTNEPVVSADWLHSNLKEPDLRVLDASWYMP  106



>gb|KJB83963.1| hypothetical protein B456_013G142500 [Gossypium raimondii]
Length=376

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 68/112 (61%), Gaps = 7/112 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MASS+++RTL   R + +       SS+L       S+  NR    QA   H +Y+ +  
Sbjct  1    MASSLLSRTLLGHRLIRF-------SSSLPHNPLIFSNLFNREFCVQAESYHTTYKASGQ  53

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             +  MAS+    + +FS  SL+TN+PVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  54   PSRLMASAAIEIRSNFSTQSLSTNDPVVSVDWLHANLREPDLKVLDASWYMP  105



>gb|KJB83962.1| hypothetical protein B456_013G142500 [Gossypium raimondii]
Length=378

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MASS+++RTL   R + +      SSS     L F + F  R    QA   H +Y+ +  
Sbjct  1    MASSLLSRTLLGHRLIRF------SSSLPHNPLIFSNLFNKREFCVQAESYHTTYKASGQ  54

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             +  MAS+    + +FS  SL+TN+PVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  55   PSRLMASAAIEIRSNFSTQSLSTNDPVVSVDWLHANLREPDLKVLDASWYMP  106



>gb|KJB83961.1| hypothetical protein B456_013G142500 [Gossypium raimondii]
Length=377

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MASS+++RTL   R + +      SSS     L F + F  R    QA   H +Y+ +  
Sbjct  1    MASSLLSRTLLGHRLIRF------SSSLPHNPLIFSNLFNKREFCVQAESYHTTYKASGQ  54

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             +  MAS+    + +FS  SL+TN+PVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  55   PSRLMASAAIEIRSNFSTQSLSTNDPVVSVDWLHANLREPDLKVLDASWYMP  106



>ref|XP_011022084.1| PREDICTED: LOW QUALITY PROTEIN: thiosulfate/3-mercaptopyruvate 
sulfurtransferase 1, mitochondrial [Populus euphratica]
Length=372

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 66/112 (59%), Gaps = 7/112 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS+++   L+  R +        SS +L     F S F  R  + +A   H SYQ +  
Sbjct  1    MASTIVTNNLWGNRLI-------RSSVSLXSPQIFISLFTGRLFHPRADPFHASYQTSQW  53

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +    ASS+ G + +FS  SL+ NEPVVSVDWLH  LR+P++KVLDASWYMP
Sbjct  54   IPRVTASSVVGTRPNFSTQSLSMNEPVVSVDWLHANLREPNLKVLDASWYMP  105



>ref|XP_006305135.1| hypothetical protein CARUB_v10009502mg [Capsella rubella]
 gb|EOA38033.1| hypothetical protein CARUB_v10009502mg [Capsella rubella]
Length=311

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 76/113 (67%), Gaps = 4/113 (4%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYS-QASFSHLSYQVAS  410
            MAS++ +R+L   R   + P   S S  L ++ +  ++FLN+  +S Q   ++ +Y+ ++
Sbjct  1    MASTLYSRSLLVARHCLFNP---SLSPILPQRTRHFATFLNKKAFSLQLHSAYSTYKSSA  57

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V+  MAS+ +G + +++ +S++T+EPVVSVDWLH  LR  D+KVLDASWYMP
Sbjct  58   HVSRVMASTGAGPKANYATSSISTDEPVVSVDWLHANLRGADIKVLDASWYMP  110



>gb|ACI96074.1| mercaptopyruvate sulfurtransferase 1 [Brassica rapa subsp. pekinensis]
Length=379

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 73/115 (63%), Gaps = 14/115 (12%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHL-SYQVA  407
            MAS++ +RT L AT  +  P L       L +K    +SFL R ++    FS L SY  A
Sbjct  1    MASTLFSRTFLAATHRLITPSL-------LPQKPLHLASFLTRRVF----FSQLGSYSTA  49

Query  408  SSVACRMASSLSGAQISFSPAS-LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
               A  MAS+ +GA+  +S +S + TNEPVVSVDWLH+ LR+PD+KVLDASWYMP
Sbjct  50   YRSARAMASAGTGARAGYSTSSSVATNEPVVSVDWLHSNLREPDLKVLDASWYMP  104



>ref|XP_006302392.1| hypothetical protein CARUB_v10020460mg [Capsella rubella]
 gb|EOA35290.1| hypothetical protein CARUB_v10020460mg [Capsella rubella]
Length=383

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++ +R+ L A+  +  PPLSS    T F    F S    R  YS    +  +Y+  +
Sbjct  1    MASTLFSRSFLAASHRLITPPLSSRLPQTTFSSAAFLS---KRSFYSHLGVASTAYKSTT  57

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                 MA +  G +  +S +S++T+EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  58   WARRAMALAGVGTKAGYSTSSISTSEPVVSVDWLHANLREPDLKVLDASWYMP  110



>gb|ACN58229.1| thiosulfate:cyanide sulfurtransferase-like protein [Solanum lycopersicum]
Length=318

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MASS+ GAQ SFS  +++TNEPVVSVDWLH  +RDPD+KVLDASWYMP
Sbjct  1    MASSMVGAQPSFSTLAISTNEPVVSVDWLHANIRDPDLKVLDASWYMP  48



>emb|CAB64716.1| 3-mercaptopyruvate sulfurtransferase [Arabidopsis thaliana]
Length=378

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 69/112 (62%), Gaps = 7/112 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS++ +RT  A       P       +L +K+   ++FL+R L+SQ   +  +Y+  + 
Sbjct  1    MASTLFSRTFLAASHRLITP-------SLPQKIFNPATFLSRSLHSQLGSASTAYKSTTW  53

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                MAS+    +  +S +S++T+EPVVSVDWLH  LR+PD+K+LDASWYMP
Sbjct  54   ARRAMASTGVETKAGYSTSSVSTSEPVVSVDWLHANLREPDLKILDASWYMP  105



>ref|NP_565203.1| mercaptopyruvate sulfurtransferase 1 [Arabidopsis thaliana]
 sp|O64530.1|STR1_ARATH RecName: Full=Thiosulfate/3-mercaptopyruvate sulfurtransferase 
1, mitochondrial; AltName: Full=AtMST1; AltName: Full=Rhodanese 
homolog protein 1; Short=AtRDH1; AltName: Full=Sulfurtransferase 
1; Short=AtStr1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17062.1| Similar to E. coli sulfurtransferase (rhodanese) gb|AE00338. 
ESTs gb|T03984, gb|T03983 and gb|W43228 come from this gene 
[Arabidopsis thaliana]
 emb|CAB55306.1| thiosulfate sulfurtransferase [Arabidopsis thaliana]
 dbj|BAA85148.1| mercaptopyruvate sulfurtransferase [Arabidopsis thaliana]
 gb|AAL77692.1| At1g79230/YUP8H12R_39 [Arabidopsis thaliana]
 gb|AAM64695.1| mercaptopyruvate sulfurtransferase (Mst1/Rdh1) [Arabidopsis thaliana]
 dbj|BAC42830.1| putative mercaptopyruvate sulfurtransferase [Arabidopsis thaliana]
 gb|ABG48385.1| At1g79230 [Arabidopsis thaliana]
 gb|AEE36219.1| mercaptopyruvate sulfurtransferase 1 [Arabidopsis thaliana]
Length=379

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 69/112 (62%), Gaps = 7/112 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS++ +RT  A       P       +L +K+   ++FL+R L+SQ   +  +Y+  + 
Sbjct  1    MASTLFSRTFLAASHRLITP-------SLPQKIFNPATFLSRSLHSQLGSASTAYKSTTW  53

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                MAS+    +  +S +S++T+EPVVSVDWLH  LR+PD+K+LDASWYMP
Sbjct  54   ARRAMASTGVETKAGYSTSSVSTSEPVVSVDWLHANLREPDLKILDASWYMP  105



>ref|XP_007022596.1| Mercaptopyruvate sulfurtransferase 1 isoform 1 [Theobroma cacao]
 gb|EOY14121.1| Mercaptopyruvate sulfurtransferase 1 isoform 1 [Theobroma cacao]
Length=378

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 71/114 (62%), Gaps = 9/114 (8%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSF--LNRPLYSQASFSHLSYQVA  407
            MASS+++RTL   R      L   SSS   + L F S F    R L+ QA  ++  Y+ +
Sbjct  1    MASSLLSRTLLGHR------LGQFSSSLTHKPLIFSSLFNLQTRQLHVQAEPTYTPYKTS  54

Query  408  SSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
               +  MAS++   +I+FS  SL+TN+ VVSVDWLH  LR+PDMKVLDASWYMP
Sbjct  55   GRPSRFMASAID-RRINFSTQSLSTNDTVVSVDWLHANLREPDMKVLDASWYMP  107



>ref|XP_002887774.1| hypothetical protein ARALYDRAFT_895827 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64033.1| hypothetical protein ARALYDRAFT_895827 [Arabidopsis lyrata subsp. 
lyrata]
Length=379

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 69/112 (62%), Gaps = 7/112 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS++ +R+  A       P       +L +K+   ++FL+R  YSQ   +  +Y+ ++ 
Sbjct  1    MASTLFSRSFLAASHRMITP-------SLPQKIFSPATFLSRSFYSQLGTASTAYKSSTW  53

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                MAS+    +  +S +S++T+EPVVSVDWLH  LR+PD+K+LDASWYMP
Sbjct  54   ARRAMASTGVETKAGYSTSSISTSEPVVSVDWLHANLREPDLKILDASWYMP  105



>ref|XP_006416816.1| hypothetical protein EUTSA_v10007910mg [Eutrema salsugineum]
 gb|ESQ35169.1| hypothetical protein EUTSA_v10007910mg [Eutrema salsugineum]
Length=383

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = +3

Query  234  MASSVIARTLF-ATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQA--SFSHLSYQV  404
            MAS++ +RTL  A   V  P L+S     L +K    ++ LN+ +++Q   S ++ +Y+ 
Sbjct  1    MASTLFSRTLLVAGHCVINPSLTSM----LPQKTCTFATILNKRVFNQQLPSAAYSAYKS  56

Query  405  ASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            ++ V   MAS+  G +  +S +S+++NEPVVSVDWLH+ LR+ D+KVLDASWYMP
Sbjct  57   STYVGRVMASTRVGPKAGYSTSSVSSNEPVVSVDWLHSNLREGDIKVLDASWYMP  111



>ref|XP_006347118.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Solanum tuberosum]
Length=318

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MASS  GAQ SFS  +++TNEPVVSVDWLH  +RDPD+KVLDASWYMP
Sbjct  1    MASSTVGAQPSFSTLAISTNEPVVSVDWLHANIRDPDLKVLDASWYMP  48



>ref|XP_010537790.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Tarenaya hassleriana]
Length=385

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = +3

Query  234  MASSVIARTL-FATRSVFYPPLssssssTLFRKLQFKSSFLN-RPLYSQASFSHLSYQVA  407
            MAS++ +RT   A   +  P LS          L F    LN R  YSQ   +  +Y+  
Sbjct  1    MASALFSRTFSAAGHRLVSPSLSFLLPQKTTSNLAF---ILNSRAFYSQRGSTFTTYKSF  57

Query  408  SSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +     MAS+  G +  +S +S+T+NEPVVSVDWLH+ LR+PD+KVLDASWYMP
Sbjct  58   AWAGRVMASAGVGQKAGYSTSSITSNEPVVSVDWLHSNLREPDLKVLDASWYMP  111



>ref|XP_002892908.1| hypothetical protein ARALYDRAFT_471843 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69167.1| hypothetical protein ARALYDRAFT_471843 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MASS SGA+++++ +S++TNEPVVSVDWLH+ LRD D+KVLDASWYMP
Sbjct  1    MASSGSGAKVNYATSSISTNEPVVSVDWLHSNLRDADIKVLDASWYMP  48



>gb|ACO57704.1| mercapto-pyruvate sulfurtransferase 1 [Chrysanthemum x morifolium]
Length=379

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 71/115 (62%), Gaps = 14/115 (12%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHL-SYQVA  407
            MAS++ +RT L AT  +  P L       L +K    +SFL R    +  FS L SY  A
Sbjct  1    MASTLFSRTFLAATHRLITPSL-------LPQKPLHLASFLTR----RGFFSQLGSYSTA  49

Query  408  SSVACRMASSLSGAQISFSPAS-LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
               A  MAS+  GA+  +S +S + TNEPVVSVDWLH+ LR+PD+KVLDASWYMP
Sbjct  50   YRSARAMASAGIGARAGYSTSSSVATNEPVVSVDWLHSNLREPDLKVLDASWYMP  104



>ref|XP_009104542.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Brassica rapa]
 emb|CDX68002.1| BnaA07g20420D [Brassica napus]
Length=379

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 71/115 (62%), Gaps = 14/115 (12%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHL-SYQVA  407
            MAS++ +RT L AT  +  P L       L +K    +SFL R    +  FS L SY  A
Sbjct  1    MASTLFSRTFLAATHRLITPSL-------LPQKPLHLASFLTR----RGFFSQLGSYSTA  49

Query  408  SSVACRMASSLSGAQISFSPAS-LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
               A  MAS+  GA+  +S +S + TNEPVVSVDWLH+ LR+PD+KVLDASWYMP
Sbjct  50   YRSARAMASAGIGARAGYSTSSSVATNEPVVSVDWLHSNLREPDLKVLDASWYMP  104



>emb|CDX79307.1| BnaC06g19960D [Brassica napus]
Length=379

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 67/114 (59%), Gaps = 12/114 (11%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++ +RT L A+  +  P L         + L   S    R L+SQ      SY  A 
Sbjct  1    MASTLFSRTFLAASHRLITPSLLPQ------KTLNLASFLTRRGLFSQLG----SYSTAY  50

Query  411  SVACRMASSLSGAQISFSPAS-LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
              A  MAS+  GA+  FS +S + TNEPVVSVDWLH+ LR+PD+KVLDASWYMP
Sbjct  51   RSARAMASAGIGARAGFSTSSSVPTNEPVVSVDWLHSNLREPDLKVLDASWYMP  104



>gb|ABK94242.1| unknown [Populus trichocarpa]
Length=372

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 63/112 (56%), Gaps = 10/112 (9%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS+++ ++L   R +      S  +  +F  L     F  R    +A   H SY+ +  
Sbjct  1    MASTILTKSLLGHRLIHSSFSLSHKTPQIFTSL-----FPGRTFQKRADPIHTSYKPSQW  55

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V C     + G + +FS  SL+ NEPVVSVDWLH  LR+PDMKVLDASWYMP
Sbjct  56   VRC-----VVGTRANFSTQSLSLNEPVVSVDWLHANLREPDMKVLDASWYMP  102



>gb|KDO61605.1| hypothetical protein CISIN_1g017338mg [Citrus sinensis]
Length=270

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 16/115 (14%)
 Frame = +3

Query  234  MASSVIARTLFATR-SVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVA  407
            MASS+  R L  +  S+ Y P             Q  +S LN+ L YS+   +H + + +
Sbjct  1    MASSLFTRRLVHSSFSISYKP-------------QVFTSLLNKKLFYSRPKHTHTTLKTS  47

Query  408  SSVA-CRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            SS + C M+S  +G +  +S  S++  EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  48   SSQSPCVMSSLAAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMP  102



>gb|KDO61604.1| hypothetical protein CISIN_1g017338mg [Citrus sinensis]
Length=269

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 16/115 (14%)
 Frame = +3

Query  234  MASSVIARTLFATR-SVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVA  407
            MASS+  R L  +  S+ Y P             Q  +S LN+ L YS+   +H + + +
Sbjct  1    MASSLFTRRLVHSSFSISYKP-------------QVFTSLLNKKLFYSRPKHTHTTLKTS  47

Query  408  SSVA-CRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            SS + C M+S  +G +  +S  S++  EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  48   SSQSPCVMSSLAAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMP  102



>ref|XP_004149966.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Cucumis sativus]
Length=377

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 72/115 (63%), Gaps = 12/115 (10%)
 Frame = +3

Query  234  MASSVIARTLFATR---SVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQV  404
            MAS++++RTL   R   S+ +P   +    ++F K  F+     RP     + + ++Y  
Sbjct  1    MASTLLSRTLLVNRFAHSISFPSGKTQILPSVFSKKLFQF----RP-----NSASVAYNP  51

Query  405  ASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                +  MASS++GA+  FS  SL+T++P+VS DWLH+ L++PD+KVLDASWYMP
Sbjct  52   TRRFSSFMASSVAGAKAHFSSKSLSTDDPIVSPDWLHSNLKEPDLKVLDASWYMP  106



>ref|XP_004160468.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Cucumis sativus]
Length=377

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 72/115 (63%), Gaps = 12/115 (10%)
 Frame = +3

Query  234  MASSVIARTLFATR---SVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQV  404
            MAS++++RTL   R   S+ +P   +    ++F K  F+     RP     + + ++Y  
Sbjct  1    MASTLLSRTLLVNRFAHSISFPSGKTQILPSVFSKKLFQF----RP-----NSASVAYNP  51

Query  405  ASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                +  MASS++GA+  FS  SL+T++P+VS DWLH+ L++PD+KVLDASWYMP
Sbjct  52   TRRFSSFMASSVAGAKAHFSSKSLSTDDPIVSPDWLHSNLKEPDLKVLDASWYMP  106



>ref|XP_010324183.1| PREDICTED: mercaptopyruvate sulfurtransferase-like protein isoform 
X1 [Solanum lycopersicum]
Length=375

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 4/79 (5%)
 Frame = +3

Query  336  FKSSF-LNRPLYSQASFSHLSYQVASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWL  512
            F SSF   +  Y Q++ ++ SY++ +SV CRM SS      +FS  S+++NEPVVSVDWL
Sbjct  28   FSSSFNQKKTFYYQSAPTYFSYKLVASVTCRMNSSRLA---TFSTQSVSSNEPVVSVDWL  84

Query  513  HTKLRDPDMKVLDASWYMP  569
            H  L+ P +KVLDASWYMP
Sbjct  85   HANLKQPHIKVLDASWYMP  103



>ref|XP_010324184.1| PREDICTED: mercaptopyruvate sulfurtransferase-like protein isoform 
X2 [Solanum lycopersicum]
Length=370

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = +3

Query  348  FLNRPLYSQASFSHLSYQVASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLR  527
            F ++  Y Q++ ++ SY++ +SV CRM SS      +FS  S+++NEPVVSVDWLH  L+
Sbjct  28   FSSKTFYYQSAPTYFSYKLVASVTCRMNSSRLA---TFSTQSVSSNEPVVSVDWLHANLK  84

Query  528  DPDMKVLDASWYMP  569
             P +KVLDASWYMP
Sbjct  85   QPHIKVLDASWYMP  98



>ref|XP_007211436.1| hypothetical protein PRUPE_ppa007180mg [Prunus persica]
 gb|EMJ12635.1| hypothetical protein PRUPE_ppa007180mg [Prunus persica]
Length=319

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MASS++GA+  F+  S++TNEPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  1    MASSVAGARAEFTTQSVSTNEPVVSVDWLHANLKEPDLKVLDASWYMP  48



>gb|KDO61603.1| hypothetical protein CISIN_1g017338mg [Citrus sinensis]
Length=349

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = +3

Query  327  KLQFKSSFLNRPL-YSQASFSHLSYQVASSVA-CRMASSLSGAQISFSPASLTTNEPVVS  500
            K Q  +S LN+ L YS+   +H + + +SS + C M+S  +G +  +S  S++  EPVVS
Sbjct  20   KPQVFTSLLNKKLFYSRPKHTHTTLKTSSSQSPCVMSSLAAGRRADYSTLSVSPKEPVVS  79

Query  501  VDWLHTKLRDPDMKVLDASWYMP  569
            VDWLH  LR+PD+KVLDASWYMP
Sbjct  80   VDWLHANLREPDLKVLDASWYMP  102



>ref|XP_006475339.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X2 [Citrus sinensis]
 gb|KDO61600.1| hypothetical protein CISIN_1g017338mg [Citrus sinensis]
Length=372

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 16/115 (14%)
 Frame = +3

Query  234  MASSVIARTLFATR-SVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVA  407
            MASS+  R L  +  S+ Y P             Q  +S LN+ L YS+   +H + + +
Sbjct  1    MASSLFTRRLVHSSFSISYKP-------------QVFTSLLNKKLFYSRPKHTHTTLKTS  47

Query  408  SSVA-CRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            SS + C M+S  +G +  +S  S++  EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  48   SSQSPCVMSSLAAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMP  102



>ref|XP_006422246.1| hypothetical protein CICLE_v10005196mg [Citrus clementina]
 ref|XP_006475338.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR35486.1| hypothetical protein CICLE_v10005196mg [Citrus clementina]
 gb|KDO61601.1| hypothetical protein CISIN_1g017338mg [Citrus sinensis]
Length=373

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 16/115 (14%)
 Frame = +3

Query  234  MASSVIARTLFATR-SVFYPPLssssssTLFRKLQFKSSFLNRPL-YSQASFSHLSYQVA  407
            MASS+  R L  +  S+ Y P             Q  +S LN+ L YS+   +H + + +
Sbjct  1    MASSLFTRRLVHSSFSISYKP-------------QVFTSLLNKKLFYSRPKHTHTTLKTS  47

Query  408  SSVA-CRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            SS + C M+S  +G +  +S  S++  EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  48   SSQSPCVMSSLAAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMP  102



>ref|XP_002310670.2| hypothetical protein POPTR_0007s08020g [Populus trichocarpa]
 gb|EEE91120.2| hypothetical protein POPTR_0007s08020g [Populus trichocarpa]
Length=248

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 62/112 (55%), Gaps = 10/112 (9%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS+++ ++L   R +      S  +  +F  L     F  R    +A   H SY+ +  
Sbjct  1    MASTILTKSLLGHRLIHSSFSLSHKTPQIFTSL-----FPGRTFQKRADPIHTSYKPSQW  55

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V C     + G + +FS  SL+ NEPVV VDWLH  LR+PDMKVLDASWYMP
Sbjct  56   VRC-----VVGTRANFSTQSLSLNEPVVFVDWLHANLREPDMKVLDASWYMP  102



>gb|KGN57573.1| hypothetical protein Csa_3G215610 [Cucumis sativus]
Length=469

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 72/115 (63%), Gaps = 12/115 (10%)
 Frame = +3

Query  234  MASSVIARTLFATR---SVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQV  404
            MAS++++RTL   R   S+ +P   +    ++F K  F+     RP     + + ++Y  
Sbjct  93   MASTLLSRTLLVNRFAHSISFPSGKTQILPSVFSKKLFQF----RP-----NSASVAYNP  143

Query  405  ASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                +  MASS++GA+  FS  SL+T++P+VS DWLH+ L++PD+KVLDASWYMP
Sbjct  144  TRRFSSFMASSVAGAKAHFSSKSLSTDDPIVSPDWLHSNLKEPDLKVLDASWYMP  198



>gb|ACT33453.1| mercapto-pyruvate sulfurtransferase 1 [Brassica napus]
Length=379

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 66/114 (58%), Gaps = 12/114 (11%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++ +RT L A+  +  P L         + L   S    R L+SQ      SY  A 
Sbjct  1    MASTLFSRTFLAASHRLITPSLLPQ------KTLNLASFLTRRGLFSQLG----SYSTAY  50

Query  411  SVACRMASSLSGAQISFSPAS-LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
              A  MAS+  GA+  FS +S + TNEPVVS DWLH+ LR+PD+KVLDASWYMP
Sbjct  51   RSARAMASAGIGARAGFSTSSSVPTNEPVVSADWLHSNLREPDLKVLDASWYMP  104



>ref|XP_008346125.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Malus domestica]
Length=225

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MASS++GA+  FS  S++T EPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  1    MASSVAGARADFSTQSVSTKEPVVSVDWLHANLKEPDLKVLDASWYMP  48



>emb|CDX87398.1| BnaA07g34750D [Brassica napus]
Length=375

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (63%), Gaps = 17/115 (15%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++ +R  L A+R +  P L   ++  L       ++FL++    ++ FS L    AS
Sbjct  1    MASTLFSRAFLAASRRLITPSLLPETTLNL-------AAFLSK----RSFFSQLG---AS  46

Query  411  SVACR--MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            S   R  MASS  G +  ++ +S+ TNEPVVSVDWLH+ LR+PD+KVLDASWYMP
Sbjct  47   STWARRAMASSGVGGKAGYATSSVPTNEPVVSVDWLHSNLREPDLKVLDASWYMP  101



>ref|XP_009106646.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial [Brassica rapa]
Length=375

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 69/115 (60%), Gaps = 17/115 (15%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFL-NRPLYSQASFSHLSYQVA  407
            MAS++ +R  L A+R +  P L   ++  L       ++FL  R  YSQ           
Sbjct  1    MASTLFSRAFLAASRRLITPSLLPETTLNL-------AAFLSKRSFYSQLG-------AP  46

Query  408  SSVACR-MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            S+ A R MASS  G +  +S +S+ TNEPVVSVDWLH+ LR+PD+KVLDASWYMP
Sbjct  47   STWARRAMASSGVGGKAGYSTSSVPTNEPVVSVDWLHSNLREPDLKVLDASWYMP  101



>ref|NP_001234274.1| mercaptopyruvate sulfurtransferase-like protein [Solanum lycopersicum]
 gb|ACN58228.1| mercaptopyruvate sulfurtransferase-like protein [Solanum lycopersicum]
Length=371

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 51/72 (71%), Gaps = 3/72 (4%)
 Frame = +3

Query  354  NRPLYSQASFSHLSYQVASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDP  533
             +  Y Q++ ++ SY++ +SV CRM SS      +FS  S+++NEPVVSVDWLH  L+ P
Sbjct  31   KKTFYYQSAPTYFSYKLVASVTCRMNSSRLA---TFSTQSVSSNEPVVSVDWLHANLKQP  87

Query  534  DMKVLDASWYMP  569
             +KVLDASWYMP
Sbjct  88   HIKVLDASWYMP  99



>ref|XP_008456097.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like 
[Cucumis melo]
 ref|XP_008456098.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like 
[Cucumis melo]
Length=377

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 69/115 (60%), Gaps = 12/115 (10%)
 Frame = +3

Query  234  MASSVIARTLFATR---SVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQV  404
            MAS++++R L   R   S  +P   +    ++F K  F         Y Q + + ++Y  
Sbjct  1    MASTLLSRALLLNRFAHSFSFPSGKTQILPSVFSKKLF---------YFQPTSASVAYSP  51

Query  405  ASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                +  MASS++GA+  FS  SL+T++P+VS DWLH+ L++PD+KVLDASWYMP
Sbjct  52   TRRFSSFMASSVAGARAHFSSKSLSTDDPIVSPDWLHSNLKEPDLKVLDASWYMP  106



>ref|XP_010094713.1| hypothetical protein L484_003021 [Morus notabilis]
 gb|EXB56759.1| hypothetical protein L484_003021 [Morus notabilis]
Length=378

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 69/113 (61%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLN-RPLYSQASFSHLSYQVAS  410
            MAS++++R+L A   + +  LS S      +K Q  SS  N RP +  A     SY+ + 
Sbjct  1    MASTLLSRSLLAAHRLIHSSLSPS------QKPQILSSLFNKRPFHLGAHPVCTSYKRSG  54

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            SV    +S+  GA   F+  +++ ++P+VSV+WLH  L+DP++KVLDASWYMP
Sbjct  55   SVRVMASSAPGGATAGFASKAISVSDPIVSVNWLHENLKDPNLKVLDASWYMP  107



>ref|XP_010429794.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Camelina sativa]
Length=383

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (60%), Gaps = 7/114 (6%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYS-QASFSHLSYQVA  407
            MAS++ +R+ L AT  +  PPLS     +L  +    +    R  YS Q   +  +Y+  
Sbjct  1    MASTLFSRSFLAATHRLITPPLS-----SLLPQTSAAAFLTKRAFYSHQLGVASTAYKST  55

Query  408  SSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +     MA +  G +  +S +S++T+EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  56   AWARRAMAYTGVGTKAGYSTSSISTSEPVVSVDWLHANLREPDLKVLDASWYMP  109



>ref|XP_010497860.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like 
isoform X1 [Camelina sativa]
Length=382

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = +3

Query  234  MASSVIARTLF-ATRSVFYPPLssssssTLFRKLQFKSSFLNRP-LYSQASFSHLSYQVA  407
            MAS++ +R+L  A R +F P LS        R  +F ++FLN+  L SQ   ++ +Y+ +
Sbjct  1    MASTLYSRSLLVARRCLFNPSLSPLLPQ---RTPKF-ATFLNKKALSSQLHSAYSTYKSS  56

Query  408  SSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            + V+  MAS+ +  +  ++ +S+++NEPVVSVDWLH  LR  D+KVLDASWYMP
Sbjct  57   THVSRVMASTGTEPKAKYATSSVSSNEPVVSVDWLHANLRGADIKVLDASWYMP  110



>ref|XP_011086349.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Sesamum indicum]
Length=378

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 8/113 (7%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSS-FLNRPLYSQASFSHLSYQVAS  410
            MAS+V +R LFA R V        SSS   +K QF +S F  R   S +  S+L+Y+ + 
Sbjct  1    MASAVFSRALFARRIV-------QSSSQFLQKSQFFTSVFPKRAFPSWSGSSNLAYKTSV  53

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            S++C M+S+   AQ SFS  SL+T+EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  54   SISCSMSSASVAAQASFSMKSLSTSEPVVSVDWLHANLREPDVKVLDASWYMP  106



>gb|ACB59214.1| cytoplasmic thiosulfate:cyanide sulfur transferase [Brassica 
oleracea]
Length=379

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 72/114 (63%), Gaps = 9/114 (8%)
 Frame = +3

Query  234  MASSVIARTLF-ATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++++RTL  A R V  P LSS    TL +K +  ++ +N+  +S    S  S   A 
Sbjct  1    MASTLLSRTLLVAGRCVINPSLSS----TLPQKSRGFATVVNKRAFSSQLRSAYS---AP  53

Query  411  SVACRMASSLS-GAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS   G +  ++ +S++T EPVVSVDWLH+ LR+ D+KVLDASWYMP
Sbjct  54   YVGRVMASSTGIGPKAGYATSSMSTKEPVVSVDWLHSNLREADIKVLDASWYMP  107



>emb|CDY33328.1| BnaC05g12550D [Brassica napus]
Length=379

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 72/114 (63%), Gaps = 9/114 (8%)
 Frame = +3

Query  234  MASSVIARTLF-ATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++++RTL  A R V  P LSS    TL +K +  ++ +N+  +S    S  S   A 
Sbjct  1    MASTLLSRTLLVAGRCVINPSLSS----TLPQKSRGFATVVNKRAFSSQLRSAYS---AP  53

Query  411  SVACRMASSLS-GAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS   G +  ++ +S++T EPVVSVDWLH+ LR+ D+KVLDASWYMP
Sbjct  54   YVGRVMASSTGIGPKAGYATSSMSTKEPVVSVDWLHSNLREADIKVLDASWYMP  107



>emb|CDY35094.1| BnaA06g11040D [Brassica napus]
Length=380

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 72/114 (63%), Gaps = 9/114 (8%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++++RT L A R V  P LSS    TL +K +  ++ LN+  +S    S  S   A 
Sbjct  1    MASTLLSRTFLVAGRCVINPSLSS----TLPQKSRGFATVLNKRAFSSQLRSAYS---AP  53

Query  411  SVACRMASSLS-GAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS   G +  ++ +S++T EPVVSVDWLH+ LR+ D+KVLDA+WYMP
Sbjct  54   YVGRVMASSTGVGPKAGYATSSMSTKEPVVSVDWLHSNLREADIKVLDATWYMP  107



>ref|XP_010476757.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like 
isoform X1 [Camelina sativa]
Length=380

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 69/113 (61%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS++ +R+L   R     P     S +  R  +F ++FLN+  +S    S  S   +S+
Sbjct  1    MASTLYSRSLLVARRCLINP-----SLSPLRTPKF-ATFLNKKAFSSQLHSAYSTSKSST  54

Query  414  VACR-MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
               R MAS+ +  + +++ +S+++NEPVVSVDWLH  LR  D+KVLDASWYMP
Sbjct  55   HVSRVMASTGTEPKANYATSSISSNEPVVSVDWLHANLRGADIKVLDASWYMP  107



>ref|XP_002307187.2| thiosulfate sulfurtransferase family protein [Populus trichocarpa]
 gb|EEE94183.2| thiosulfate sulfurtransferase family protein [Populus trichocarpa]
Length=315

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MASS+ G + +FS  SL+ NEPVVSVDWLH  LR+P++KVLDASWYMP
Sbjct  1    MASSVVGTRPNFSTQSLSMNEPVVSVDWLHANLREPNLKVLDASWYMP  48



>ref|XP_006853294.1| hypothetical protein AMTR_s00032p00026180 [Amborella trichopoda]
 gb|ERN14761.1| hypothetical protein AMTR_s00032p00026180 [Amborella trichopoda]
Length=377

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 9/114 (8%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MA S++ R     RS+  P +  + +  L+      SSFL R               A  
Sbjct  1    MAGSLLTRAFGGFRSI-RPAILHTHNPQLY------SSFLKRKSIDNLVKPSSLVSSAPR  53

Query  414  VACRMASSLS--GAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
              C ++++L+  GA+ +FS  S+ TNEPVVSVDWLH  LR+P++KVLDASWYMP
Sbjct  54   FVCYISAALTHKGARATFSTQSMATNEPVVSVDWLHENLREPNVKVLDASWYMP  107



>ref|XP_011007217.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial [Populus euphratica]
Length=372

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 62/112 (55%), Gaps = 10/112 (9%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS+++ ++L   R +      S  +  +F  L     F  R    +A   H S++ +  
Sbjct  1    MASTILTKSLLGHRLIHSSFSLSHKTPQIFTSL-----FPWRTFQKRADPFHTSFKTSQW  55

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V C     + GA+ +FS  SL+  EPVVSVDWLH  L +PDMKVLDASWYMP
Sbjct  56   VQC-----VVGARANFSTQSLSLKEPVVSVDWLHANLGEPDMKVLDASWYMP  102



>gb|AFK34139.1| unknown [Lotus japonicus]
Length=384

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MASS+ G + ++S  S++TNEPVVSVDWL+  L++PDMKVLDASWYMP
Sbjct  62   MASSIVGRRATYSTQSVSTNEPVVSVDWLYDNLKEPDMKVLDASWYMP  109



>ref|XP_004488787.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Cicer arietinum]
Length=375

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 66/116 (57%), Gaps = 18/116 (16%)
 Frame = +3

Query  234  MASSVIARTLFATRSVF--YPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVA  407
            MASS + + L   RS+   +PP+               SSF ++ L+S  +    + Q  
Sbjct  1    MASSFLTKILLGPRSIITHHPPIL--------------SSFFSKRLFSIQTVPTSTAQNT  46

Query  408  --SSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
              +  A  MASS+ G + ++S  S  TNEPVVSVDWL+  L++PD+KV+DASWYMP
Sbjct  47   KLTGWAPCMASSIVGRRAAYSTRSAPTNEPVVSVDWLYDNLKEPDIKVVDASWYMP  102



>ref|XP_010417543.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial isoform X1 [Camelina sativa]
Length=383

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 67/114 (59%), Gaps = 7/114 (6%)
 Frame = +3

Query  234  MASSVIART-LFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYS-QASFSHLSYQVA  407
            MAS++ +R+ L AT  +  P LS     +L  +    +    R  YS Q   +  +Y+  
Sbjct  1    MASTLFSRSFLAATHRLITPSLS-----SLLPQTTAAAFLTKRAFYSPQLGVASTAYKST  55

Query  408  SSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +     MA +  G +  +S +S++T+EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  56   TWARRAMAYTGVGTKAGYSTSSISTSEPVVSVDWLHANLREPDLKVLDASWYMP  109



>ref|XP_010472766.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Camelina sativa]
 ref|XP_010472767.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Camelina sativa]
Length=382

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 10/115 (9%)
 Frame = +3

Query  234  MASSVIARTLFA-TRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++ +R+  A T  +  PPLSS    T        ++FL +  +        S    S
Sbjct  1    MASTLFSRSFVAATHRLITPPLSSLLPQTT-------AAFLTKRAFYSHQLGVASTASKS  53

Query  411  SVACR--MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +   R  MA +  G +  +S +S++T+EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  54   TTWARRAMAYTRVGTKAGYSTSSISTSEPVVSVDWLHANLREPDLKVLDASWYMP  108



>ref|XP_010459188.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like 
isoform X1 [Camelina sativa]
Length=379

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = +3

Query  234  MASSVIARTLF-ATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++ +R+L  A R +F P LS        R  +F +    +   SQ   ++ + + ++
Sbjct  1    MASTLYSRSLLVARRCLFNPSLSPQ------RTPKFATFLTKKAFSSQLHSAYSTCKSST  54

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V+  MAS+ +  + +++ +S+++NEPVVSVDWLH  LR  D+KVLDASWYMP
Sbjct  55   HVSRVMASTGTEPKANYATSSVSSNEPVVSVDWLHANLRGADLKVLDASWYMP  107



>ref|XP_010539576.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X2 [Tarenaya hassleriana]
Length=359

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 4/72 (6%)
 Frame = +3

Query  357  RPLYSQASFSHLSYQVASSVACRMASSLSGAQI-SFSPASLTTNEPVVSVDWLHTKLRDP  533
            R  YSQ   ++ S   AS V   MAS+  G +   +S +S++T+EPVVS DWLH+ LR+P
Sbjct  17   RTFYSQPGSTYQSSSWASRV---MASAGGGPRAAGYSTSSISTDEPVVSADWLHSNLREP  73

Query  534  DMKVLDASWYMP  569
            D+KVLDASWYMP
Sbjct  74   DLKVLDASWYMP  85



>ref|XP_009149076.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2 
[Brassica rapa]
Length=380

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 71/114 (62%), Gaps = 9/114 (8%)
 Frame = +3

Query  234  MASSVIAR-TLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVAS  410
            MAS++++R +L A R V  P LSS    TL +K +  ++ LN+  +S    S  S     
Sbjct  1    MASTLLSRISLVAGRCVINPSLSS----TLPQKSRGFATVLNKRAFSSQLRSAYSPPYVG  56

Query  411  SVACRMASSLS-GAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             V   MASS   G +  ++ +S++T EPVVSVDWLH+ LR+ D+KVLDA+WYMP
Sbjct  57   RV---MASSTGVGPKAGYATSSMSTKEPVVSVDWLHSNLREADIKVLDATWYMP  107



>ref|XP_010539575.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Tarenaya hassleriana]
Length=371

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 4/72 (6%)
 Frame = +3

Query  357  RPLYSQASFSHLSYQVASSVACRMASSLSGAQI-SFSPASLTTNEPVVSVDWLHTKLRDP  533
            R  YSQ   ++ S   AS V   MAS+  G +   +S +S++T+EPVVS DWLH+ LR+P
Sbjct  29   RTFYSQPGSTYQSSSWASRV---MASAGGGPRAAGYSTSSISTDEPVVSADWLHSNLREP  85

Query  534  DMKVLDASWYMP  569
            D+KVLDASWYMP
Sbjct  86   DLKVLDASWYMP  97



>ref|XP_003546810.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Glycine max]
 gb|KHN48889.1| 3-mercaptopyruvate sulfurtransferase [Glycine soja]
Length=384

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 65/112 (58%), Gaps = 3/112 (3%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS+++ + L   R + +P    +    +   L  K  F  R +   AS S  + +    
Sbjct  6    MASTLLTKMLLGHR-LIHPSSFLTHQPQILSSLFSKRLFCIRAVPVSASTSQ-NIKTTGW  63

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
              C MASS  G + ++S  S++TNEPVVSVDWL+  L++PD+KVLDASWYMP
Sbjct  64   APC-MASSSVGRRATYSTQSVSTNEPVVSVDWLYDNLKEPDIKVLDASWYMP  114



>gb|KCW71382.1| hypothetical protein EUGRSUZ_F04458 [Eucalyptus grandis]
Length=375

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MASS+IART  A R        + SS  L RK    +S   +  +  +     + Q    
Sbjct  1    MASSLIARTFLAHR-------LAPSSLPLARKAPILTSLFTKRTHCTSRGLRFAAQQFRR  53

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                MAS++   +  +S  S++T+EPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  54   TFQPMASAVFQTRADYSTQSVSTSEPVVSVDWLHANLKEPDLKVLDASWYMP  105



>ref|XP_010064077.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial [Eucalyptus grandis]
 gb|KCW71381.1| hypothetical protein EUGRSUZ_F04458 [Eucalyptus grandis]
Length=375

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MASS+IART  A R        + SS  L RK    +S   +  +  +     + Q    
Sbjct  1    MASSLIARTFLAHR-------LAPSSLPLARKAPILTSLFTKRTHCTSRGLRFAAQQFRR  53

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                MAS++   +  +S  S++T+EPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  54   TFQPMASAVFQTRADYSTQSVSTSEPVVSVDWLHANLKEPDLKVLDASWYMP  105



>ref|XP_006346030.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Solanum tuberosum]
Length=373

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  NRPLYSQASFSHLSYQVASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDP  533
             +  YSQA+ ++ SY++  SV CRM SS  G + +FS  ++++NE VVSVDWLH  L+ P
Sbjct  30   KKTFYSQAAPTYFSYKLVGSVTCRMDSSRVGTRATFSTQAVSSNESVVSVDWLHANLKLP  89

Query  534  DMKVLDASWYMP  569
            D+KVLDASWYMP
Sbjct  90   DIKVLDASWYMP  101



>ref|XP_006389908.1| hypothetical protein EUTSA_v10018699mg [Eutrema salsugineum]
 gb|ESQ27194.1| hypothetical protein EUTSA_v10018699mg [Eutrema salsugineum]
Length=384

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFL-NRPLYSQASFSHLSYQVAS  410
            MAS++  R+  A       P  SS    L +K    ++FL  R  +SQ      +Y   S
Sbjct  1    MASTLFTRSFLAASHRMITPCLSSL---LPQKTLNLAAFLSKRAFHSQLGSVSTAYNSTS  57

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                 MASS    +  +S +S++ NEPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  58   WARRAMASSGIEPKAGYSTSSVSANEPVVSVDWLHANLKEPDLKVLDASWYMP  110



>ref|XP_007022598.1| Mercaptopyruvate sulfurtransferase 1 isoform 3 [Theobroma cacao]
 gb|EOY14123.1| Mercaptopyruvate sulfurtransferase 1 isoform 3 [Theobroma cacao]
Length=318

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MAS++   +I+FS  SL+TN+ VVSVDWLH  LR+PDMKVLDASWYMP
Sbjct  1    MASAID-RRINFSTQSLSTNDTVVSVDWLHANLREPDMKVLDASWYMP  47



>ref|XP_006305134.1| hypothetical protein CARUB_v10009502mg [Capsella rubella]
 gb|EOA38032.1| hypothetical protein CARUB_v10009502mg [Capsella rubella]
Length=250

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MAS+ +G + +++ +S++T+EPVVSVDWLH  LR  D+KVLDASWYMP
Sbjct  1    MASTGAGPKANYATSSISTDEPVVSVDWLHANLRGADIKVLDASWYMP  48



>ref|XP_006416815.1| hypothetical protein EUTSA_v10007910mg [Eutrema salsugineum]
 gb|ESQ35168.1| hypothetical protein EUTSA_v10007910mg [Eutrema salsugineum]
Length=320

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MAS+  G +  +S +S+++NEPVVSVDWLH+ LR+ D+KVLDASWYMP
Sbjct  1    MASTRVGPKAGYSTSSVSSNEPVVSVDWLHSNLREGDIKVLDASWYMP  48



>ref|XP_003531486.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Glycine max]
Length=379

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MASS  G + ++S  S++TNEPVVSVDWL+  L++PD+KVLDASWYMP
Sbjct  62   MASSSVGRRATYSTQSVSTNEPVVSVDWLYDNLKEPDIKVLDASWYMP  109



>gb|EPS72023.1| hypothetical protein M569_02734, partial [Genlisea aurea]
Length=372

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 66/112 (59%), Gaps = 7/112 (6%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS+V++  L A R++     S SS  T      F     NR L+S    S L       
Sbjct  1    MASAVLSGILVARRTLQLSCSSFSSILTNLNYFWFLFPLQNRKLHSNPGLSIL-------  53

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V+  M+S+   +Q SFS  SL+TNEPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  54   VSRNMSSAAVASQASFSIHSLSTNEPVVSVDWLHANLREPDVKVLDASWYMP  105



>ref|XP_007149204.1| hypothetical protein PHAVU_005G050400g [Phaseolus vulgaris]
 gb|ESW21198.1| hypothetical protein PHAVU_005G050400g [Phaseolus vulgaris]
Length=379

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +3

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            V C MASS  G + S+S  S++TNEPVVSVDWL+  L+ PD+KVLDASWYMP
Sbjct  59   VPC-MASSSVGRRASYSTQSVSTNEPVVSVDWLYDNLKVPDIKVLDASWYMP  109



>ref|XP_006305133.1| hypothetical protein CARUB_v10009502mg, partial [Capsella rubella]
 gb|EOA38031.1| hypothetical protein CARUB_v10009502mg, partial [Capsella rubella]
Length=369

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MAS+ +G + +++ +S++T+EPVVSVDWLH  LR  D+KVLDASWYMP
Sbjct  1    MASTGAGPKANYATSSISTDEPVVSVDWLHANLRGADIKVLDASWYMP  48



>ref|NP_001077848.1| mercaptopyruvate sulfurtransferase 1 [Arabidopsis thaliana]
 gb|AEE36221.1| mercaptopyruvate sulfurtransferase 1 [Arabidopsis thaliana]
Length=322

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MAS+    +  +S +S++T+EPVVSVDWLH  LR+PD+K+LDASWYMP
Sbjct  1    MASTGVETKAGYSTSSVSTSEPVVSVDWLHANLREPDLKILDASWYMP  48



>gb|KCW71383.1| hypothetical protein EUGRSUZ_F04458 [Eucalyptus grandis]
Length=318

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MAS++   +  +S  S++T+EPVVSVDWLH  L++PD+KVLDASWYMP
Sbjct  1    MASAVFQTRADYSTQSVSTSEPVVSVDWLHANLKEPDLKVLDASWYMP  48



>gb|KDO61602.1| hypothetical protein CISIN_1g017338mg [Citrus sinensis]
Length=319

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            M+S  +G +  +S  S++  EPVVSVDWLH  LR+PD+KVLDASWYMP
Sbjct  1    MSSLAAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMP  48



>ref|XP_011095713.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Sesamum indicum]
 ref|XP_011095714.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Sesamum indicum]
Length=321

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            M+S+   +Q  FS  SL+T+EPVVSV WLH+ LR+P++KVLDASWYMP
Sbjct  1    MSSAAVASQGPFSMQSLSTDEPVVSVSWLHSNLREPNVKVLDASWYMP  48



>ref|NP_563998.1| thiosulfate/3-mercaptopyruvate sulfurtransferase 2 [Arabidopsis 
thaliana]
 ref|NP_001031056.1| thiosulfate/3-mercaptopyruvate sulfurtransferase 2 [Arabidopsis 
thaliana]
 ref|NP_001185012.1| thiosulfate/3-mercaptopyruvate sulfurtransferase 2 [Arabidopsis 
thaliana]
 emb|CAB53639.1| thiosulfate sulfurtransferase [Arabidopsis thaliana]
 dbj|BAA85149.1| mercaptopyruvate sulfurtransferase [Arabidopsis thaliana]
 gb|AAM61125.1| mercaptopyruvate sulfurtransferase Mst2/Rdh2 [Arabidopsis thaliana]
 dbj|BAF01145.1| thiosulfate sulfurtransferase like protein [Arabidopsis thaliana]
 gb|AEE29453.1| thiosulfate/3-mercaptopyruvate sulfurtransferase 2 [Arabidopsis 
thaliana]
 gb|AEE29455.1| thiosulfate/3-mercaptopyruvate sulfurtransferase 2 [Arabidopsis 
thaliana]
 gb|AEE29456.1| thiosulfate/3-mercaptopyruvate sulfurtransferase 2 [Arabidopsis 
thaliana]
Length=318

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYM  566
            MASS S A+ +++P  ++TNEPVVSVDWLH+ L D D+KVLDASWYM
Sbjct  1    MASSGSEAKANYAP--ISTNEPVVSVDWLHSNLGDADIKVLDASWYM  45



>dbj|BAF00796.1| thiosulfate sulfurtransferase like protein [Arabidopsis thaliana]
Length=318

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYM  566
            MASS S A+ +++P  ++TNEPVVSVDWLH+ L D D+KVLDASWYM
Sbjct  1    MASSGSEAKANYAP--ISTNEPVVSVDWLHSNLGDADIKVLDASWYM  45



>gb|AAD34697.1|AC006341_25 Similar to gb|AF109156 thiosulfate sulfurtransferase (TST) from 
Datisca glomerata and contains PF|00581 Rhodanese-like domain. 
ESTs gb|F19994 and gb|F19993 come from this gene [Arabidopsis 
thaliana]
Length=329

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYM  566
            MASS S A+ +++P  ++TNEPVVSVDWLH+ L D D+KVLDASWYM
Sbjct  1    MASSGSEAKANYAP--ISTNEPVVSVDWLHSNLGDADIKVLDASWYM  45



>ref|NP_849675.1| thiosulfate/3-mercaptopyruvate sulfurtransferase 2 [Arabidopsis 
thaliana]
 sp|Q24JL3.1|STR2_ARATH RecName: Full=Thiosulfate/3-mercaptopyruvate sulfurtransferase 
2; AltName: Full=Rhodanese homolog protein 2; Short=AtRDH2; 
AltName: Full=Sulfurtransferase 2; Short=AtStr2 [Arabidopsis 
thaliana]
 gb|ABD85147.1| At1g16460 [Arabidopsis thaliana]
 gb|AEE29454.1| thiosulfate/3-mercaptopyruvate sulfurtransferase 2 [Arabidopsis 
thaliana]
Length=342

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYM  566
            MASS S A+ +++P  ++TNEPVVSVDWLH+ L D D+KVLDASWYM
Sbjct  25   MASSGSEAKANYAP--ISTNEPVVSVDWLHSNLGDADIKVLDASWYM  69



>emb|CAB88023.1| 3-mercaptopyruvate sulfurtransferase [Arabidopsis thaliana]
Length=366

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYM  566
            MASS S A+ +++P  ++TNEPVVSVDWLH+ L D D+KVLDASWYM
Sbjct  49   MASSGSEAKANYAP--ISTNEPVVSVDWLHSNLGDADIKVLDASWYM  93



>ref|XP_010497864.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X2 [Camelina sativa]
Length=320

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            MAS+ +  +  ++ +S+++NEPVVSVDWLH  LR  D+KVLDASWYMP
Sbjct  1    MASTGTEPKAKYATSSVSSNEPVVSVDWLHANLRGADIKVLDASWYMP  48



>ref|XP_003637743.1| Mercaptopyruvate sulfurtransferase-like protein [Medicago truncatula]
 gb|KEH38272.1| thiosulfate/3-mercaptopyruvate sulfurtransferase [Medicago truncatula]
Length=381

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 63/115 (55%), Gaps = 11/115 (10%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASF---SHLSYQV  404
            MASS+  + L   RS+      S +   L       SSF N+ L+S  +    + ++ + 
Sbjct  1    MASSLFTKILLRPRSIHTSSFFSHNPPIL-------SSFFNKRLFSIRAVPTSTAVNTKS  53

Query  405  ASSVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                 C MASS+     ++S  S  +NEPVVSVDWL+  L++P +KV+DASWYMP
Sbjct  54   TGWSPC-MASSIVSRTATYSTRSAPSNEPVVSVDWLYDNLKEPAIKVVDASWYMP  107



>emb|CDX88520.1| BnaC06g39640D [Brassica napus]
Length=336

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  486  EPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            EPVVSVDWLH+ LR+PD+KVLDASWYMP
Sbjct  54   EPVVSVDWLHSNLREPDLKVLDASWYMP  81



>ref|XP_008787354.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Phoenix dactylifera]
Length=377

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  414  VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            + C   +S S   I+ +  S   NEPVVS +WLH  LR+PD+KV+DASWYMP
Sbjct  56   IRCDATTSPSARIITSAIHSKAHNEPVVSAEWLHANLREPDVKVVDASWYMP  107



>gb|EEC69648.1| hypothetical protein OsI_39055 [Oryza sativa Indica Group]
Length=372

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +3

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             +A R  ++ S A +S +  +L   EPVVS +WLH  L+DPD+KVLDASWYMP
Sbjct  87   GIAARCNATSSSA-VSEATNALPRTEPVVSAEWLHANLKDPDVKVLDASWYMP  138



>ref|XP_010669991.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Beta vulgaris subsp. vulgaris]
Length=378

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 24/120 (20%)
 Frame = +3

Query  234  MASSVIARTLFATRSVFYPPLssssssTLFRKLQFKSSFLNRPLYSQASFSHLSYQVASS  413
            MAS++ +RT F+ R               F     +S FLN   +   +F   S ++   
Sbjct  1    MASALFSRTFFSNR---------------FLHSSSRSLFLNPQFFHSRAFGLRSKELDCC  45

Query  414  --------VACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
                    V C    + S A+ S+   +++T+EPVVS++WLH  LR P +KV+DASWYMP
Sbjct  46   NLVQRTCWVRCVGPWTNSSAK-SYCTQAMSTSEPVVSIEWLHANLRQPGIKVVDASWYMP  104



>ref|NP_001067237.1| Os12g0608600 [Oryza sativa Japonica Group]
 dbj|BAF30256.1| Os12g0608600 [Oryza sativa Japonica Group]
Length=387

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +3

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             +A R  ++ S A +S +  +L   EPVVS +WLH  L+DPD+KVLDASWYMP
Sbjct  65   GIAARCNATSSSA-VSEATNALPRTEPVVSAEWLHANLKDPDVKVLDASWYMP  116



>gb|EAY83836.1| hypothetical protein OsI_39053 [Oryza sativa Indica Group]
Length=404

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +3

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             +A R  ++ S A +S +  +L   EPVVS +WLH  L+DPD+KVLDASWYMP
Sbjct  87   GIAARCNATSSSA-VSEATNALPRTEPVVSAEWLHANLKDPDVKVLDASWYMP  138



>gb|EAZ21169.1| hypothetical protein OsJ_36817 [Oryza sativa Japonica Group]
Length=398

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +3

Query  411  SVACRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             +A R  ++ S A +S +  +L   EPVVS +WLH  L+DPD+KVLDASWYMP
Sbjct  65   GIAARCNATSSSA-VSEATNALPRTEPVVSAEWLHANLKDPDVKVLDASWYMP  116



>tpg|DAA47453.1| TPA: hypothetical protein ZEAMMB73_269466 [Zea mays]
Length=365

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  420  CRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            C   SS S    +    ++   EPVVS +WLH  L+DPD+KVLDASWYMP
Sbjct  61   CNATSSSSAVSEATGVHTVPPTEPVVSAEWLHANLKDPDVKVLDASWYMP  110



>ref|XP_008669586.1| PREDICTED: uncharacterized protein LOC100275494 isoform X1 [Zea 
mays]
 tpg|DAA47451.1| TPA: hypothetical protein ZEAMMB73_269466 [Zea mays]
Length=407

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  420  CRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            C   SS S    +    ++   EPVVS +WLH  L+DPD+KVLDASWYMP
Sbjct  87   CNATSSSSAVSEATGVHTVPPTEPVVSAEWLHANLKDPDVKVLDASWYMP  136



>dbj|BAJ97390.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  486  EPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            EPVVS +WLH  LRDPD+KVLDASWYMP
Sbjct  101  EPVVSAEWLHANLRDPDVKVLDASWYMP  128



>ref|XP_008669588.1| PREDICTED: uncharacterized protein LOC100275494 isoform X2 [Zea 
mays]
 tpg|DAA47452.1| TPA: hypothetical protein ZEAMMB73_269466 [Zea mays]
Length=386

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  420  CRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            C   SS S    +    ++   EPVVS +WLH  L+DPD+KVLDASWYMP
Sbjct  66   CNATSSSSAVSEATGVHTVPPTEPVVSAEWLHANLKDPDVKVLDASWYMP  115



>dbj|BAJ87778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96180.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  486  EPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            EPVVS +WLH  LRDPD+KVLDASWYMP
Sbjct  80   EPVVSAEWLHANLRDPDVKVLDASWYMP  107



>ref|XP_010923778.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like 
[Elaeis guineensis]
Length=377

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  471  SLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            S+   EPVVS +WLH  LR+PD+KVLDASWYMP
Sbjct  75   SIAHKEPVVSAEWLHANLREPDVKVLDASWYMP  107



>ref|XP_003577689.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like 
isoform X1 [Brachypodium distachyon]
Length=402

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  486  EPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            EPVVS +WLH  LRDPD+KVLDASWYMP
Sbjct  104  EPVVSAEWLHANLRDPDVKVLDASWYMP  131



>ref|XP_010237052.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like 
isoform X2 [Brachypodium distachyon]
Length=381

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  486  EPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            EPVVS +WLH  LRDPD+KVLDASWYMP
Sbjct  83   EPVVSAEWLHANLRDPDVKVLDASWYMP  110



>ref|XP_008807177.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008807178.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008807179.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008807180.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008807181.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008807182.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Phoenix dactylifera]
Length=300

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  474  LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +  NEPVVS +WLH  L DPD+KVLDASWYMP
Sbjct  1    MGHNEPVVSAEWLHANLGDPDVKVLDASWYMP  32



>ref|XP_004963128.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Setaria italica]
Length=384

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  471  SLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             L   EPVVS +WLH  L+DPD+KVLDASWYMP
Sbjct  80   ELPRTEPVVSAEWLHANLKDPDVKVLDASWYMP  112



>ref|XP_010926888.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like [Elaeis guineensis]
Length=300

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  474  LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +  NEPVVS +WLH  L DPD+KVLD SWYMP
Sbjct  1    MGHNEPVVSAEWLHANLGDPDVKVLDGSWYMP  32



>ref|XP_010669992.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X2 [Beta vulgaris subsp. vulgaris]
Length=306

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  474  LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            ++T+EPVVS++WLH  LR P +KV+DASWYMP
Sbjct  1    MSTSEPVVSIEWLHANLRQPGIKVVDASWYMP  32



>ref|XP_009393284.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial [Musa acuminata subsp. malaccensis]
 ref|XP_009393285.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=305

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  474  LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            + ++EPVVS  WLH  L++PD+KVLDASWYMP
Sbjct  1    MESHEPVVSAAWLHANLKNPDIKVLDASWYMP  32



>ref|XP_009419015.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=376

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  486  EPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            EPVVS DWL   LR PD+K+LDASWYMP
Sbjct  80   EPVVSADWLLANLRQPDVKILDASWYMP  107



>gb|KHN26865.1| 3-mercaptopyruvate sulfurtransferase [Glycine soja]
Length=354

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 40/84 (48%), Gaps = 36/84 (43%)
 Frame = +3

Query  426  MASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMK---------------------  542
            MASS  G + ++S  S++TNEPVVSVDWL+  L++PD+K                     
Sbjct  1    MASSSVGRRATYSTQSVSTNEPVVSVDWLYDNLKEPDIKVQENEIPLDPFNYLLNSATVV  60

Query  543  ---------------VLDASWYMP  569
                           VLDASWYMP
Sbjct  61   PNHRSQLRQLLSNYAVLDASWYMP  84



>ref|XP_009419014.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=377

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  486  EPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            EPVVS DWL   LR PD+K+LDASWYMP
Sbjct  80   EPVVSADWLLANLRQPDVKILDASWYMP  107



>gb|ABK24999.1| unknown [Picea sitchensis]
Length=396

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  471  SLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            S   ++ VVS DWLH  LR PD+KV+DASWYMP
Sbjct  90   STDNDDCVVSADWLHQNLRQPDVKVVDASWYMP  122



>ref|XP_002956187.1| hypothetical protein VOLCADRAFT_107126 [Volvox carteri f. nagariensis]
 gb|EFJ42726.1| hypothetical protein VOLCADRAFT_107126 [Volvox carteri f. nagariensis]
Length=1378

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 8/50 (16%)
 Frame = +3

Query  420   CRMASSLSGAQISFSPASLTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
             CR  ++++GA  +          PVV+VDWL  +L DP ++VLDA WYMP
Sbjct  993   CRTETTMAGAAAAI--------HPVVTVDWLAERLNDPSVRVLDACWYMP  1034



>ref|XP_008653485.1| PREDICTED: uncharacterized protein LOC103633571 isoform X2 [Zea 
mays]
Length=283

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 4/65 (6%)
 Frame = +3

Query  387  HLSYQVASSVACRMASSLSGAQISFSPAS----LTTNEPVVSVDWLHTKLRDPDMKVLDA  554
            ++S+QV SSV   + S++   +    P +    +  ++PVVS  W+H  L  PD+KVLDA
Sbjct  50   YISFQVPSSVTLNILSNVWRPRSLGLPVARRSVMAQDDPVVSAQWMHEHLVMPDVKVLDA  109

Query  555  SWYMP  569
            SWYMP
Sbjct  110  SWYMP  114



>ref|XP_008653486.1| PREDICTED: uncharacterized protein LOC103633571 isoform X3 [Zea 
mays]
Length=278

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 4/65 (6%)
 Frame = +3

Query  387  HLSYQVASSVACRMASSLSGAQISFSPAS----LTTNEPVVSVDWLHTKLRDPDMKVLDA  554
            ++S+QV SSV   + S++   +    P +    +  ++PVVS  W+H  L  PD+KVLDA
Sbjct  45   YISFQVPSSVTLNILSNVWRPRSLGLPVARRSVMAQDDPVVSAQWMHEHLVMPDVKVLDA  104

Query  555  SWYMP  569
            SWYMP
Sbjct  105  SWYMP  109



>ref|XP_008653484.1| PREDICTED: uncharacterized protein LOC103633571 isoform X1 [Zea 
mays]
Length=289

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 4/65 (6%)
 Frame = +3

Query  387  HLSYQVASSVACRMASSLSGAQISFSPAS----LTTNEPVVSVDWLHTKLRDPDMKVLDA  554
            ++S+QV SSV   + S++   +    P +    +  ++PVVS  W+H  L  PD+KVLDA
Sbjct  56   YISFQVPSSVTLNILSNVWRPRSLGLPVARRSVMAQDDPVVSAQWMHEHLVMPDVKVLDA  115

Query  555  SWYMP  569
            SWYMP
Sbjct  116  SWYMP  120



>gb|AFW66412.1| thiosulfate transferase [Zea mays]
Length=406

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 33/59 (56%), Gaps = 10/59 (17%)
 Frame = +3

Query  423  RMASSLSGAQISFSPASL----------TTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            R  SS +G +I   P SL            ++PVVS  WLH  L  PD+KVLDASWYMP
Sbjct  69   RSPSSPAGIRIIRRPRSLGLSAARRSVMAQDDPVVSAQWLHEHLGMPDVKVLDASWYMP  127



>ref|XP_004951799.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X1 [Setaria italica]
 ref|XP_004951800.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, 
mitochondrial-like isoform X2 [Setaria italica]
Length=306

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  474  LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +  ++PVVS  WLH  L  PD+KVLDASWYMP
Sbjct  1    MAQDDPVVSAQWLHQHLGAPDVKVLDASWYMP  32



>gb|AFW66409.1| hypothetical protein ZEAMMB73_693495 [Zea mays]
Length=382

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  474  LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +  ++PVVS  WLH  L  PD+KVLDASWYMP
Sbjct  1    MAQDDPVVSAQWLHEHLGMPDVKVLDASWYMP  32



>gb|AFW66411.1| thiosulfate transferase [Zea mays]
Length=368

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  474  LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +  ++PVVS  WLH  L  PD+KVLDASWYMP
Sbjct  58   MAQDDPVVSAQWLHEHLGMPDVKVLDASWYMP  89



>ref|XP_008676730.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
 ref|XP_008676731.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
 gb|AFW66408.1| thiosulfate transferase [Zea mays]
Length=311

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  474  LTTNEPVVSVDWLHTKLRDPDMKVLDASWYMP  569
            +  ++PVVS  WLH  L  PD+KVLDASWYMP
Sbjct  1    MAQDDPVVSAQWLHEHLGMPDVKVLDASWYMP  32



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960