BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G17

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629096.1|  PREDICTED: histone H2A.1                           164   7e-48   Nicotiana tomentosiformis
ref|XP_009778270.1|  PREDICTED: histone H2A.1                           163   2e-47   Nicotiana sylvestris
ref|XP_004230227.1|  PREDICTED: histone H2A.1                           160   3e-46   
ref|XP_002465460.1|  hypothetical protein SORBIDRAFT_01g039250          160   4e-46   Sorghum bicolor [broomcorn]
ref|XP_002465459.1|  hypothetical protein SORBIDRAFT_01g039240          160   4e-46   Sorghum bicolor [broomcorn]
ref|XP_006344647.1|  PREDICTED: histone H2A.1-like                      159   5e-46   Solanum tuberosum [potatoes]
gb|ACG24462.1|  histone H2A                                             159   5e-46   Zea mays [maize]
ref|NP_001183510.1|  uncharacterized LOC100501984                       159   6e-46   Zea mays [maize]
ref|XP_004487028.1|  PREDICTED: probable histone H2A.2-like             159   8e-46   Cicer arietinum [garbanzo]
ref|XP_008388544.1|  PREDICTED: histone H2A.1-like                      159   8e-46   Malus domestica [apple tree]
ref|XP_008448380.1|  PREDICTED: histone H2A                             159   9e-46   Cucumis melo [Oriental melon]
ref|XP_002462725.1|  hypothetical protein SORBIDRAFT_02g030950          159   1e-45   Sorghum bicolor [broomcorn]
ref|XP_003629797.1|  Histone H2A                                        158   2e-45   Medicago truncatula
ref|XP_004970473.1|  PREDICTED: histone H2A-like                        158   2e-45   Setaria italica
ref|XP_007206079.1|  hypothetical protein PRUPE_ppa012864mg             158   2e-45   Prunus persica
ref|XP_004970471.1|  PREDICTED: histone H2A-like                        158   2e-45   Setaria italica
ref|XP_008246411.1|  PREDICTED: histone H2A.1-like                      158   2e-45   Prunus mume [ume]
ref|XP_004487029.1|  PREDICTED: probable histone H2A.1-like             158   2e-45   Cicer arietinum [garbanzo]
ref|XP_011036853.1|  PREDICTED: probable histone H2A.5                  157   2e-45   Populus euphratica
ref|XP_008345605.1|  PREDICTED: histone H2A.1-like                      157   2e-45   
ref|XP_003597343.1|  Histone H2A                                        157   3e-45   Medicago truncatula
ref|XP_009376634.1|  PREDICTED: histone H2A.1                           157   3e-45   Pyrus x bretschneideri [bai li]
sp|P19177.1|H2A_PETCR  RecName: Full=Histone H2A                        157   3e-45   Petroselinum crispum
ref|NP_001288376.1|  histone H2A                                        157   3e-45   Zea mays [maize]
gb|ACG25089.1|  histone H2A                                             157   3e-45   Zea mays [maize]
gb|KEH30172.1|  core histone H2A/H2B/H3/H4                              157   3e-45   Medicago truncatula
gb|ACG30889.1|  histone H2A                                             157   3e-45   Zea mays [maize]
ref|XP_004294587.1|  PREDICTED: histone H2A-like                        157   4e-45   Fragaria vesca subsp. vesca
ref|XP_009769039.1|  PREDICTED: histone H2A-like                        157   5e-45   Nicotiana sylvestris
ref|XP_009626972.1|  PREDICTED: histone H2A                             156   6e-45   Nicotiana tomentosiformis
ref|NP_001281214.1|  uncharacterized protein LOC103504712               157   6e-45   Zea mays [maize]
gb|AAT08680.1|  histone H2A                                             157   6e-45   Hyacinthus orientalis [common hyacinth]
gb|AAT08677.1|  histone H2A                                             157   6e-45   Hyacinthus orientalis [common hyacinth]
gb|ACG33265.1|  histone H2A                                             157   6e-45   Zea mays [maize]
ref|XP_004984759.1|  PREDICTED: histone H2A-like                        157   6e-45   Setaria italica
gb|KEH30201.1|  core histone H2A/H2B/H3/H4                              156   6e-45   Medicago truncatula
gb|ACG30023.1|  histone H2A                                             156   9e-45   Zea mays [maize]
ref|XP_002533104.1|  histone h2a, putative                              156   9e-45   Ricinus communis
ref|XP_002533102.1|  histone h2a, putative                              156   1e-44   Ricinus communis
gb|AES88841.2|  core histone H2A/H2B/H3/H4                              156   1e-44   Medicago truncatula
emb|CDP19528.1|  unnamed protein product                                155   1e-44   Coffea canephora [robusta coffee]
ref|XP_003607007.1|  Histone H2A                                        156   1e-44   Medicago truncatula
gb|AFK43066.1|  unknown                                                 155   1e-44   Medicago truncatula
ref|XP_002284305.1|  PREDICTED: histone H2A                             155   1e-44   Vitis vinifera
ref|XP_003597346.1|  Histone H2A                                        155   1e-44   Medicago truncatula
ref|NP_001239884.1|  uncharacterized protein LOC100784431               155   2e-44   Glycine max [soybeans]
ref|XP_003547405.1|  PREDICTED: histone H2A-like                        155   2e-44   Glycine max [soybeans]
ref|NP_001237026.1|  uncharacterized protein LOC100306579               155   2e-44   Glycine max [soybeans]
ref|NP_001235555.1|  uncharacterized protein LOC100305705               155   2e-44   Glycine max [soybeans]
ref|XP_003543507.1|  PREDICTED: histone H2A-like                        155   2e-44   Glycine max [soybeans]
ref|XP_006649862.1|  PREDICTED: probable histone H2A.5-like             155   2e-44   Oryza brachyantha
ref|XP_003606634.1|  Histone H2A                                        155   2e-44   Medicago truncatula
ref|XP_006382493.1|  hypothetical protein POPTR_0005s02660g             155   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006341061.1|  PREDICTED: histone H2A-like                        155   2e-44   Solanum tuberosum [potatoes]
gb|AFK46765.1|  unknown                                                 155   3e-44   Lotus japonicus
ref|NP_001105357.1|  histone H2A                                        155   3e-44   
ref|XP_011077442.1|  PREDICTED: histone H2A                             155   3e-44   Sesamum indicum [beniseed]
ref|XP_007016497.1|  Histone H2A 12 isoform 1                           155   3e-44   
gb|AFK44015.1|  unknown                                                 155   3e-44   Lotus japonicus
ref|XP_010685819.1|  PREDICTED: histone H2A                             155   3e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010037863.1|  PREDICTED: histone H2A-like                        154   4e-44   Eucalyptus grandis [rose gum]
ref|XP_010905725.1|  PREDICTED: histone H2A                             154   4e-44   Elaeis guineensis
gb|EYU41689.1|  hypothetical protein MIMGU_mgv1a015617mg                154   4e-44   Erythranthe guttata [common monkey flower]
ref|XP_008776490.1|  PREDICTED: histone H2A                             154   4e-44   
ref|XP_010253272.1|  PREDICTED: histone H2A                             154   4e-44   Nelumbo nucifera [Indian lotus]
ref|XP_008788088.1|  PREDICTED: histone H2A-like                        154   4e-44   Phoenix dactylifera
ref|XP_010937685.1|  PREDICTED: histone H2A-like                        154   5e-44   Elaeis guineensis
gb|ACG30919.1|  histone H2A                                             155   5e-44   Zea mays [maize]
ref|XP_009628436.1|  PREDICTED: probable histone H2A.1                  154   5e-44   Nicotiana tomentosiformis
ref|XP_009419951.1|  PREDICTED: histone H2A-like                        154   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006429024.1|  hypothetical protein CICLE_v10013023mg             154   5e-44   Citrus clementina [clementine]
gb|KHG21834.1|  hypothetical protein F383_27070                         154   5e-44   Gossypium arboreum [tree cotton]
ref|XP_007206082.1|  hypothetical protein PRUPE_ppa012888mg             154   5e-44   
gb|ACG23907.1|  histone H2A                                             154   5e-44   Zea mays [maize]
ref|XP_010922382.1|  PREDICTED: histone H2A-like                        154   5e-44   Elaeis guineensis
ref|XP_004487027.1|  PREDICTED: probable histone H2A.1-like             154   5e-44   Cicer arietinum [garbanzo]
ref|XP_010025201.1|  PREDICTED: probable histone H2A.5                  154   5e-44   Eucalyptus grandis [rose gum]
gb|KJB21599.1|  hypothetical protein B456_004G004000                    154   5e-44   Gossypium raimondii
ref|XP_002463507.1|  hypothetical protein SORBIDRAFT_01g000950          154   5e-44   Sorghum bicolor [broomcorn]
ref|XP_010047429.1|  PREDICTED: histone H2A                             154   5e-44   Eucalyptus grandis [rose gum]
ref|WP_039311042.1|  hypothetical protein                               154   6e-44   Paenibacillus sp. IHB B 3415
ref|XP_009801696.1|  PREDICTED: histone H2A                             154   6e-44   Nicotiana sylvestris
ref|XP_007150300.1|  hypothetical protein PHAVU_005G141800g             154   6e-44   Phaseolus vulgaris [French bean]
ref|XP_004246465.1|  PREDICTED: histone H2A-like                        154   6e-44   Solanum lycopersicum
ref|XP_010694234.1|  PREDICTED: probable histone H2A.5                  154   6e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|ACU20753.1|  unknown                                                 154   6e-44   Glycine max [soybeans]
ref|XP_011092071.1|  PREDICTED: histone H2A.1                           154   6e-44   Sesamum indicum [beniseed]
ref|XP_004302400.1|  PREDICTED: histone H2A.1                           154   6e-44   Fragaria vesca subsp. vesca
gb|KHG05600.1|  hypothetical protein F383_01039                         154   6e-44   Gossypium arboreum [tree cotton]
gb|KHG05602.1|  putative histone H2A                                    154   6e-44   Gossypium arboreum [tree cotton]
ref|XP_007150302.1|  hypothetical protein PHAVU_005G142000g             154   6e-44   Phaseolus vulgaris [French bean]
ref|XP_010112901.1|  putative histone H2A.4                             154   6e-44   Morus notabilis
gb|KJB21524.1|  hypothetical protein B456_004G004100                    153   7e-44   Gossypium raimondii
ref|XP_003606644.1|  Histone H2A                                        157   7e-44   
gb|AHY02120.1|  histone H2A12                                           154   7e-44   Gossypium hirsutum [American cotton]
ref|NP_001043136.1|  Os01g0502700                                       154   8e-44   
ref|XP_010260089.1|  PREDICTED: histone H2A-like                        154   8e-44   Nelumbo nucifera [Indian lotus]
dbj|BAL49713.1|  fusion protein of histone 2A and enhanced yellow...    160   8e-44   Cloning vector pSolycp00001
gb|ACG31632.1|  histone H2A                                             154   8e-44   Zea mays [maize]
gb|KJB21523.1|  hypothetical protein B456_004G004100                    154   8e-44   Gossypium raimondii
ref|XP_007150306.1|  hypothetical protein PHAVU_005G142300g             154   8e-44   Phaseolus vulgaris [French bean]
ref|XP_007150301.1|  hypothetical protein PHAVU_005G141900g             154   8e-44   Phaseolus vulgaris [French bean]
ref|XP_008385149.1|  PREDICTED: histone H2A                             154   9e-44   
sp|P02276.1|H2A2_WHEAT  RecName: Full=Histone H2A.2.1                   154   9e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009409009.1|  PREDICTED: probable histone H2A.2                  154   9e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008357619.1|  PREDICTED: histone H2A-like                        154   9e-44   
gb|ACG30679.1|  histone H2A                                             154   1e-43   Zea mays [maize]
ref|XP_003558215.1|  PREDICTED: histone H2A-like                        154   1e-43   Brachypodium distachyon [annual false brome]
ref|NP_001054458.1|  Os05g0113900                                       154   1e-43   
ref|XP_011094822.1|  PREDICTED: histone H2A-like                        153   1e-43   Sesamum indicum [beniseed]
ref|XP_008648632.1|  PREDICTED: histone H2A.2.1-like                    154   1e-43   Zea mays [maize]
ref|XP_007027098.1|  Histone H2A 12                                     154   1e-43   Theobroma cacao [chocolate]
ref|XP_002512417.1|  histone h2a, putative                              153   1e-43   Ricinus communis
ref|XP_009766769.1|  PREDICTED: histone H2A                             153   1e-43   Nicotiana sylvestris
ref|XP_010443771.1|  PREDICTED: probable histone H2A.7                  153   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_002318994.2|  hypothetical protein POPTR_0013s01890g             153   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006653972.1|  PREDICTED: probable histone H2A.6-like             153   1e-43   Oryza brachyantha
emb|CDP06647.1|  unnamed protein product                                153   1e-43   Coffea canephora [robusta coffee]
gb|KHG05601.1|  putative histone H2A                                    153   1e-43   Gossypium arboreum [tree cotton]
ref|XP_006400900.1|  hypothetical protein EUTSA_v10014932mg             153   1e-43   Eutrema salsugineum [saltwater cress]
ref|XP_006400901.1|  hypothetical protein EUTSA_v10014933mg             153   1e-43   Eutrema salsugineum [saltwater cress]
ref|XP_002441223.1|  hypothetical protein SORBIDRAFT_09g022690          153   1e-43   Sorghum bicolor [broomcorn]
gb|EMT27732.1|  Histone H2A                                             153   2e-43   
gb|AFK41325.1|  unknown                                                 153   2e-43   Lotus japonicus
gb|EPS64904.1|  hypothetical protein M569_09875                         153   2e-43   Genlisea aurea
ref|NP_001183439.1|  uncharacterized protein LOC100501869               153   2e-43   Zea mays [maize]
dbj|BAK04720.1|  predicted protein                                      153   2e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009612960.1|  PREDICTED: histone H2A-like                        153   2e-43   Nicotiana tomentosiformis
ref|NP_001183143.1|  uncharacterized LOC100501512                       153   2e-43   Zea mays [maize]
gb|EMS55804.1|  Histone H2A                                             153   2e-43   Triticum urartu
gb|KDP45349.1|  hypothetical protein JCGZ_09598                         153   2e-43   Jatropha curcas
ref|XP_010929515.1|  PREDICTED: histone H2A.1-like                      152   2e-43   Elaeis guineensis
gb|ACG38394.1|  histone H2A                                             153   2e-43   Zea mays [maize]
ref|XP_002274570.1|  PREDICTED: histone H2A                             152   2e-43   Vitis vinifera
ref|XP_008807840.1|  PREDICTED: histone H2A.1-like                      152   2e-43   Phoenix dactylifera
dbj|BAK05993.1|  predicted protein                                      153   2e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG30685.1|  histone H2A                                             153   2e-43   Zea mays [maize]
ref|XP_002866356.1|  hypothetical protein ARALYDRAFT_358205             152   2e-43   Arabidopsis lyrata subsp. lyrata
gb|AFW78282.1|  hypothetical protein ZEAMMB73_348782                    153   2e-43   
ref|NP_001278724.1|  uncharacterized protein LOC100216750               153   2e-43   Zea mays [maize]
ref|XP_009350091.1|  PREDICTED: histone H2A-like                        152   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_008343478.1|  PREDICTED: histone H2A                             152   2e-43   
ref|XP_009374659.1|  PREDICTED: histone H2A-like                        152   2e-43   Pyrus x bretschneideri [bai li]
gb|ACG31676.1|  histone H2A                                             153   2e-43   Zea mays [maize]
dbj|BAA85117.1|  histone H2A-like protein                               152   2e-43   Solanum melongena [aubergine]
ref|XP_010674032.1|  PREDICTED: probable histone H2A.1                  152   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003569004.1|  PREDICTED: probable histone H2A.5                  153   3e-43   Brachypodium distachyon [annual false brome]
ref|XP_011023672.1|  PREDICTED: histone H2A.1-like                      152   3e-43   Populus euphratica
ref|XP_008387736.1|  PREDICTED: histone H2A-like                        152   3e-43   
ref|XP_008798355.1|  PREDICTED: histone H2A.1-like                      152   3e-43   Phoenix dactylifera
gb|ACG33030.1|  histone H2A                                             152   3e-43   Zea mays [maize]
gb|KDP44203.1|  hypothetical protein JCGZ_05670                         152   3e-43   Jatropha curcas
ref|XP_002459460.1|  hypothetical protein SORBIDRAFT_02g004970          152   4e-43   Sorghum bicolor [broomcorn]
gb|KFK27527.1|  hypothetical protein AALP_AA8G395100                    152   4e-43   Arabis alpina [alpine rockcress]
ref|XP_002866355.1|  hypothetical protein ARALYDRAFT_358204             152   4e-43   Arabidopsis lyrata subsp. lyrata
ref|NP_001055762.1|  Os05g0461400                                       152   4e-43   
ref|XP_011089445.1|  PREDICTED: histone H2A-like                        152   4e-43   Sesamum indicum [beniseed]
ref|XP_007147031.1|  hypothetical protein PHAVU_006G090400g             151   4e-43   Phaseolus vulgaris [French bean]
ref|XP_006279502.1|  hypothetical protein CARUB_v10027312mg             152   4e-43   
ref|XP_004961835.1|  PREDICTED: probable histone H2A.4-like             152   4e-43   Setaria italica
ref|XP_010483635.1|  PREDICTED: probable histone H2A.7                  152   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_004302773.1|  PREDICTED: histone H2A                             152   4e-43   Fragaria vesca subsp. vesca
ref|XP_004957462.1|  PREDICTED: lon protease homolog 2, peroxisom...    161   4e-43   
ref|XP_009131963.1|  PREDICTED: probable histone H2A.7                  152   5e-43   Brassica rapa
ref|XP_002439160.1|  hypothetical protein SORBIDRAFT_09g001520          152   5e-43   Sorghum bicolor [broomcorn]
sp|P25470.1|H2A1_PEA  RecName: Full=Histone H2A.1                       152   5e-43   Pisum sativum [garden pea]
ref|XP_002283971.1|  PREDICTED: histone H2A.1                           151   5e-43   Vitis vinifera
gb|EPS68090.1|  hypothetical protein M569_06682                         151   6e-43   Genlisea aurea
gb|KDO56240.1|  hypothetical protein CISIN_1g032326mg                   151   6e-43   Citrus sinensis [apfelsine]
ref|XP_006433398.1|  hypothetical protein CICLE_v10002795mg             151   6e-43   Citrus clementina [clementine]
ref|XP_009125454.1|  PREDICTED: probable histone H2A.4                  151   6e-43   Brassica rapa
ref|XP_007030982.1|  Histone H2A 7                                      151   7e-43   
ref|XP_004142082.1|  PREDICTED: probable histone H2A.4-like             151   7e-43   Cucumis sativus [cucumbers]
ref|XP_004165280.1|  PREDICTED: probable histone H2A.4-like             151   7e-43   
ref|XP_010259658.1|  PREDICTED: histone H2A.1                           151   7e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008447608.1|  PREDICTED: probable histone H2A.4                  151   7e-43   Cucumis melo [Oriental melon]
ref|XP_006381182.1|  histone H2A family protein                         151   7e-43   Populus trichocarpa [western balsam poplar]
gb|KDP23489.1|  hypothetical protein JCGZ_23322                         151   8e-43   Jatropha curcas
sp|P02277.1|H2A3_WHEAT  RecName: Full=Histone H2A.2.2                   151   9e-43   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ84992.1|  predicted protein                                      151   9e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY04858.1|  BnaAnng00400D                                          151   9e-43   
emb|CDY31587.1|  BnaA10g12840D                                          151   1e-42   Brassica napus [oilseed rape]
ref|XP_004494603.1|  PREDICTED: probable histone H2A.5-like             150   1e-42   Cicer arietinum [garbanzo]
ref|XP_006424768.1|  hypothetical protein CICLE_v10029498mg             151   1e-42   
ref|XP_010558312.1|  PREDICTED: histone H2A                             151   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_004149043.1|  PREDICTED: histone H2A-like                        150   1e-42   Cucumis sativus [cucumbers]
ref|XP_010443773.1|  PREDICTED: probable histone H2A.7                  150   1e-42   Camelina sativa [gold-of-pleasure]
dbj|BAJ87012.1|  predicted protein                                      150   1e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX71069.1|  BnaC03g11530D                                          150   1e-42   
gb|EMT13611.1|  Protein H2A.6                                           150   2e-42   
ref|XP_006398714.1|  hypothetical protein EUTSA_v10014920mg             150   2e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009126642.1|  PREDICTED: probable histone H2A.7                  150   2e-42   Brassica rapa
ref|XP_010455661.1|  PREDICTED: probable histone H2A.7 isoform X2       150   2e-42   Camelina sativa [gold-of-pleasure]
gb|EMS46915.1|  Histone H2A.1                                           150   2e-42   Triticum urartu
gb|EYU28273.1|  hypothetical protein MIMGU_mgv1a015602mg                150   2e-42   Erythranthe guttata [common monkey flower]
gb|KFK27518.1|  hypothetical protein AALP_AA8G393700                    150   2e-42   Arabis alpina [alpine rockcress]
ref|XP_004251321.2|  PREDICTED: histone H2A isoform X2                  150   2e-42   Solanum lycopersicum
gb|EPS67284.1|  hypothetical protein M569_07493                         150   2e-42   Genlisea aurea
ref|NP_200795.1|  histone H2A 6                                         150   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144786.1|  PREDICTED: probable histone H2A.5-like             149   3e-42   Cucumis sativus [cucumbers]
gb|EMT29882.1|  Histone H2A                                             150   3e-42   
ref|XP_004251320.1|  PREDICTED: histone H2A isoform X1                  150   3e-42   Solanum lycopersicum
ref|XP_011095196.1|  PREDICTED: histone H2A-like                        149   3e-42   
ref|XP_010104725.1|  putative histone H2A.5                             149   3e-42   Morus notabilis
ref|XP_006281263.1|  hypothetical protein CARUB_v10027309mg             150   3e-42   Capsella rubella
ref|XP_009392699.1|  PREDICTED: histone H2A                             150   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578017.1|  PREDICTED: histone H2A                             150   3e-42   Brachypodium distachyon [annual false brome]
ref|XP_003554652.1|  PREDICTED: probable histone H2A.5                  149   3e-42   Glycine max [soybeans]
gb|EMS62077.1|  Histone H2A                                             150   3e-42   Triticum urartu
ref|XP_002872262.1|  hypothetical protein ARALYDRAFT_489561             149   3e-42   
dbj|BAJ86067.1|  predicted protein                                      150   3e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010942329.1|  PREDICTED: histone H2A.1-like                      149   3e-42   Elaeis guineensis
gb|KFK24714.1|  hypothetical protein AALP_AA8G015200                    149   4e-42   Arabis alpina [alpine rockcress]
emb|CDP09012.1|  unnamed protein product                                150   4e-42   Coffea canephora [robusta coffee]
gb|EMT16548.1|  Protein H2A.6                                           149   4e-42   
gb|EMT21049.1|  Protein H2A.6                                           151   4e-42   
ref|XP_007206077.1|  hypothetical protein PRUPE_ppa012844mg             149   4e-42   Prunus persica
gb|EMS64812.1|  Protein H2A.6                                           149   5e-42   Triticum urartu
dbj|BAK05388.1|  predicted protein                                      149   5e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010455652.1|  PREDICTED: probable histone H2A.7 isoform X1       149   5e-42   Camelina sativa [gold-of-pleasure]
sp|Q43213.3|H2A5_WHEAT  RecName: Full=Protein H2A.5; AltName: Ful...    149   5e-42   Triticum aestivum [Canadian hard winter wheat]
emb|CDM87218.1|  unnamed protein product                                150   5e-42   Triticum aestivum [Canadian hard winter wheat]
sp|P02275.2|H2A1_WHEAT  RecName: Full=Histone H2A.1; AltName: Ful...    149   5e-42   Triticum aestivum [Canadian hard winter wheat]
gb|EEC78400.1|  hypothetical protein OsI_18189                          149   5e-42   Oryza sativa Indica Group [Indian rice]
gb|EMT17582.1|  Histone H2A.1                                           149   5e-42   
ref|XP_006848587.1|  hypothetical protein AMTR_s00168p00048800          149   6e-42   Amborella trichopoda
gb|KJB45295.1|  hypothetical protein B456_007G299000                    148   7e-42   Gossypium raimondii
ref|XP_006288848.1|  hypothetical protein CARUB_v10002193mg             149   8e-42   Capsella rubella
gb|EMT06531.1|  Protein H2A.6                                           148   8e-42   
ref|XP_010455104.1|  PREDICTED: probable histone H2A.5                  149   8e-42   Camelina sativa [gold-of-pleasure]
dbj|BAJ97579.1|  predicted protein                                      148   9e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS62078.1|  Histone H2A                                             149   9e-42   Triticum urartu
ref|XP_006288838.1|  hypothetical protein CARUB_v10002180mg             149   9e-42   Capsella rubella
gb|EMS68239.1|  Histone H2A                                             149   9e-42   Triticum urartu
dbj|BAK00643.1|  predicted protein                                      149   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q9M531.1|H2A_EUPES  RecName: Full=Histone H2A                        148   1e-41   Euphorbia esula [wolf's milk]
ref|XP_005643643.1|  histone-fold-containing protein                    147   1e-41   Coccomyxa subellipsoidea C-169
ref|XP_003568288.1|  PREDICTED: probable histone H2A.4                  149   1e-41   Brachypodium distachyon [annual false brome]
ref|NP_195876.1|  histone H2A 12                                        148   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769677.1|  histone H2A                                        148   1e-41   
dbj|BAJ96803.1|  predicted protein                                      149   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY05567.1|  BnaA02g31240D                                          148   1e-41   
dbj|BAK04939.1|  predicted protein                                      148   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010493993.1|  PREDICTED: probable histone H2A.5                  148   1e-41   Camelina sativa [gold-of-pleasure]
gb|ACG24751.1|  histone H2A                                             148   1e-41   Zea mays [maize]
ref|XP_008454292.1|  PREDICTED: probable histone H2A.5                  148   1e-41   Cucumis melo [Oriental melon]
ref|XP_009120510.1|  PREDICTED: probable histone H2A.7                  148   1e-41   Brassica rapa
dbj|BAJ95629.1|  predicted protein                                      148   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001764943.1|  histone H2A                                        148   1e-41   
gb|EMT24733.1|  Protein H2A.6                                           148   1e-41   
gb|EMT12804.1|  Histone                                                 148   1e-41   
ref|XP_010421587.1|  PREDICTED: probable histone H2A.5                  148   1e-41   Camelina sativa [gold-of-pleasure]
ref|NP_001141182.1|  uncharacterized LOC100273269                       148   2e-41   Zea mays [maize]
ref|XP_005646408.1|  histone-fold-containing protein                    147   2e-41   Coccomyxa subellipsoidea C-169
ref|XP_010521817.1|  PREDICTED: histone H2A-like                        148   2e-41   Tarenaya hassleriana [spider flower]
gb|ACG36457.1|  histone H2A                                             148   2e-41   Zea mays [maize]
gb|EYU18948.1|  hypothetical protein MIMGU_mgv1a015624mg                148   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_010452100.1|  PREDICTED: probable histone H2A.4                  148   2e-41   Camelina sativa [gold-of-pleasure]
emb|CDY25028.1|  BnaC02g39800D                                          147   2e-41   Brassica napus [oilseed rape]
gb|ACG33355.1|  histone H2A                                             147   2e-41   Zea mays [maize]
gb|EYU41690.1|  hypothetical protein MIMGU_mgv1a015546mg                147   2e-41   Erythranthe guttata [common monkey flower]
sp|P40281.1|H2A2_PEA  RecName: Full=Histone H2A.2                       147   2e-41   Pisum sativum [garden pea]
gb|EMT33769.1|  Histone H2A                                             147   2e-41   
ref|XP_010490717.1|  PREDICTED: probable histone H2A.4                  147   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010557294.1|  PREDICTED: histone H2A-like                        147   3e-41   Tarenaya hassleriana [spider flower]
ref|NP_198119.1|  histone H2A 7                                         147   3e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK07505.1|  predicted protein                                      147   3e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009129873.1|  PREDICTED: probable histone H2A.5                  147   3e-41   Brassica rapa
gb|EMS51250.1|  Histone H2A                                             147   4e-41   Triticum urartu
gb|EMT17934.1|  Histone H2A                                             147   4e-41   
dbj|BAJ98455.1|  predicted protein                                      147   4e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q43214.3|H2A6_WHEAT  RecName: Full=Protein H2A.6; AltName: Ful...    146   5e-41   Triticum aestivum [Canadian hard winter wheat]
gb|AAB00193.1|  histone H2A                                             146   5e-41   Triticum aestivum [Canadian hard winter wheat]
emb|CDY19730.1|  BnaA09g03830D                                          146   5e-41   Brassica napus [oilseed rape]
ref|XP_005645131.1|  histone-fold-containing protein                    146   5e-41   Coccomyxa subellipsoidea C-169
ref|XP_003558214.1|  PREDICTED: histone H2A-like                        147   5e-41   Brachypodium distachyon [annual false brome]
ref|XP_005848689.1|  hypothetical protein CHLNCDRAFT_21904              146   6e-41   Chlorella variabilis
ref|XP_005843638.1|  hypothetical protein CHLNCDRAFT_54972              145   6e-41   Chlorella variabilis
ref|XP_005843094.1|  hypothetical protein CHLNCDRAFT_28450              145   6e-41   Chlorella variabilis
gb|KFK26491.1|  hypothetical protein AALP_AA8G255900                    146   6e-41   
ref|XP_009111748.1|  PREDICTED: probable histone H2A.5                  146   6e-41   
ref|XP_003626258.1|  Histone H2A                                        146   6e-41   
emb|CAB53509.1|  histone H2A                                            146   7e-41   
dbj|BAK07726.1|  predicted protein                                      146   7e-41   
emb|CDX99975.1|  BnaC09g03260D                                          146   8e-41   
dbj|BAK00739.1|  predicted protein                                      146   1e-40   
ref|XP_010550981.1|  PREDICTED: probable histone H2A.5                  145   1e-40   
gb|EMS66698.1|  Histone H2A.1                                           145   1e-40   
ref|XP_006394950.1|  hypothetical protein EUTSA_v10005083mg             145   1e-40   
gb|EMS52207.1|  Protein H2A.6                                           149   1e-40   
gb|ACG31268.1|  histone H2A                                             145   2e-40   
ref|XP_009151192.1|  PREDICTED: probable histone H2A.5                  145   2e-40   
emb|CDX86146.1|  BnaA06g28630D                                          144   3e-40   
gb|KDD72215.1|  hypothetical protein H632_c3686p0                       143   3e-40   
dbj|BAJ95543.1|  predicted protein                                      144   3e-40   
gb|EMS49485.1|  Protein H2A.6                                           147   3e-40   
gb|EMS50484.1|  Histone H2A                                             144   4e-40   
gb|EMT10820.1|  Histone H2A                                             144   4e-40   
ref|XP_010455640.1|  PREDICTED: probable histone H2A.7                  144   4e-40   
gb|ABD16410.1|  HTA6-sGFP                                               150   5e-40   
gb|ABD16408.1|  HTA6-EYFP                                               150   5e-40   
gb|AEG42342.1|  HTA6-sGFP fusion protein                                150   6e-40   
gb|ABK23043.1|  unknown                                                 144   6e-40   
gb|KDD72183.1|  hypothetical protein H632_c3733p0                       143   6e-40   
gb|ABK26850.1|  unknown                                                 143   6e-40   
ref|XP_011397773.1|  Histone H2A                                        142   9e-40   
ref|XP_006855540.1|  hypothetical protein AMTR_s00057p00215390          143   1e-39   
ref|XP_010249362.1|  PREDICTED: histone H2A-beta, sperm-like            143   1e-39   
ref|XP_011398096.1|  Histone H2A                                        142   1e-39   
gb|EMT12331.1|  Histone H2A                                             143   1e-39   
ref|XP_006650512.1|  PREDICTED: probable histone H2AXa-like             142   1e-39   
ref|XP_011398542.1|  Histone H2A                                        142   1e-39   
gb|EMT06530.1|  Histone H2A                                             143   1e-39   
ref|XP_002271506.1|  PREDICTED: histone H2AX                            142   2e-39   
gb|EWM29644.1|  histone-fold-containing protein                         141   3e-39   
ref|XP_005852170.1|  hypothetical protein CHLNCDRAFT_48410              141   3e-39   
ref|XP_002949393.1|  hypothetical protein VOLCADRAFT_101861             141   3e-39   
ref|XP_005847129.1|  hypothetical protein CHLNCDRAFT_52799              140   4e-39   
gb|ABR17403.1|  unknown                                                 141   4e-39   
ref|XP_008388545.1|  PREDICTED: histone H2A.1-like                      143   5e-39   
ref|XP_004025195.1|  hypothetical protein IMG5_190380                   141   5e-39   
ref|XP_004164644.1|  PREDICTED: LOW QUALITY PROTEIN: histone H2A....    141   5e-39   
gb|EWM21571.1|  histone-fold-containing protein                         141   5e-39   
gb|KJB26398.1|  hypothetical protein B456_004G239900                    141   5e-39   
gb|KHG21861.1|  hypothetical protein F383_10239                         141   5e-39   
ref|XP_004148213.1|  PREDICTED: LOW QUALITY PROTEIN: histone H2A....    141   6e-39   
gb|ABK27024.1|  unknown                                                 141   6e-39   
gb|ABR17094.1|  unknown                                                 141   7e-39   
ref|XP_011401684.1|  Histone H3.1                                       144   7e-39   
ref|XP_002948600.1|  hypothetical protein VOLCADRAFT_80244              142   7e-39   
ref|XP_008246410.1|  PREDICTED: histone H2A, sperm-like                 142   7e-39   
gb|ADE77580.1|  unknown                                                 140   9e-39   
ref|XP_005643617.1|  histone-fold-containing protein                    140   1e-38   
ref|XP_002945852.1|  histone H2A                                        140   1e-38   
ref|XP_004031379.1|  hypothetical protein IMG5_140410                   140   1e-38   
ref|XP_002947993.1|  histone H2A                                        140   1e-38   
ref|XP_002948138.1|  histone H2A                                        140   1e-38   
gb|KGN47362.1|  Histone H2A                                             141   1e-38   
ref|XP_001697820.1|  histone H2A                                        139   1e-38   
ref|XP_002946107.1|  histone H2A                                        139   1e-38   
ref|XP_007143975.1|  hypothetical protein PHAVU_007G118400g             140   1e-38   
gb|EMT17897.1|  Histone H2A.1                                           140   1e-38   
ref|XP_001026177.1|  Core histone H2A/H2B/H3/H4 family protein          140   2e-38   
ref|XP_002948271.1|  histone H2A                                        139   2e-38   
ref|XP_002951795.1|  histone H2A                                        139   2e-38   
sp|P02274.2|H2A1_TETPY  RecName: Full=Histone H2A.1; AltName: Ful...    139   2e-38   
ref|XP_007205943.1|  hypothetical protein PRUPE_ppa011799mg             141   2e-38   
ref|XP_001690809.1|  histone H2A                                        139   2e-38   
sp|P02273.2|H2AX_TETPY  RecName: Full=Histone H2AX; AltName: Full...    139   2e-38   
prf||0906228B  histone H2A(2)                                           139   2e-38
ref|XP_002956799.1|  histone H2A                                        139   2e-38   
ref|XP_001692945.1|  histone H2A                                        139   2e-38   
ref|XP_001690672.1|  histone H2A                                        139   2e-38   
ref|XP_001691545.1|  histone H2A                                        139   2e-38   
ref|XP_004030209.1|  hypothetical protein IMG5_165690                   139   2e-38   
ref|XP_004037461.1|  hypothetical protein IMG5_051530                   139   2e-38   
ref|XP_002772191.1|  histone H2A.1, putative                            140   2e-38   
ref|XP_001696261.1|  histone H2A                                        139   2e-38   
prf||0906228A  histone H2A(1)                                           139   2e-38
ref|XP_002772586.1|  histone H2A.1, putative                            140   2e-38   
ref|XP_002956803.1|  histone H2A                                        139   2e-38   
ref|XP_002783742.1|  histone H2A.1, putative                            140   3e-38   
gb|ABK25862.1|  unknown                                                 139   3e-38   
ref|XP_001021342.1|  Core histone H2A/H2B/H3/H4 family protein          139   3e-38   
gb|EMT32584.1|  Histone H2AX                                            139   3e-38   
ref|XP_009780648.1|  PREDICTED: histone H2AX-like                       139   3e-38   
gb|ADE76480.1|  unknown                                                 139   3e-38   
ref|XP_002906921.1|  histone H2A type 1                                 139   3e-38   
ref|XP_002767005.1|  histone H2A.1, putative                            139   3e-38   
ref|XP_009516110.1|  hypothetical protein PHYSODRAFT_322459             139   3e-38   
ref|XP_001609714.1|  Histone H2A protein                                139   4e-38   
ref|XP_011396350.1|  putative histone H2A.1                             138   4e-38   
gb|ABK25428.1|  unknown                                                 139   4e-38   
ref|XP_002785171.1|  histone H2A.1, putative                            138   4e-38   
gb|ABK27117.1|  unknown                                                 139   4e-38   
gb|KIZ00861.1|  Histone H2A                                             138   4e-38   
ref|XP_006352795.1|  PREDICTED: histone H2AX-like                       139   5e-38   
gb|AEX11381.1|  hypothetical protein 0_13794_01                         138   5e-38   
ref|XP_002765954.1|  histone H2A.1, putative                            138   5e-38   
ref|XP_002784006.1|  histone H2A.1, putative                            138   5e-38   
gb|ABR16040.1|  unknown                                                 138   6e-38   
emb|CDR95029.1|  Histone H2A protein, putative                          138   6e-38   
ref|XP_004242321.2|  PREDICTED: histone H2AX-like                       138   6e-38   
ref|XP_008895586.1|  histone H2A.X                                      138   6e-38   
ref|XP_004493627.1|  PREDICTED: probable histone H2AXb-like             138   6e-38   
ref|XP_002777399.1|  histone H2A.1, putative                            138   7e-38   
ref|XP_002906920.1|  histone H2A                                        138   7e-38   
gb|KIZ03565.1|  Histone H2AX                                            137   8e-38   
gb|ACF83743.1|  unknown                                                 143   9e-38   
ref|XP_002776950.1|  histone H2A.1, putative                            137   1e-37   
ref|XP_009516109.1|  hypothetical protein PHYSODRAFT_349254             137   1e-37   
ref|XP_004148882.1|  PREDICTED: histone H2AX-like                       138   1e-37   
gb|EMT31655.1|  Putative histone H2AXb                                  137   1e-37   
gb|ACG30024.1|  histone H2A                                             138   1e-37   
ref|XP_002443276.1|  hypothetical protein SORBIDRAFT_08g016830          137   1e-37   
ref|XP_008451416.1|  PREDICTED: histone H2AX-like                       137   1e-37   
gb|KIY91489.1|  Histone H2A                                             137   1e-37   
gb|EMT03189.1|  Protein H2A.6                                           137   2e-37   
ref|XP_006664071.1|  PREDICTED: probable histone H2AXb-like             136   3e-37   
ref|XP_010112701.1|  Histone H2AX                                       137   3e-37   
gb|KIY96584.1|  Histone H2A                                             136   3e-37   
ref|XP_009618732.1|  PREDICTED: histone H2AX-like                       137   3e-37   
ref|XP_003521229.1|  PREDICTED: histone H2AX                            137   3e-37   
ref|XP_010108156.1|  Histone H2A.1                                      137   3e-37   
ref|XP_002506581.1|  histone H2A                                        136   4e-37   
gb|ETP36181.1|  histone H2A.X                                           137   4e-37   
gb|KHG05005.1|  Histone H2AX                                            136   4e-37   
ref|NP_001051106.1|  Os03g0721900                                       136   4e-37   
emb|CBM82509.1|  histone H2A replacement protein                        135   5e-37   
ref|XP_003554230.1|  PREDICTED: probable histone H2AXa-like             136   5e-37   
ref|XP_002595082.1|  hypothetical protein BRAFLDRAFT_115227             136   5e-37   
ref|XP_002158325.1|  PREDICTED: histone H2A-like                        135   5e-37   
ref|XP_004830907.1|  histone H2a, putative                              135   5e-37   
ref|XP_002520712.1|  histone h2a, putative                              136   6e-37   
ref|XP_002501402.1|  histone H2A                                        135   6e-37   
gb|EMS55374.1|  putative histone H2AXa                                  135   6e-37   
ref|XP_010668325.1|  PREDICTED: histone H2A-beta, sperm-like            135   7e-37   
gb|EMT03043.1|  Histone H2A                                             139   7e-37   
ref|XP_004981945.1|  PREDICTED: probable histone H2AXa-like             135   7e-37   
ref|XP_010455694.1|  PREDICTED: probable histone H2A.7                  136   7e-37   
ref|XP_002503630.1|  histone H2A                                        135   7e-37   
gb|ELU01212.1|  hypothetical protein CAPTEDRAFT_125227                  135   7e-37   
ref|XP_007050739.1|  Gamma histone variant H2AX                         135   7e-37   
ref|XP_010237215.1|  PREDICTED: probable histone H2AXb                  135   8e-37   
emb|CBJ32077.1|  histone H2A isoform 2                                  135   8e-37   
emb|CBJ48885.1|  histone H2A (ISS)                                      135   8e-37   
ref|XP_002961374.1|  hypothetical protein SELMODRAFT_76653              135   8e-37   
ref|XP_763957.1|  histone H2A                                           135   8e-37   
gb|ACJ70461.1|  putative histone                                        135   8e-37   
ref|XP_002466553.1|  hypothetical protein SORBIDRAFT_01g009820          135   8e-37   
ref|XP_011311688.1|  PREDICTED: histone H2A                             135   9e-37   
ref|XP_011313770.1|  PREDICTED: histone H2A-like                        135   9e-37   
gb|EJY86268.1|  Histone H2A-III                                         135   9e-37   
ref|XP_008644553.1|  PREDICTED: probable histone H2AXa                  135   9e-37   
ref|XP_009692449.1|  late histone H2A.2.2                               135   1e-36   
gb|ACG49233.1|  histone H2A                                             135   1e-36   
ref|XP_001608288.1|  PREDICTED: histone H2A                             134   1e-36   
ref|NP_999718.1|  late histone H2A.L3                                   134   1e-36   
ref|XP_008550838.1|  PREDICTED: histone H2A                             134   1e-36   
ref|XP_008545617.1|  PREDICTED: histone H2A-like                        134   1e-36   
ref|XP_008560080.1|  PREDICTED: histone H2A                             134   1e-36   
ref|XP_002595192.1|  hypothetical protein BRAFLDRAFT_129784             134   1e-36   
gb|KEJ83000.1|  Histone H2A                                             135   1e-36   
gb|EJK52562.1|  hypothetical protein THAOC_28150                        134   1e-36   
ref|XP_002179202.1|  histone H2A isoform 3a                             134   1e-36   
ref|XP_005715904.1|  Histone H2A                                        134   1e-36   
ref|XP_008557954.1|  PREDICTED: histone H2A                             134   1e-36   
ref|XP_008557953.1|  PREDICTED: histone H2A                             134   1e-36   
gb|ACU20713.1|  unknown                                                 135   1e-36   
ref|XP_007162367.1|  hypothetical protein PHAVU_001G146100g             135   1e-36   
gb|EAZ28409.1|  hypothetical protein OsJ_12389                          135   1e-36   
ref|XP_001600014.1|  PREDICTED: histone H2A                             135   1e-36   
gb|ABK93238.1|  unknown                                                 135   1e-36   
ref|XP_010511579.1|  PREDICTED: probable histone H2AXb                  135   1e-36   
ref|XP_010500675.1|  PREDICTED: probable histone H2A.1                  134   1e-36   
sp|P35063.1|H2AX_PICAB  RecName: Full=Histone H2AX                      134   2e-36   
emb|CDP03574.1|  unnamed protein product                                135   2e-36   
ref|XP_006303412.1|  hypothetical protein CARUB_v10010618mg             134   2e-36   
ref|NP_175517.1|  histone H2A 10                                        134   2e-36   
gb|KJB25894.1|  hypothetical protein B456_004G214100                    136   2e-36   
emb|CBM82446.1|  histone H2A-II protein                                 134   2e-36   
ref|XP_009412074.1|  PREDICTED: histone H2AX-like                       134   2e-36   
ref|XP_009412003.1|  PREDICTED: probable histone H2A.2                  134   2e-36   
gb|KJB25893.1|  hypothetical protein B456_004G214100                    134   2e-36   
ref|XP_006844934.1|  hypothetical protein AMTR_s00058p00158560          134   2e-36   
ref|XP_009420540.1|  PREDICTED: probable histone H2A.2                  134   2e-36   
gb|KHG15784.1|  hypothetical protein F383_22140                         134   2e-36   
ref|NP_172363.1|  putative histone H2AXa                                134   2e-36   
ref|XP_001762476.1|  histone H2A                                        134   2e-36   
emb|CDM81473.1|  unnamed protein product                                134   2e-36   
ref|NP_001066920.1|  Os12g0530000                                       134   2e-36   
emb|CBM82439.1|  histone H2A.X-I protein                                134   2e-36   
gb|EJK74336.1|  hypothetical protein THAOC_03987                        134   2e-36   
ref|XP_008560150.1|  PREDICTED: histone H2A-like                        134   2e-36   
gb|ACN41027.1|  unknown                                                 134   2e-36   
tpg|DAA51076.1|  TPA: hypothetical protein ZEAMMB73_630367              134   2e-36   
ref|XP_008477669.1|  PREDICTED: histone H2A-like                        134   2e-36   
ref|XP_009107182.1|  PREDICTED: probable histone H2A.1                  134   2e-36   
gb|KFK39387.1|  hypothetical protein AALP_AA3G238600                    134   2e-36   
emb|CEF99821.1|  Histone core                                           134   2e-36   
gb|ABK24084.1|  unknown                                                 134   2e-36   
sp|P02268.2|H2A_SEPOF  RecName: Full=Histone H2A                        134   2e-36   
ref|XP_010686931.1|  PREDICTED: histone H2A.6-like                      134   2e-36   
sp|P19178.2|H2A_PLADU  RecName: Full=Histone H2A                        134   2e-36   
ref|NP_175868.1|  gamma histone variant H2AX                            134   2e-36   
gb|ELT88487.1|  hypothetical protein CAPTEDRAFT_147401                  134   2e-36   
emb|CBM82444.1|  histone H2A-I protein                                  134   2e-36   
ref|XP_624700.1|  PREDICTED: histone H2A-like isoform 6                 134   2e-36   
ref|XP_003706155.1|  PREDICTED: histone H2A-like                        134   2e-36   
ref|XP_002738085.1|  PREDICTED: histone H2A-like                        134   2e-36   
ref|XP_003394856.1|  PREDICTED: histone H2A-like                        134   2e-36   
ref|XP_001606447.1|  PREDICTED: histone H2A                             134   2e-36   
ref|XP_009393243.1|  PREDICTED: histone H2AX                            134   2e-36   
ref|XP_003054974.1|  histone H2A                                        134   2e-36   
gb|ELT95147.1|  hypothetical protein CAPTEDRAFT_203037                  134   2e-36   
gb|ELT91190.1|  hypothetical protein CAPTEDRAFT_128452                  134   3e-36   
ref|XP_008479070.1|  PREDICTED: histone H2A                             134   3e-36   
gb|ELT88272.1|  hypothetical protein CAPTEDRAFT_142841                  134   3e-36   
ref|XP_001419342.1|  predicted protein                                  133   3e-36   
gb|ABW86651.1|  histone H2A                                             134   3e-36   



>ref|XP_009629096.1| PREDICTED: histone H2A.1 [Nicotiana tomentosiformis]
Length=149

 Score =   164 bits (415),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKS+KAGLQFPVGRIAR+LKKGRYAQR GTGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTKSVKAGLQFPVGRIARFLKKGRYAQRVGTGAPIYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRHVLLAVRNDEELGKLLSGVTIA+GGVLPNINPVLLP
Sbjct  84   KKSRIIPRHVLLAVRNDEELGKLLSGVTIASGGVLPNINPVLLP  127



>ref|XP_009778270.1| PREDICTED: histone H2A.1 [Nicotiana sylvestris]
 dbj|BAC53941.1| H2A histone [Nicotiana tabacum]
Length=148

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKS+KAGLQFPVGRIAR+LKKGRYAQR G+GAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVTKSVKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRHVLLAVRNDEELGKLLSGVTIA+GGVLPNINPVLLP
Sbjct  83   KKSRIIPRHVLLAVRNDEELGKLLSGVTIASGGVLPNINPVLLP  126



>ref|XP_004230227.1| PREDICTED: histone H2A.1 [Solanum lycopersicum]
 sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Full=LeH2A-1 [Solanum lycopersicum]
 gb|AES12482.1| putative histone 2A protein [Solanum lycopersicum]
Length=146

 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKSIKAGLQFPVGRI RYLKKGRYAQR G+GAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRHVLLAVRNDEELGKLL+GVTIA+GGVLPNINPVLLP
Sbjct  81   KKSRIIPRHVLLAVRNDEELGKLLAGVTIASGGVLPNINPVLLP  124



>ref|XP_002465460.1| hypothetical protein SORBIDRAFT_01g039250 [Sorghum bicolor]
 gb|EER92458.1| hypothetical protein SORBIDRAFT_01g039250 [Sorghum bicolor]
Length=160

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  29   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  88

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLLSGVTIA GGVLPNINPVLLP
Sbjct  89   KKTRIIPRHVLLAIRNDEELGKLLSGVTIAHGGVLPNINPVLLP  132



>ref|XP_002465459.1| hypothetical protein SORBIDRAFT_01g039240 [Sorghum bicolor]
 gb|EER92457.1| hypothetical protein SORBIDRAFT_01g039240 [Sorghum bicolor]
Length=159

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLLSGVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLSGVTIAHGGVLPNINPVLLP  131



>ref|XP_006344647.1| PREDICTED: histone H2A.1-like [Solanum tuberosum]
Length=146

 Score =   159 bits (402),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKSIKAGLQFPVGRI RYLKKGRYAQR G+GAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRHVLLAVRNDEELGKLL+GVTIA+GGVLPNINP+LLP
Sbjct  81   KKSRIIPRHVLLAVRNDEELGKLLAGVTIASGGVLPNINPILLP  124



>gb|ACG24462.1| histone H2A [Zea mays]
Length=156

 Score =   159 bits (403),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLLSGVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLSGVTIAHGGVLPNINPVLLP  131



>ref|NP_001183510.1| uncharacterized LOC100501984 [Zea mays]
 gb|ACG25126.1| histone H2A [Zea mays]
 gb|ACG36235.1| histone H2A [Zea mays]
 gb|ACG36361.1| histone H2A [Zea mays]
 gb|ACG43354.1| histone H2A [Zea mays]
 gb|ACR37193.1| unknown [Zea mays]
 gb|ACR37779.1| unknown [Zea mays]
 tpg|DAA59872.1| TPA: histone H2A [Zea mays]
Length=156

 Score =   159 bits (403),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLLSGVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLSGVTIAHGGVLPNINPVLLP  131



>ref|XP_004487028.1| PREDICTED: probable histone H2A.2-like [Cicer arietinum]
Length=150

 Score =   159 bits (402),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNINP+LLP
Sbjct  83   KKNRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNINPILLP  126



>ref|XP_008388544.1| PREDICTED: histone H2A.1-like [Malus domestica]
Length=148

 Score =   159 bits (401),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRIAR+LKKGRYAQR GTGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVSKSVKAGLQFPVGRIARFLKKGRYAQRTGTGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI PRHVLLAVRNDEELGKLL+GVTIA+GGVLPNINPVLLP
Sbjct  81   KKTRINPRHVLLAVRNDEELGKLLAGVTIASGGVLPNINPVLLP  124



>ref|XP_008448380.1| PREDICTED: histone H2A [Cucumis melo]
Length=149

 Score =   159 bits (401),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V++S+KAGLQFPVGRIARYLKKGRYAQR GTGAPVYLAAV+EYLAAEVLELAGNAARDN
Sbjct  22   AVSRSVKAGLQFPVGRIARYLKKGRYAQRVGTGAPVYLAAVMEYLAAEVLELAGNAARDN  81

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLA+RNDEELGKLL+GVTIA+GGVLPNINPVLLP
Sbjct  82   KKNRIIPRHVLLAIRNDEELGKLLAGVTIASGGVLPNINPVLLP  125



>ref|XP_002462725.1| hypothetical protein SORBIDRAFT_02g030950 [Sorghum bicolor]
 gb|EER99246.1| hypothetical protein SORBIDRAFT_02g030950 [Sorghum bicolor]
Length=157

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  26   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KKTRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  129



>ref|XP_003629797.1| Histone H2A [Medicago truncatula]
 gb|AET04273.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AFK39807.1| unknown [Medicago truncatula]
Length=150

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  127



>ref|XP_004970473.1| PREDICTED: histone H2A-like [Setaria italica]
Length=159

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  131



>ref|XP_007206079.1| hypothetical protein PRUPE_ppa012864mg [Prunus persica]
 gb|EMJ07278.1| hypothetical protein PRUPE_ppa012864mg [Prunus persica]
Length=151

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRIAR+LKKGRYAQR GTGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVSKSVKAGLQFPVGRIARFLKKGRYAQRTGTGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  81   KKTRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNINPVLLP  124



>ref|XP_004970471.1| PREDICTED: histone H2A-like [Setaria italica]
Length=157

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  26   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KKTRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  129



>ref|XP_008246411.1| PREDICTED: histone H2A.1-like [Prunus mume]
Length=148

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRIAR+LKKGRYAQR GTGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVSKSVKAGLQFPVGRIARFLKKGRYAQRTGTGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  81   KKTRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNINPVLLP  124



>ref|XP_004487029.1| PREDICTED: probable histone H2A.1-like [Cicer arietinum]
Length=149

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  83   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|XP_011036853.1| PREDICTED: probable histone H2A.5 [Populus euphratica]
Length=145

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  87   MEAVSkttkgaggrkggerkkSVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvyla  266
            MEA +K TKGAGGR+GG+RKKSV+KSIKAGLQFPVGRI+R+LKKGRYAQR G+GAP+Y+A
Sbjct  1    MEATTKATKGAGGRRGGDRKKSVSKSIKAGLQFPVGRISRFLKKGRYAQRLGSGAPIYMA  60

Query  267  avleylaaevlelaGNAARDNKKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNIN  446
            AVLEYLAAEVLELAGNAARDNKKTRI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNIN
Sbjct  61   AVLEYLAAEVLELAGNAARDNKKTRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNIN  120

Query  447  PVLLP  461
            PVLLP
Sbjct  121  PVLLP  125



>ref|XP_008345605.1| PREDICTED: histone H2A.1-like [Malus domestica]
Length=149

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRIAR+LKKGRYAQR GTGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVSKSVKAGLQFPVGRIARFLKKGRYAQRTGTGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI PRH+LLAVRNDEELGKLL+GVTIA+GGVLPNINPVLLP
Sbjct  81   KKTRINPRHLLLAVRNDEELGKLLAGVTIASGGVLPNINPVLLP  124



>ref|XP_003597343.1| Histone H2A [Medicago truncatula]
 sp|Q2HU65.1|H2A2_MEDTR RecName: Full=Probable histone H2A.2 [Medicago truncatula]
 gb|ABD32280.1| Histone H2A; Histone-fold [Medicago truncatula]
 gb|AES67594.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AFK48361.1| unknown [Medicago truncatula]
 gb|AFK48541.1| unknown [Medicago truncatula]
Length=153

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  83   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_009376634.1| PREDICTED: histone H2A.1 [Pyrus x bretschneideri]
Length=149

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRIAR+LKKGRYAQR GTGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVSKSVKAGLQFPVGRIARFLKKGRYAQRTGTGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI PRH+LLAVRNDEELGKLL+GVTIA+GGVLPNINPVLLP
Sbjct  81   KKTRINPRHLLLAVRNDEELGKLLAGVTIASGGVLPNINPVLLP  124



>sp|P19177.1|H2A_PETCR RecName: Full=Histone H2A [Petroselinum crispum]
 emb|CAA37828.1| unnamed protein product [Petroselinum crispum]
Length=149

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  22   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  81

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRNDEELGKLL+GVT A GGVLPNINPVLLP
Sbjct  82   KKTRIIPRHLLLAVRNDEELGKLLAGVTFAHGGVLPNINPVLLP  125



>ref|NP_001288376.1| histone H2A [Zea mays]
 gb|ACF83318.1| unknown [Zea mays]
 gb|ACG31563.1| histone H2A [Zea mays]
 gb|ACG45898.1| histone H2A [Zea mays]
 gb|AFW88795.1| histone2A1 [Zea mays]
Length=159

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLGGVTIAHGGVLPNINPVLLP  131



>gb|ACG25089.1| histone H2A [Zea mays]
 gb|ACG27254.1| histone H2A [Zea mays]
 gb|ACG30890.1| histone H2A [Zea mays]
Length=159

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLGGVTIAHGGVLPNINPVLLP  131



>gb|KEH30172.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=148

 Score =   157 bits (397),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KKNRIIPRHVLLAVRNDEELGKLLNGVTIAHGGVLPNINPILLP  127



>gb|ACG30889.1| histone H2A [Zea mays]
Length=159

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLGGVTIAHGGVLPNINPVLLP  131



>ref|XP_004294587.1| PREDICTED: histone H2A-like [Fragaria vesca subsp. vesca]
Length=156

 Score =   157 bits (398),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SIKAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTRSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNINP+LLP
Sbjct  84   KKTRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINPILLP  127



>ref|XP_009769039.1| PREDICTED: histone H2A-like [Nicotiana sylvestris]
Length=145

 Score =   157 bits (396),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V++S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYL+AVLEYLAAEVLELAGNAARDN
Sbjct  18   AVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLSAVLEYLAAEVLELAGNAARDN  77

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  78   KKTRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  121



>ref|XP_009626972.1| PREDICTED: histone H2A [Nicotiana tomentosiformis]
Length=145

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V++S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYL+AVLEYLAAEVLELAGNAARDN
Sbjct  18   AVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLSAVLEYLAAEVLELAGNAARDN  77

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  78   KKTRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  121



>ref|NP_001281214.1| uncharacterized protein LOC103504712 [Zea mays]
 gb|ACG30047.1| histone H2A [Zea mays]
 gb|ACG30600.1| histone H2A [Zea mays]
 gb|ACG30650.1| histone H2A [Zea mays]
 gb|ACG30709.1| histone H2A [Zea mays]
 gb|ACG31773.1| histone H2A [Zea mays]
 tpg|DAA58614.1| TPA: histone H2A [Zea mays]
Length=159

 Score =   157 bits (397),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIVPRHVLLAIRNDEELGKLLTGVTIAHGGVLPNINPVLLP  131



>gb|AAT08680.1| histone H2A [Hyacinthus orientalis]
Length=152

 Score =   157 bits (396),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGR+ RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSRSVKAGLQFPVGRLGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  83   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|AAT08677.1| histone H2A [Hyacinthus orientalis]
Length=152

 Score =   157 bits (396),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGR+ RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSRSVKAGLQFPVGRLGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  83   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|ACG33265.1| histone H2A [Zea mays]
Length=159

 Score =   157 bits (396),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIVPRHVLLAIRNDEELGKLLTGVTIAHGGVLPNINPVLLP  131



>ref|XP_004984759.1| PREDICTED: histone H2A-like [Setaria italica]
Length=159

 Score =   157 bits (396),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELG+LL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGRLLAGVTIAHGGVLPNINPVLLP  131



>gb|KEH30201.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=148

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KKNRIIPRHVLLAVRNDEELGKLLNGVTIAHGGVLPNINPILLP  127



>gb|ACG30023.1| histone H2A [Zea mays]
Length=159

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVY AAVLEYLAAEVLELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYPAAVLEYLAAEVLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIVPRHVLLAIRNDEELGKLLTGVTIAHGGVLPNINPVLLP  131



>ref|XP_002533104.1| histone h2a, putative [Ricinus communis]
 gb|EEF29276.1| histone h2a, putative [Ricinus communis]
Length=150

 Score =   156 bits (394),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S++AGLQFPVGRI RYLKKGRYAQR GTGAPVY+AAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_002533102.1| histone h2a, putative [Ricinus communis]
 gb|EEF29274.1| histone h2a, putative [Ricinus communis]
Length=150

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S++AGLQFPVGRI RYLKKGRYAQR GTGAPVY+AAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|AES88841.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=148

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDE+LGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KKNRIIPRHVLLAVRNDEDLGKLLNGVTIAHGGVLPNINPILLP  127



>emb|CDP19528.1| unnamed protein product [Coffea canephora]
Length=145

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VTKS+KAGLQFPVGRIARYLKKGRYAQR G GAP+Y+AAVLEYLAAEVLELAGNAARDN
Sbjct  21   AVTKSVKAGLQFPVGRIARYLKKGRYAQRTGIGAPIYMAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  81   KKNRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNINPVLLP  124



>ref|XP_003607007.1| Histone H2A [Medicago truncatula]
 sp|Q1S053.1|H2A3_MEDTR RecName: Full=Probable histone H2A.3 [Medicago truncatula]
 gb|AES89204.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=152

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRH+LLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KKNRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  127



>gb|AFK43066.1| unknown [Medicago truncatula]
Length=148

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTG PVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGVPVYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KKNRIIPRHVLLAVRNDEELGKLLNGVTIAHGGVLPNINPILLP  127



>ref|XP_002284305.1| PREDICTED: histone H2A [Vitis vinifera]
 emb|CAN60181.1| hypothetical protein VITISV_014244 [Vitis vinifera]
 emb|CBI16178.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNINPVLLP  126



>ref|XP_003597346.1| Histone H2A [Medicago truncatula]
 sp|Q2HU68.1|H2A1_MEDTR RecName: Full=Probable histone H2A.1 [Medicago truncatula]
 gb|ABD32277.1| Histone H2A; Histone-fold [Medicago truncatula]
 gb|AES67597.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AFK47235.1| unknown [Medicago truncatula]
Length=148

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S +AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  22   SVTRSTRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  81

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  82   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  125



>ref|NP_001239884.1| uncharacterized protein LOC100784431 [Glycine max]
 gb|ACU24250.1| unknown [Glycine max]
 gb|KHN30193.1| Histone H2A [Glycine soja]
Length=148

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_003547405.1| PREDICTED: histone H2A-like [Glycine max]
 gb|KHN33403.1| Histone H2A [Glycine soja]
Length=149

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|NP_001237026.1| uncharacterized protein LOC100306579 [Glycine max]
 gb|ACU14815.1| unknown [Glycine max]
 gb|KHN30189.1| Histone H2A [Glycine soja]
Length=149

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|NP_001235555.1| uncharacterized protein LOC100305705 [Glycine max]
 ref|XP_003547415.1| PREDICTED: histone H2A-like isoform 1 [Glycine max]
 gb|ACU13529.1| unknown [Glycine max]
 gb|KHN33402.1| Histone H2A [Glycine soja]
 gb|KHN33404.1| Histone H2A [Glycine soja]
Length=149

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_003543507.1| PREDICTED: histone H2A-like [Glycine max]
 gb|KHN30192.1| Histone H2A [Glycine soja]
Length=149

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_006649862.1| PREDICTED: probable histone H2A.5-like [Oryza brachyantha]
Length=159

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  131



>ref|XP_003606634.1| Histone H2A [Medicago truncatula]
 gb|AES88831.1| histone H2A 6 [Medicago truncatula]
Length=145

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  18   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  77

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGV PNINP+LLP
Sbjct  78   KKNRIIPRHVLLAVRNDEELGKLLNGVTIAHGGVFPNINPILLP  121



>ref|XP_006382493.1| hypothetical protein POPTR_0005s02660g [Populus trichocarpa]
 gb|ABK94359.1| unknown [Populus trichocarpa]
 gb|ERP60290.1| hypothetical protein POPTR_0005s02660g [Populus trichocarpa]
Length=145

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  87   MEAVSkttkgaggrkggerkkSVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvyla  266
            MEA +K TKGAGGR+GG+RKKSV+KSIKAGLQFPVGRI+R+LKKGRYA+R G+GAP+Y+A
Sbjct  1    MEATTKATKGAGGRRGGDRKKSVSKSIKAGLQFPVGRISRFLKKGRYAKRLGSGAPIYMA  60

Query  267  avleylaaevlelaGNAARDNKKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNIN  446
            AVLEYLAAEVLELAGNAARDNKKTRI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNIN
Sbjct  61   AVLEYLAAEVLELAGNAARDNKKTRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNIN  120

Query  447  PVLLP  461
            PVLLP
Sbjct  121  PVLLP  125



>ref|XP_006341061.1| PREDICTED: histone H2A-like [Solanum tuberosum]
Length=145

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRY+QR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  18   SVTRSVKAGLQFPVGRIGRYLKKGRYSQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  77

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  78   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  121



>gb|AFK46765.1| unknown [Lotus japonicus]
Length=155

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  25   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  84

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>ref|NP_001105357.1| histone H2A [Zea mays]
 sp|P40280.1|H2A_MAIZE RecName: Full=Histone H2A [Zea mays]
 gb|AAB04687.1| histone H2A [Zea mays]
Length=159

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQ  GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQXVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLGGVTIAHGGVLPNINPVLLP  131



>ref|XP_011077442.1| PREDICTED: histone H2A [Sesamum indicum]
Length=150

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVY+AAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_007016497.1| Histone H2A 12 isoform 1 [Theobroma cacao]
 ref|XP_007016498.1| Histone H2A 12 isoform 1 [Theobroma cacao]
 gb|EOY34116.1| Histone H2A 12 isoform 1 [Theobroma cacao]
 gb|EOY34117.1| Histone H2A 12 isoform 1 [Theobroma cacao]
Length=149

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVY+AAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|AFK44015.1| unknown [Lotus japonicus]
Length=151

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_010685819.1| PREDICTED: histone H2A [Beta vulgaris subsp. vulgaris]
Length=153

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRND+ELGKLLSGVTIA GGVLPNINPVLLP
Sbjct  86   KNRIIPRHVLLAVRNDDELGKLLSGVTIAHGGVLPNINPVLLP  128



>ref|XP_010037863.1| PREDICTED: histone H2A-like [Eucalyptus grandis]
 gb|KCW49641.1| hypothetical protein EUGRSUZ_K03160 [Eucalyptus grandis]
Length=149

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_010905725.1| PREDICTED: histone H2A [Elaeis guineensis]
Length=147

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|EYU41689.1| hypothetical protein MIMGU_mgv1a015617mg [Erythranthe guttata]
Length=151

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRY+QR G+GAP+Y+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSRSVKAGLQFPVGRIGRYLKKGRYSQRVGSGAPIYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  83   KKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|XP_008776490.1| PREDICTED: histone H2A [Phoenix dactylifera]
Length=147

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_010253272.1| PREDICTED: histone H2A [Nelumbo nucifera]
Length=149

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_008788088.1| PREDICTED: histone H2A-like [Phoenix dactylifera]
Length=147

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_010937685.1| PREDICTED: histone H2A-like [Elaeis guineensis]
Length=154

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  25   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  84

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  127



>gb|ACG30919.1| histone H2A [Zea mays]
Length=159

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQ  GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQXFGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLGGVTIAHGGVLPNINPVLLP  131



>ref|XP_009628436.1| PREDICTED: probable histone H2A.1 [Nicotiana tomentosiformis]
Length=151

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S++AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|XP_009419951.1| PREDICTED: histone H2A-like [Musa acuminata subsp. malaccensis]
Length=152

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  27   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  86

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  87   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  129



>ref|XP_006429024.1| hypothetical protein CICLE_v10013023mg [Citrus clementina]
 ref|XP_006480755.1| PREDICTED: histone H2A-like [Citrus sinensis]
 gb|AEI72269.1| histone H2A [Citrus trifoliata]
 gb|ESR42264.1| hypothetical protein CICLE_v10013023mg [Citrus clementina]
Length=150

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|KHG21834.1| hypothetical protein F383_27070 [Gossypium arboreum]
 gb|KHG23433.1| hypothetical protein F383_06044 [Gossypium arboreum]
 gb|KHG24043.1| hypothetical protein F383_02980 [Gossypium arboreum]
Length=150

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_007206082.1| hypothetical protein PRUPE_ppa012888mg [Prunus persica]
 ref|XP_008223128.1| PREDICTED: histone H2A [Prunus mume]
 gb|EMJ07281.1| hypothetical protein PRUPE_ppa012888mg [Prunus persica]
Length=150

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRH+LLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|ACG23907.1| histone H2A [Zea mays]
Length=159

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQF VGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFSVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLGGVTIAHGGVLPNINPVLLP  131



>ref|XP_010922382.1| PREDICTED: histone H2A-like [Elaeis guineensis]
Length=147

 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_004487027.1| PREDICTED: probable histone H2A.1-like [Cicer arietinum]
Length=149

 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S +AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   AVTRSTRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  83   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|XP_010025201.1| PREDICTED: probable histone H2A.5 [Eucalyptus grandis]
 gb|KCW61811.1| hypothetical protein EUGRSUZ_H04505 [Eucalyptus grandis]
Length=138

 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGR+AR+LKKGRYA+R GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  16   SVSKSVKAGLQFPVGRVARFLKKGRYARRTGTGAPVYLAAVLEYLAAEVLELAGNAARDN  75

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  76   KKNRISPRHVLLAVRNDEELGKLLQGVTIASGGVLPNINPVLLP  119



>gb|KJB21599.1| hypothetical protein B456_004G004000 [Gossypium raimondii]
Length=150

 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_002463507.1| hypothetical protein SORBIDRAFT_01g000950 [Sorghum bicolor]
 gb|EER90505.1| hypothetical protein SORBIDRAFT_01g000950 [Sorghum bicolor]
Length=155

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNI+ VLLP
Sbjct  88   KKTRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNIHSVLLP  131



>ref|XP_010047429.1| PREDICTED: histone H2A [Eucalyptus grandis]
 gb|KCW88910.1| hypothetical protein EUGRSUZ_A01241 [Eucalyptus grandis]
Length=149

 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|WP_039311042.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|AEC10950.1| histone H2A [Camellia sinensis]
 gb|KHL91161.1| hypothetical protein QW71_36260 [Paenibacillus sp. IHB B 3415]
Length=151

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  156  TKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNKK  335
            ++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVY+AAVLEYLAAEVLELAGNAARDNKK
Sbjct  25   SRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDNKK  84

Query  336  TRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
             RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   NRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_009801696.1| PREDICTED: histone H2A [Nicotiana sylvestris]
Length=151

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S++AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|XP_007150300.1| hypothetical protein PHAVU_005G141800g [Phaseolus vulgaris]
 gb|ESW22294.1| hypothetical protein PHAVU_005G141800g [Phaseolus vulgaris]
Length=149

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V++S+KAGLQFPVGRI R+LKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   AVSRSVKAGLQFPVGRIGRFLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNINPVLLP
Sbjct  83   KKNRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNINPVLLP  126



>ref|XP_004246465.1| PREDICTED: histone H2A-like [Solanum lycopersicum]
Length=145

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRY++R G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  18   AVTRSVKAGLQFPVGRIGRYLKKGRYSERVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  77

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNINP+LLP
Sbjct  78   KKNRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNINPILLP  121



>ref|XP_010694234.1| PREDICTED: probable histone H2A.5 [Beta vulgaris subsp. vulgaris]
Length=150

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  25   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  84

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRND+ELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   KNRIIPRHVLLAVRNDDELGKLLAGVTIAHGGVLPNINPVLLP  127



>gb|ACU20753.1| unknown [Glycine max]
Length=149

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK+GRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKRGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_011092071.1| PREDICTED: histone H2A.1 [Sesamum indicum]
Length=145

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            ++ KS+KAGLQFPVGRIAR+LKKGRYAQR G GAP+Y+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   AIPKSVKAGLQFPVGRIARFLKKGRYAQRMGIGAPIYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHV LA+RNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  83   KKTRIIPRHVQLAIRNDEELGKLLQGVTIASGGVLPNINPVLLP  126



>ref|XP_004302400.1| PREDICTED: histone H2A.1 [Fragaria vesca subsp. vesca]
Length=148

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRIAR+LKKGRYAQR G+GAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVSKSVKAGLQFPVGRIARFLKKGRYAQRTGSGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI PRHV LAVRNDEELGKLL+GVTIA+GGVLPNINPVLLP
Sbjct  81   KKTRINPRHVQLAVRNDEELGKLLAGVTIASGGVLPNINPVLLP  124



>gb|KHG05600.1| hypothetical protein F383_01039 [Gossypium arboreum]
 gb|KJB16910.1| hypothetical protein B456_002G254000 [Gossypium raimondii]
Length=154

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|KHG05602.1| putative histone H2A [Gossypium arboreum]
 gb|KJB16911.1| hypothetical protein B456_002G254100 [Gossypium raimondii]
Length=151

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_007150302.1| hypothetical protein PHAVU_005G142000g [Phaseolus vulgaris]
 gb|ESW22296.1| hypothetical protein PHAVU_005G142000g [Phaseolus vulgaris]
Length=149

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR G+GAP+YLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_010112901.1| putative histone H2A.4 [Morus notabilis]
 gb|EXC35050.1| putative histone H2A.4 [Morus notabilis]
Length=149

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|KJB21524.1| hypothetical protein B456_004G004100 [Gossypium raimondii]
Length=136

 Score =   153 bits (387),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  10   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  69

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  70   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  112



>ref|XP_003606644.1| Histone H2A [Medicago truncatula]
Length=239

 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SI+AGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTRSIRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KKNRIIPRHVLLAVRNDEELGKLLNGVTIAHGGVLPNINPILLP  127



>gb|AHY02120.1| histone H2A12, partial [Gossypium hirsutum]
Length=143

 Score =   154 bits (388),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  17   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  76

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  77   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  119



>ref|NP_001043136.1| Os01g0502700 [Oryza sativa Japonica Group]
 ref|NP_001049731.1| Os03g0279200 [Oryza sativa Japonica Group]
 sp|Q94E96.1|H2A5_ORYSJ RecName: Full=Probable histone H2A.5 [Oryza sativa Japonica Group]
 sp|A2WQG7.1|H2A5_ORYSI RecName: Full=Probable histone H2A.5 [Oryza sativa Indica Group]
 dbj|BAB44136.1| putative histone H2A [Oryza sativa Japonica Group]
 gb|ABF95291.1| Histone H2A, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF05050.1| Os01g0502700 [Oryza sativa Japonica Group]
 dbj|BAF11645.1| Os03g0279200 [Oryza sativa Japonica Group]
 gb|EAY74213.1| hypothetical protein OsI_02094 [Oryza sativa Indica Group]
 gb|EAY89478.1| hypothetical protein OsI_11008 [Oryza sativa Indica Group]
 gb|EAZ12047.1| hypothetical protein OsJ_01928 [Oryza sativa Japonica Group]
 gb|EAZ26464.1| hypothetical protein OsJ_10353 [Oryza sativa Japonica Group]
 dbj|BAH00636.1| unnamed protein product [Oryza sativa Japonica Group]
Length=159

 Score =   154 bits (389),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   AVSRSVKAGLQFPVGRIGRYLKKGRYAQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  131



>ref|XP_010260089.1| PREDICTED: histone H2A-like [Nelumbo nucifera]
Length=149

 Score =   154 bits (388),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAYGGVLPNINPVLLP  126



>dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00001]
 dbj|BAL49716.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00002]
 dbj|BAL49719.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00003]
 dbj|BAL49722.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00004]
 dbj|BAL49725.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00005]
 dbj|BAL49728.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00006]
 dbj|BAL49731.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00007]
 dbj|BAL49734.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00008]
 dbj|BAL49737.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00009]
 dbj|BAL49740.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00010]
 dbj|BAL49743.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00011]
 dbj|BAL49746.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00012]
 dbj|BAL49749.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00013]
 dbj|BAL49752.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00014]
 dbj|BAL49755.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00015]
 dbj|BAL49758.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00016]
 dbj|BAL49761.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00017]
 dbj|BAL49764.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00018]
 dbj|BAL49767.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00019]
 dbj|BAL49770.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00020]
 dbj|BAL49773.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00021]
 dbj|BAL49776.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00022]
 dbj|BAL49779.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00023]
 dbj|BAL49782.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00024]
 dbj|BAL49785.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00025]
 dbj|BAL49788.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00026]
 dbj|BAL49791.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00027]
 dbj|BAL49794.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00028]
 dbj|BAL49797.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00029]
 dbj|BAL49800.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00030]
 dbj|BAL49803.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00031]
 dbj|BAL49806.1| fusion protein of histone 2A and enhanced yellow fluorescence 
protein [Cloning vector pSolycp00032]
Length=387

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKSIKAGLQFPVGRI RYLKKGRYAQR G+GAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRHVLLAVRNDEELGKLL+GVTIA+GGVLPNINPVLLP
Sbjct  81   KKSRIIPRHVLLAVRNDEELGKLLAGVTIASGGVLPNINPVLLP  124



>gb|ACG31632.1| histone H2A [Zea mays]
Length=159

 Score =   154 bits (389),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR G+GA VYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGASVYLAAVLEYLAAEVLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIVPRHVLLAIRNDEELGKLLTGVTIAHGGVLPNINPVLLP  131



>gb|KJB21523.1| hypothetical protein B456_004G004100 [Gossypium raimondii]
Length=150

 Score =   154 bits (388),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|XP_007150306.1| hypothetical protein PHAVU_005G142300g [Phaseolus vulgaris]
 gb|ESW22300.1| hypothetical protein PHAVU_005G142300g [Phaseolus vulgaris]
Length=149

 Score =   154 bits (388),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S++AGLQFPVGR+ RYLKKGRYA+R GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVRAGLQFPVGRVGRYLKKGRYAKRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNINPILLP  126



>ref|XP_007150301.1| hypothetical protein PHAVU_005G141900g [Phaseolus vulgaris]
 gb|ESW22295.1| hypothetical protein PHAVU_005G141900g [Phaseolus vulgaris]
Length=149

 Score =   154 bits (388),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V++S+KAGLQFPVGRI R+LKKGRYAQR G GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   AVSRSVKAGLQFPVGRIGRFLKKGRYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNINPVLLP
Sbjct  83   KKNRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNINPVLLP  126



>ref|XP_008385149.1| PREDICTED: histone H2A [Malus domestica]
 ref|XP_009353720.1| PREDICTED: histone H2A [Pyrus x bretschneideri]
 ref|XP_009338378.1| PREDICTED: histone H2A [Pyrus x bretschneideri]
Length=150

 Score =   154 bits (388),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S++AGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   AVTRSVRAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRH+LLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  83   KKNRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>sp|P02276.1|H2A2_WHEAT RecName: Full=Histone H2A.2.1 [Triticum aestivum]
Length=151

 Score =   154 bits (388),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKSIKAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  21   SVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRH+LLA+RND+ELG+LLSGVTIA GGV+PNINPVLLP
Sbjct  81   KKTRIVPRHLLLAIRNDQELGRLLSGVTIAHGGVIPNINPVLLP  124



>ref|XP_009409009.1| PREDICTED: probable histone H2A.2 [Musa acuminata subsp. malaccensis]
Length=148

 Score =   154 bits (388),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK+GRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKQGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_008357619.1| PREDICTED: histone H2A-like [Malus domestica]
 ref|XP_009358342.1| PREDICTED: histone H2A-like [Pyrus x bretschneideri]
Length=150

 Score =   154 bits (388),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S++AGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   AVTRSVRAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRH+LLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  83   KKNRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|ACG30679.1| histone H2A [Zea mays]
Length=159

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRHVLLA+ NDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKTRIVPRHVLLAIPNDEELGKLLTGVTIAHGGVLPNINPVLLP  131



>ref|XP_003558215.1| PREDICTED: histone H2A-like [Brachypodium distachyon]
Length=161

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S++AGLQFPVGRI RYLKKGRYAQR GTGAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  27   SVTRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDN  86

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRHVLLAVRND+ELGKLL+GVTIA GGVLP INP+LLP
Sbjct  87   KKSRIIPRHVLLAVRNDDELGKLLAGVTIAHGGVLPKINPILLP  130



>ref|NP_001054458.1| Os05g0113900 [Oryza sativa Japonica Group]
 sp|Q75L11.2|H2A6_ORYSJ RecName: Full=Probable histone H2A.6 [Oryza sativa Japonica Group]
 sp|A2XZN0.2|H2A6_ORYSI RecName: Full=Probable histone H2A.6 [Oryza sativa Indica Group]
 dbj|BAF16372.1| Os05g0113900 [Oryza sativa Japonica Group]
 dbj|BAG93764.1| unnamed protein product [Oryza sativa Japonica Group]
Length=156

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>ref|XP_011094822.1| PREDICTED: histone H2A-like [Sesamum indicum]
Length=150

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY++R GTGAPVY+AAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSERVGTGAPVYMAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_008648632.1| PREDICTED: histone H2A.2.1-like [Zea mays]
 gb|AFW74918.1| hypothetical protein ZEAMMB73_393221 [Zea mays]
Length=157

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPV+LAAVLEYLAAEVLELAGNAARDNK
Sbjct  27   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVFLAAVLEYLAAEVLELAGNAARDNK  86

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KTRIIPRH+LLA+RNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  87   KTRIIPRHLLLAIRNDEELGKLLGGVTIAHGGVLPNINPVLLP  129



>ref|XP_007027098.1| Histone H2A 12 [Theobroma cacao]
 gb|EOY07600.1| Histone H2A 12 [Theobroma cacao]
Length=153

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_002512417.1| histone h2a, putative [Ricinus communis]
 gb|EEF49869.1| histone h2a, putative [Ricinus communis]
Length=146

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRIAR+LKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVSKSVKAGLQFPVGRIARFLKKGRYAQRFGSGAPVYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  81   KKNRINPRHVLLAVRNDEELGKLLHGVTIASGGVLPNINPVLLP  124



>ref|XP_009766769.1| PREDICTED: histone H2A [Nicotiana sylvestris]
Length=150

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|XP_010443771.1| PREDICTED: probable histone H2A.7 [Camelina sativa]
Length=149

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKTRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLP  126



>ref|XP_002318994.2| hypothetical protein POPTR_0013s01890g [Populus trichocarpa]
 gb|EEE94917.2| hypothetical protein POPTR_0013s01890g [Populus trichocarpa]
Length=145

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  87   MEAVSkttkgaggrkggerkkSVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvyla  266
            MEA +K TKGAGGR+GGERKKSV+KS KAGLQFPVGRIAR+LKKGRYAQR G+GAP+Y+A
Sbjct  1    MEATTKATKGAGGRRGGERKKSVSKSTKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYMA  60

Query  267  avleylaaevlelaGNAARDNKKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNIN  446
            AVLEYLAAEVLELAGNAARDNKK RI PRHVLLA+RNDEELGKLL GVTIA+GGVLPNIN
Sbjct  61   AVLEYLAAEVLELAGNAARDNKKNRINPRHVLLAIRNDEELGKLLQGVTIASGGVLPNIN  120

Query  447  PVLLP  461
            PVLLP
Sbjct  121  PVLLP  125



>ref|XP_006653972.1| PREDICTED: probable histone H2A.6-like [Oryza brachyantha]
Length=154

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V++S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  25   AVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  84

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   KKNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>emb|CDP06647.1| unnamed protein product [Coffea canephora]
Length=151

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY++R GTGAPVY+AAVLEYLAAEVLELAGNAARDNK
Sbjct  25   VSRSVKAGLQFPVGRIGRYLKKGRYSERVGTGAPVYMAAVLEYLAAEVLELAGNAARDNK  84

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  127



>gb|KHG05601.1| putative histone H2A [Gossypium arboreum]
Length=151

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|XP_006400900.1| hypothetical protein EUTSA_v10014932mg [Eutrema salsugineum]
 gb|ESQ42353.1| hypothetical protein EUTSA_v10014932mg [Eutrema salsugineum]
Length=149

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKTRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINAVLLP  126



>ref|XP_006400901.1| hypothetical protein EUTSA_v10014933mg [Eutrema salsugineum]
 gb|ESQ42354.1| hypothetical protein EUTSA_v10014933mg [Eutrema salsugineum]
Length=149

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKTRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINAVLLP  126



>ref|XP_002441223.1| hypothetical protein SORBIDRAFT_09g022690 [Sorghum bicolor]
 gb|EES19653.1| hypothetical protein SORBIDRAFT_09g022690 [Sorghum bicolor]
Length=159

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK+GRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKQGRYAQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>gb|EMT27732.1| Histone H2A [Aegilops tauschii]
Length=155

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAELLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLAVRNDEELGKLL+GVTIA GGV+P INPVLLP
Sbjct  88   KKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVIPKINPVLLP  131



>gb|AFK41325.1| unknown [Lotus japonicus]
Length=155

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>gb|EPS64904.1| hypothetical protein M569_09875, partial [Genlisea aurea]
Length=147

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            ++++S++AGLQFPVGRI RYLKKGRYAQR G+GAP+YLAAVLEYLAAEVLEL+GNAARDN
Sbjct  26   AISRSVRAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELSGNAARDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  129



>ref|NP_001183439.1| uncharacterized protein LOC100501869 [Zea mays]
 gb|ACG24512.1| histone H2A [Zea mays]
 gb|ACG24696.1| histone H2A [Zea mays]
 gb|ACR36818.1| unknown [Zea mays]
Length=157

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  26   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAAKDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNI+ VLLP
Sbjct  86   KKTRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNIHSVLLP  129



>dbj|BAK04720.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=156

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  26   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAELLELAGNAAKDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLAVRNDEELGKLL+GVTIA GGV+P INPVLLP
Sbjct  86   KKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVIPKINPVLLP  129



>ref|XP_009612960.1| PREDICTED: histone H2A-like [Nicotiana tomentosiformis]
Length=150

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|NP_001183143.1| uncharacterized LOC100501512 [Zea mays]
 gb|ACG30784.1| histone H2A [Zea mays]
 gb|ACG39651.1| histone H2A [Zea mays]
 gb|ACR35843.1| unknown [Zea mays]
 tpg|DAA62467.1| TPA: histone H2A [Zea mays]
Length=164

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  26   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAAKDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRHVLLA+RND ELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KKTRIVPRHVLLAIRNDVELGKLLAGVTIAHGGVLPNINPVLLP  129



>gb|EMS55804.1| Histone H2A [Triticum urartu]
Length=158

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAA +LELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAVLLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLAVRNDEELGKLL+GVTIA GGV+P INPVLLP
Sbjct  88   KKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVIPKINPVLLP  131



>gb|KDP45349.1| hypothetical protein JCGZ_09598 [Jatropha curcas]
Length=151

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
             ++S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVY+AAVLEYLAAEVLELAGNAARDNK
Sbjct  24   TSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYMAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_010929515.1| PREDICTED: histone H2A.1-like [Elaeis guineensis]
Length=140

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V+KS+KAGLQFPVGRIAR+LKKGRYA+R GTGAP+YLAAVLEYLAAEVLELAGNAARDNK
Sbjct  22   VSKSVKAGLQFPVGRIARFLKKGRYAKRLGTGAPIYLAAVLEYLAAEVLELAGNAARDNK  81

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KTRIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  82   KTRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNIHQVLLP  124



>gb|ACG38394.1| histone H2A [Zea mays]
Length=160

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK+GRY+QR GTGAPVYLAAVLEYLAAE+LELAGNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKQGRYSQRVGTGAPVYLAAVLEYLAAELLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>ref|XP_002274570.1| PREDICTED: histone H2A [Vitis vinifera]
 emb|CAN63391.1| hypothetical protein VITISV_009336 [Vitis vinifera]
Length=149

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  156  TKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNKK  335
            ++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNKK
Sbjct  25   SRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKK  84

Query  336  TRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
             RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   NRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_008807840.1| PREDICTED: histone H2A.1-like [Phoenix dactylifera]
Length=140

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V+K++KAGLQFPVGRIAR+LKKGRYA+R GTGAP+YLAAVLEYLAAEVLELAGNAARDNK
Sbjct  22   VSKAVKAGLQFPVGRIARFLKKGRYAERVGTGAPIYLAAVLEYLAAEVLELAGNAARDNK  81

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KTRIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  82   KTRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNIHQVLLP  124



>dbj|BAK05993.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=156

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR GTGAPV+LAAVLEYLAAE+LELAGNAA+DN
Sbjct  26   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVFLAAVLEYLAAELLELAGNAAKDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLAVRNDEELGKLL+GVTIA GGV+P INPVLLP
Sbjct  86   KKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVIPKINPVLLP  129



>gb|ACG30685.1| histone H2A [Zea mays]
Length=164

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  26   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAAKDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRHVLLA+RND ELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KKTRIVPRHVLLAIRNDVELGKLLAGVTIAHGGVLPNINPVLLP  129



>ref|XP_002866356.1| hypothetical protein ARALYDRAFT_358205 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42615.1| hypothetical protein ARALYDRAFT_358205 [Arabidopsis lyrata subsp. 
lyrata]
Length=149

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKTRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLP  126



>gb|AFW78282.1| hypothetical protein ZEAMMB73_348782 [Zea mays]
Length=157

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK+GRY+QR GTGAPVYLAAVLEYLAAE+LELAGNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKQGRYSQRVGTGAPVYLAAVLEYLAAELLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>ref|NP_001278724.1| uncharacterized protein LOC100216750 [Zea mays]
 gb|ACF82293.1| unknown [Zea mays]
 gb|ACG35220.1| histone H2A [Zea mays]
 gb|AFW78281.1| histone H2A [Zea mays]
Length=160

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK+GRY+QR GTGAPVYLAAVLEYLAAE+LELAGNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKQGRYSQRVGTGAPVYLAAVLEYLAAELLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>ref|XP_009350091.1| PREDICTED: histone H2A-like [Pyrus x bretschneideri]
Length=150

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S++AGLQFPVGRI RYLK GRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVRAGLQFPVGRIGRYLKHGRYAQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLKGVTIAHGGVLPNINPVLLP  126



>ref|XP_008343478.1| PREDICTED: histone H2A [Malus domestica]
Length=150

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S++AGLQFPVGRI RYLK GRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVRAGLQFPVGRIGRYLKHGRYAQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLKGVTIAHGGVLPNINPVLLP  126



>ref|XP_009374659.1| PREDICTED: histone H2A-like [Pyrus x bretschneideri]
Length=150

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S++AGLQFPVGRI RYLK GRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVRAGLQFPVGRIGRYLKHGRYAQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLKGVTIAHGGVLPNINPVLLP  126



>gb|ACG31676.1| histone H2A [Zea mays]
Length=164

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  26   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAAKDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRH+LLA+RND ELGKLLSGVTIA GGVLPNINPVLLP
Sbjct  86   KKTRIVPRHLLLAIRNDVELGKLLSGVTIAHGGVLPNINPVLLP  129



>dbj|BAA85117.1| histone H2A-like protein [Solanum melongena]
Length=131

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S+KAGLQFPVGRI RYLKKG+YAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  7    VTRSVKAGLQFPVGRIGRYLKKGQYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  66

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRH+LLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  67   KNRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  109



>ref|XP_010674032.1| PREDICTED: probable histone H2A.1 [Beta vulgaris subsp. vulgaris]
Length=150

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI R+LKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  22   SVTRSVKAGLQFPVGRIGRFLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  81

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRHVLLA+RND+ELGKLL GVTIA GGVLPNINP+LLP
Sbjct  82   KKSRIIPRHVLLAIRNDDELGKLLHGVTIAHGGVLPNINPILLP  125



>ref|XP_003569004.1| PREDICTED: probable histone H2A.5 [Brachypodium distachyon]
Length=159

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI R+LKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVTRSVKAGLQFPVGRIGRFLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELG+LL GVTIA GGVLPNINP+LLP
Sbjct  84   KKTRIIPRHVLLAIRNDEELGRLLGGVTIAHGGVLPNINPLLLP  127



>ref|XP_011023672.1| PREDICTED: histone H2A.1-like [Populus euphratica]
Length=144

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V+KS KAGLQFPVGRIAR+LKKGRYAQR G+GAP+Y+AAVLEYLAAEVLELAGNAARDN
Sbjct  21   AVSKSTKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYMAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  81   KKNRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNINPVLLP  124



>ref|XP_008387736.1| PREDICTED: histone H2A-like [Malus domestica]
Length=150

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S++AGLQFPVGRI RYLK GRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSVRAGLQFPVGRIGRYLKHGRYAQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLKGVTIAHGGVLPNINPVLLP  126



>ref|XP_008798355.1| PREDICTED: histone H2A.1-like [Phoenix dactylifera]
Length=140

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V+KS+KAGLQFPVGRIAR+LKKGRYA+R GTGAP+YLAAVLEYLAAEVLELAGNAARDNK
Sbjct  22   VSKSVKAGLQFPVGRIARFLKKGRYAKRLGTGAPIYLAAVLEYLAAEVLELAGNAARDNK  81

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KTRIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  82   KTRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNIHQVLLP  124



>gb|ACG33030.1| histone H2A [Zea mays]
Length=160

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK+GRY+QR GTGAPVYLAAVLEYLAAE+LELAGNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKQGRYSQRVGTGAPVYLAAVLEYLAAELLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>gb|KDP44203.1| hypothetical protein JCGZ_05670 [Jatropha curcas]
Length=150

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
             ++S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   TSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_002459460.1| hypothetical protein SORBIDRAFT_02g004970 [Sorghum bicolor]
 gb|EER95981.1| hypothetical protein SORBIDRAFT_02g004970 [Sorghum bicolor]
Length=159

 Score =   152 bits (385),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  29   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  88

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLL  458
            KKTRIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNI+ VLL
Sbjct  89   KKTRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNIHSVLL  131



>gb|KFK27527.1| hypothetical protein AALP_AA8G395100 [Arabis alpina]
Length=149

 Score =   152 bits (384),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+L+KGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLRKGRYAQRLGSGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN +LLP
Sbjct  83   KKTRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINAILLP  126



>ref|XP_002866355.1| hypothetical protein ARALYDRAFT_358204 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42614.1| hypothetical protein ARALYDRAFT_358204 [Arabidopsis lyrata subsp. 
lyrata]
Length=149

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLP  126



>ref|NP_001055762.1| Os05g0461400 [Oryza sativa Japonica Group]
 sp|Q6L500.1|H2A4_ORYSJ RecName: Full=Probable histone H2A.4 [Oryza sativa Japonica Group]
 sp|A2Y5G8.1|H2A4_ORYSI RecName: Full=Probable histone H2A.4 [Oryza sativa Indica Group]
 gb|AAT39174.1| putative histone H2A [Oryza sativa Japonica Group]
 gb|AAT39181.1| putative histone H2A [Oryza sativa Japonica Group]
 dbj|BAF17676.1| Os05g0461400 [Oryza sativa Japonica Group]
 gb|EAY98328.1| hypothetical protein OsI_20238 [Oryza sativa Indica Group]
 dbj|BAG90407.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63993.1| hypothetical protein OsJ_18822 [Oryza sativa Japonica Group]
Length=163

 Score =   152 bits (385),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK+GRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  27   VSRSVKAGLQFPVGRIGRYLKQGRYSQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  86

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  87   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  129



>ref|XP_011089445.1| PREDICTED: histone H2A-like [Sesamum indicum]
Length=153

 Score =   152 bits (384),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  156  TKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNKK  335
            ++S++AGLQFPVGRI RYLKKGRYAQR GTGAPVY+AAVLEYLAAEVLELAGNAARDNKK
Sbjct  25   SRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDNKK  84

Query  336  TRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
             RIIPRHVLLAVRNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  85   NRIIPRHVLLAVRNDEELGKLLQGVTIAHGGVLPNINPVLLP  126



>ref|XP_007147031.1| hypothetical protein PHAVU_006G090400g [Phaseolus vulgaris]
 gb|ESW19025.1| hypothetical protein PHAVU_006G090400g [Phaseolus vulgaris]
Length=137

 Score =   151 bits (382),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V+KS KAGLQFPVGR+ARYLKKGRY++R GTGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  18   AVSKSTKAGLQFPVGRVARYLKKGRYSRRLGTGAPIYLAAVLEYLAAEVLELAGNAARDN  77

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRND+ELGKLL GVTIA+GGVLPN+NPVLLP
Sbjct  78   KKNRIIPRHVLLAVRNDDELGKLLQGVTIASGGVLPNVNPVLLP  121



>ref|XP_006279502.1| hypothetical protein CARUB_v10027312mg [Capsella rubella]
 gb|EOA12400.1| hypothetical protein CARUB_v10027312mg [Capsella rubella]
Length=150

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELG+LLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKTRIIPRHLLLAIRNDEELGRLLSGVTIAHGGVLPNINSVLLP  126



>ref|XP_004961835.1| PREDICTED: probable histone H2A.4-like [Setaria italica]
Length=162

 Score =   152 bits (384),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK+GRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKQGRYSQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  86   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  128



>ref|XP_010483635.1| PREDICTED: probable histone H2A.7 [Camelina sativa]
Length=149

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  83   KKTRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNIHSVLLP  126



>ref|XP_004302773.1| PREDICTED: histone H2A [Fragaria vesca subsp. vesca]
Length=151

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            VT+S KAGLQFPVGRI RYLK GRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VTRSTKAGLQFPVGRIGRYLKNGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_004957462.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Setaria 
italica]
Length=563

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  432  SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  491

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  492  KKTRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  535



>ref|XP_009131963.1| PREDICTED: probable histone H2A.7 [Brassica rapa]
 emb|CDX88729.1| BnaA03g09200D [Brassica napus]
Length=148

 Score =   152 bits (383),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLP  126



>ref|XP_002439160.1| hypothetical protein SORBIDRAFT_09g001520 [Sorghum bicolor]
 gb|EES17590.1| hypothetical protein SORBIDRAFT_09g001520 [Sorghum bicolor]
Length=157

 Score =   152 bits (383),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  27   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  86

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNIN VLLP
Sbjct  87   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINSVLLP  129



>sp|P25470.1|H2A1_PEA RecName: Full=Histone H2A.1 [Pisum sativum]
Length=150

 Score =   152 bits (383),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S++AGLQFPVGR+ R+LKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVTRSVRAGLQFPVGRVGRFLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRH+LLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  83   KKNRISPRHLLLAVRNDEELGKLLAGVTIAYGGVLPNINPVLLP  126



>ref|XP_002283971.1| PREDICTED: histone H2A.1 [Vitis vinifera]
 emb|CAN67660.1| hypothetical protein VITISV_044408 [Vitis vinifera]
 emb|CBI39501.3| unnamed protein product [Vitis vinifera]
Length=137

 Score =   151 bits (382),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRIAR+LK GRYAQR GTGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   SVSKSVKAGLQFPVGRIARFLKTGRYAQRTGTGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRHVLLAVRNDEELGKLL GVTIA GGVLPNINPVLLP
Sbjct  81   KKNRISPRHVLLAVRNDEELGKLLRGVTIANGGVLPNINPVLLP  124



>gb|EPS68090.1| hypothetical protein M569_06682 [Genlisea aurea]
Length=153

 Score =   151 bits (382),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR G GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|KDO56240.1| hypothetical protein CISIN_1g032326mg [Citrus sinensis]
Length=143

 Score =   151 bits (382),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            ++KS+KAGLQFPVGRIAR+LKKGRYAQR G+GAP+Y+AAVLEYLAAEVLELAGNAARDNK
Sbjct  22   ISKSVKAGLQFPVGRIARFLKKGRYAQRMGSGAPIYMAAVLEYLAAEVLELAGNAARDNK  81

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RI PRHVLLAVRND+ELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  82   KNRINPRHVLLAVRNDDELGKLLQGVTIASGGVLPNINPVLLP  124



>ref|XP_006433398.1| hypothetical protein CICLE_v10002795mg [Citrus clementina]
 ref|XP_006472074.1| PREDICTED: probable histone H2A.5-like [Citrus sinensis]
 gb|ESR46638.1| hypothetical protein CICLE_v10002795mg [Citrus clementina]
Length=143

 Score =   151 bits (382),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            ++KS+KAGLQFPVGRIAR+LKKGRYAQR G+GAP+Y+AAVLEYLAAEVLELAGNAARDNK
Sbjct  22   ISKSVKAGLQFPVGRIARFLKKGRYAQRMGSGAPIYMAAVLEYLAAEVLELAGNAARDNK  81

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RI PRHVLLAVRND+ELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  82   KNRINPRHVLLAVRNDDELGKLLQGVTIASGGVLPNINPVLLP  124



>ref|XP_009125454.1| PREDICTED: probable histone H2A.4 [Brassica rapa]
Length=152

 Score =   151 bits (382),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY++R GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSKRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRND+ELGKLL GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDDELGKLLKGVTIAHGGVLPNINPVLLP  126



>ref|XP_007030982.1| Histone H2A 7 [Theobroma cacao]
 gb|EOY11484.1| Histone H2A 7 [Theobroma cacao]
Length=142

 Score =   151 bits (381),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V+KS+KAGLQFPVGRIAR+LKKGRYAQR G GAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  18   AVSKSVKAGLQFPVGRIARFLKKGRYAQRYGAGAPIYLAAVLEYLAAEVLELAGNAARDN  77

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRH+LLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  78   KKNRINPRHLLLAVRNDEELGKLLQGVTIASGGVLPNINPVLLP  121



>ref|XP_004142082.1| PREDICTED: probable histone H2A.4-like [Cucumis sativus]
 gb|KGN54228.1| hypothetical protein Csa_4G293870 [Cucumis sativus]
Length=152

 Score =   151 bits (382),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK GRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  25   VSRSVKAGLQFPVGRIGRYLKNGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  84

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  127



>ref|XP_004165280.1| PREDICTED: probable histone H2A.4-like [Cucumis sativus]
Length=152

 Score =   151 bits (382),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK GRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  25   VSRSVKAGLQFPVGRIGRYLKNGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  84

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  127



>ref|XP_010259658.1| PREDICTED: histone H2A.1 [Nelumbo nucifera]
Length=142

 Score =   151 bits (381),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V+KSIKAGLQFPVGR+AR+LKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   AVSKSIKAGLQFPVGRVARFLKKGRYAQRIGTGAPVYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RIIPRHVLLAVRNDEELG+LL GVTIA+GGVLPNI+ VLLP
Sbjct  81   KKNRIIPRHVLLAVRNDEELGRLLDGVTIASGGVLPNIHSVLLP  124



>ref|XP_008447608.1| PREDICTED: probable histone H2A.4 [Cucumis melo]
Length=153

 Score =   151 bits (382),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK GRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  25   VSRSVKAGLQFPVGRIGRYLKNGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  84

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  127



>ref|XP_006381182.1| histone H2A family protein [Populus trichocarpa]
 ref|XP_011019915.1| PREDICTED: histone H2A [Populus euphratica]
 gb|ABK94574.1| unknown [Populus trichocarpa]
 gb|ERP58979.1| histone H2A family protein [Populus trichocarpa]
Length=149

 Score =   151 bits (382),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S KAGLQFPVGRI RYLKKGRY+QR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSAKAGLQFPVGRIGRYLKKGRYSQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|KDP23489.1| hypothetical protein JCGZ_23322 [Jatropha curcas]
Length=149

 Score =   151 bits (381),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V+KSI+AGLQFPVGRI+R+LKKGRYAQR G GAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  21   AVSKSIRAGLQFPVGRISRFLKKGRYAQRYGAGAPIYLAAVLEYLAAEVLELAGNAARDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  81   KKNRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNINPVLLP  124



>sp|P02277.1|H2A3_WHEAT RecName: Full=Histone H2A.2.2 [Triticum aestivum]
Length=151

 Score =   151 bits (381),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+SIKAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  21   SVTRSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  80

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RI+PRH+LLAVRND+ELG+LL+GVTIA GGV+PNINPVLLP
Sbjct  81   KKSRIVPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINPVLLP  124



>dbj|BAJ84992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=145

 Score =   151 bits (381),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  12   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAELLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELGKLL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGKLLAGVTIAHGGVIPNINSVLLP  115



>emb|CDY04858.1| BnaAnng00400D [Brassica napus]
Length=152

 Score =   151 bits (381),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY++R GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSKRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRND+ELGKLL GVTIA GGVLPN+NPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDDELGKLLKGVTIAHGGVLPNVNPVLLP  126



>emb|CDY31587.1| BnaA10g12840D [Brassica napus]
 emb|CDX80219.1| BnaC09g35230D [Brassica napus]
Length=148

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLP  126



>ref|XP_004494603.1| PREDICTED: probable histone H2A.5-like [Cicer arietinum]
Length=146

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V+KS KAGLQFPVGRIARYLKKGRY+QR  TGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  24   AVSKSAKAGLQFPVGRIARYLKKGRYSQRLATGAPIYLAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI PRHVLLAVRND+ELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  84   KKTRINPRHVLLAVRNDDELGKLLHGVTIASGGVLPNINPVLLP  127



>ref|XP_006424768.1| hypothetical protein CICLE_v10029498mg [Citrus clementina]
 ref|XP_006488277.1| PREDICTED: histone H2A-like [Citrus sinensis]
 gb|ESR38008.1| hypothetical protein CICLE_v10029498mg [Citrus clementina]
Length=150

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI R+LKKGRY+QR G+GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSRSVKAGLQFPVGRIGRFLKKGRYSQRVGSGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK +IIPRHV LAVRNDEELGKLL+GVTIA+GGVLPNINPVLLP
Sbjct  83   KKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLP  126



>ref|XP_010558312.1| PREDICTED: histone H2A [Tarenaya hassleriana]
Length=153

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+K+GLQFPVGRI RYLKKGRY+QR GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKSGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRH+LLAVRNDEELG+LL GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHILLAVRNDEELGRLLQGVTIAHGGVLPNINPVLLP  126



>ref|XP_004149043.1| PREDICTED: histone H2A-like [Cucumis sativus]
 ref|XP_004172251.1| PREDICTED: histone H2A-like [Cucumis sativus]
 ref|XP_008457544.1| PREDICTED: histone H2A [Cucumis melo]
 gb|KGN65668.1| hypothetical protein Csa_1G481210 [Cucumis sativus]
Length=153

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK GRYA+R GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKNGRYARRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|XP_010443773.1| PREDICTED: probable histone H2A.7 [Camelina sativa]
Length=148

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS KAGLQFPVGRIAR+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSAKAGLQFPVGRIARFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  83   KKTRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNIHSVLLP  126



>dbj|BAJ87012.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99957.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08278.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGR+ RYLKKGRYAQR GTGAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  28   SVSRSVKAGLQFPVGRVGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAELLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLAVRNDEELGKLL+GVTIA GGV+P INPVLLP
Sbjct  88   KKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVVPKINPVLLP  131



>emb|CDX71069.1| BnaC03g11530D [Brassica napus]
Length=148

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+L+KGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLRKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLP  126



>gb|EMT13611.1| Protein H2A.6 [Aegilops tauschii]
Length=157

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLK+GRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA DN
Sbjct  11   AVTRSVKAGLQFPVGRIGRYLKQGRYAQRIGSGAPVYLAAVLEYLAAEVLELAGNAAVDN  70

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEE+GKLL+GVTIA GGVLPNINPVLLP
Sbjct  71   KKTRIIPRHLLLAIRNDEEIGKLLAGVTIAHGGVLPNINPVLLP  114



>ref|XP_006398714.1| hypothetical protein EUTSA_v10014920mg [Eutrema salsugineum]
 gb|ESQ40167.1| hypothetical protein EUTSA_v10014920mg [Eutrema salsugineum]
Length=152

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY++R GTGAPVYLAAVLEYL AEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKKGRYSKRVGTGAPVYLAAVLEYLVAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLKGVTIAHGGVLPNINPILLP  126



>ref|XP_009126642.1| PREDICTED: probable histone H2A.7 [Brassica rapa]
 emb|CDY09243.1| BnaA02g06690D [Brassica napus]
Length=148

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+L+KGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLRKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLP  126



>ref|XP_010455661.1| PREDICTED: probable histone H2A.7 isoform X2 [Camelina sativa]
Length=149

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSVKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRH+LLA+RNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  83   KKTRIVPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNIHSVLLP  126



>gb|EMS46915.1| Histone H2A.1 [Triticum urartu]
Length=147

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELGKLL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGKLLAGVTIAHGGVIPNINSVLLP  115



>gb|EYU28273.1| hypothetical protein MIMGU_mgv1a015602mg [Erythranthe guttata]
Length=152

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR G+GAPVY+AAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSMKAGLQFPVGRIGRYLKKGRYSQRVGSGAPVYMAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRH+LLAVRNDEELGKLL+GVTIA GGV+PNINPVLLP
Sbjct  84   KNRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVIPNINPVLLP  126



>gb|KFK27518.1| hypothetical protein AALP_AA8G393700 [Arabis alpina]
Length=148

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKS KAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVTKSTKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN +LLP
Sbjct  83   KKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINAILLP  126



>ref|XP_004251321.2| PREDICTED: histone H2A isoform X2 [Solanum lycopersicum]
Length=148

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI R+LKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRFLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRH+LLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>gb|EPS67284.1| hypothetical protein M569_07493 [Genlisea aurea]
Length=153

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S KAGLQFPVGRI RYLKKGRY++R G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSAKAGLQFPVGRIGRYLKKGRYSERVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>ref|NP_200795.1| histone H2A 6 [Arabidopsis thaliana]
 sp|Q9FJE8.1|H2A7_ARATH RecName: Full=Probable histone H2A.7; AltName: Full=HTA6 [Arabidopsis 
thaliana]
 dbj|BAB08355.1| histone H2A-like protein [Arabidopsis thaliana]
 gb|AAM63158.1| histone H2A-like protein [Arabidopsis thaliana]
 dbj|BAC42529.1| putative histone H2A [Arabidopsis thaliana]
 gb|AAO39897.1| At5g59870 [Arabidopsis thaliana]
 gb|AED97244.1| histone H2A 6 [Arabidopsis thaliana]
Length=150

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  24   SVSKSMKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  83

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLA+RNDEELGKLLSGVTIA GGVLPNIN VLLP
Sbjct  84   KKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLP  127



>ref|XP_004144786.1| PREDICTED: probable histone H2A.5-like [Cucumis sativus]
 ref|XP_004167537.1| PREDICTED: probable histone H2A.5-like [Cucumis sativus]
 gb|KGN60951.1| hypothetical protein Csa_2G030610 [Cucumis sativus]
Length=141

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V+KS+KAGLQFPVGRI RYLKKGRYAQR   GAP+YLAAVLEYLAAEVLELAGNAARDNK
Sbjct  18   VSKSVKAGLQFPVGRIGRYLKKGRYAQRTAAGAPIYLAAVLEYLAAEVLELAGNAARDNK  77

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  78   KNRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNINPVLLP  120



>gb|EMT29882.1| Histone H2A [Aegilops tauschii]
Length=156

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYA R GTGAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  26   SVTRSVKAGLQFPVGRIGRYLKKGRYAPRVGTGAPVYLAAVLEYLAAELLELAGNAAKDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLAVRNDEELGKLL+GVTIA GGV+P INPVLLP
Sbjct  86   KKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVIPKINPVLLP  129



>ref|XP_004251320.1| PREDICTED: histone H2A isoform X1 [Solanum lycopersicum]
 ref|XP_006363380.1| PREDICTED: histone H2A-like [Solanum tuberosum]
 ref|XP_006363382.1| PREDICTED: histone H2A-like [Solanum tuberosum]
Length=148

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI R+LKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRFLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRH+LLAVRNDEELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVLPNINPILLP  126



>ref|XP_011095196.1| PREDICTED: histone H2A-like [Sesamum indicum]
Length=145

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRY+QR GTGAPVY+AAVLEYLAAEVLE AGNAARDNK
Sbjct  19   VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYMAAVLEYLAAEVLEFAGNAARDNK  78

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHV LAVRNDEELGKLL+GVTIA GGVLP INPVLLP
Sbjct  79   KNRIIPRHVWLAVRNDEELGKLLAGVTIAHGGVLPKINPVLLP  121



>ref|XP_010104725.1| putative histone H2A.5 [Morus notabilis]
 gb|EXC01677.1| putative histone H2A.5 [Morus notabilis]
Length=147

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V+KS+KAGLQFPVGRI RYLKKGRYAQR GTGAP+YL+AVLEYLAAEVLELAGNAARDN
Sbjct  19   AVSKSVKAGLQFPVGRIVRYLKKGRYAQRTGTGAPIYLSAVLEYLAAEVLELAGNAARDN  78

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRHVLLAVRND+ELGKLL  VTI++GGVLPNINPVLLP
Sbjct  79   KKNRINPRHVLLAVRNDDELGKLLQSVTISSGGVLPNINPVLLP  122



>ref|XP_006281263.1| hypothetical protein CARUB_v10027309mg [Capsella rubella]
 gb|EOA14161.1| hypothetical protein CARUB_v10027309mg [Capsella rubella]
Length=150

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RNDEELG+LLSGVTIA GGVLPNI+ VLLP
Sbjct  83   KKTRIIPRHLLLAIRNDEELGRLLSGVTIAHGGVLPNIHSVLLP  126



>ref|XP_009392699.1| PREDICTED: histone H2A [Musa acuminata subsp. malaccensis]
Length=150

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI R+LKKGRYAQR G GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  25   VSRSVKAGLQFPVGRIGRFLKKGRYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNK  84

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  127



>ref|XP_003578017.1| PREDICTED: histone H2A [Brachypodium distachyon]
Length=154

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAE+LELAGNAARDN
Sbjct  27   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAELLELAGNAARDN  86

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLA+RND+ELGKLL+GVTIA GGV+P IN VLLP
Sbjct  87   KKTRIIPRHLLLAIRNDDELGKLLAGVTIAHGGVMPKINQVLLP  130



>ref|XP_003554652.1| PREDICTED: probable histone H2A.5 [Glycine max]
 gb|KHN43294.1| Putative histone H2A.5 [Glycine soja]
Length=144

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPV R+ARYLKKGRY++R GTGAP+YLAAVLEYLAAEVLELAGNAARDN
Sbjct  18   SVSKSIKAGLQFPVSRVARYLKKGRYSRRLGTGAPIYLAAVLEYLAAEVLELAGNAARDN  77

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRHVLLAVRND+ELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  78   KKNRINPRHVLLAVRNDDELGKLLQGVTIASGGVLPNINPVLLP  121



>gb|EMS62077.1| Histone H2A [Triticum urartu]
Length=156

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLK GRYA+R GTGAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKNGRYAKRVGTGAPVYLAAVLEYLAAELLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RI+PRH+LLAVRND+ELG+LL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKSRIVPRHLLLAVRNDQELGRLLAGVTIAHGGVLPNINPVLLP  131



>ref|XP_002872262.1| hypothetical protein ARALYDRAFT_489561 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48521.1| hypothetical protein ARALYDRAFT_489561 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKS+KAGLQFPVGRIARYLKKGRYA R G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  25   SVTKSVKAGLQFPVGRIARYLKKGRYAIRYGSGAPVYLAAVLEYLAAEVLELAGNAARDN  84

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRH+ LA+RNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  85   KKNRINPRHLCLAIRNDEELGKLLHGVTIASGGVLPNINPVLLP  128



>dbj|BAJ86067.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=166

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  26   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAELLELAGNAAKDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLAVRNDEELGKLL+GVTIA GGV+PNIN VLLP
Sbjct  86   KKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVVPNINTVLLP  129



>ref|XP_010942329.1| PREDICTED: histone H2A.1-like [Elaeis guineensis]
Length=140

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++++KAGLQFPVGRIAR+LKKGRYA+R G+GAP+YLAAVLEYLAAEVLELAGNAARDNK
Sbjct  22   VSRAVKAGLQFPVGRIARFLKKGRYAERVGSGAPIYLAAVLEYLAAEVLELAGNAARDNK  81

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KTRIIPRHVLLAVRNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  82   KTRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNIHQVLLP  124



>gb|KFK24714.1| hypothetical protein AALP_AA8G015200 [Arabis alpina]
Length=152

 Score =   149 bits (377),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+K+GLQFPVGRI RYLKKGRY++R G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKSGLQFPVGRIGRYLKKGRYSKRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL GVTIA GGVLPNINP+LLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLKGVTIAHGGVLPNINPILLP  126



>emb|CDP09012.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  156  TKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNKK  335
            ++S KAGLQFPVGRI RYLKKGRY++R GTGAPVY+AAVLEYLAAEVLELAGNAARDNKK
Sbjct  25   SRSTKAGLQFPVGRIGRYLKKGRYSERVGTGAPVYMAAVLEYLAAEVLELAGNAARDNKK  84

Query  336  TRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
             RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   NRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|EMT16548.1| Protein H2A.6 [Aegilops tauschii]
Length=146

 Score =   149 bits (377),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>gb|EMT21049.1| Protein H2A.6 [Aegilops tauschii]
Length=205

 Score =   151 bits (381),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S KAGLQFPVGRI R+LKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  11   AVTRSTKAGLQFPVGRIGRFLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  70

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRH+LLA+RND+ELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  71   KKTRIVPRHLLLAIRNDQELGKLLAGVTIAHGGVLPNINPVLLP  114



>ref|XP_007206077.1| hypothetical protein PRUPE_ppa012844mg [Prunus persica]
 ref|XP_008241452.1| PREDICTED: histone H2A-like [Prunus mume]
 gb|EMJ07276.1| hypothetical protein PRUPE_ppa012844mg [Prunus persica]
Length=152

 Score =   149 bits (377),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK GRY++R GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRYLKNGRYSKRIGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLP  126



>gb|EMS64812.1| Protein H2A.6 [Triticum urartu]
Length=146

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>dbj|BAK05388.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=146

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAELLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>ref|XP_010455652.1| PREDICTED: probable histone H2A.7 isoform X1 [Camelina sativa]
Length=149

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS KAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSTKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRI+PRH+LLA+RNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  83   KKTRIVPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNIHSVLLP  126



>sp|Q43213.3|H2A5_WHEAT RecName: Full=Protein H2A.5; AltName: Full=wcH2A-2 [Triticum 
aestivum]
 dbj|BAA07276.1| protein H2A [Triticum aestivum]
 prf||2108279A histone H2A:ISOTYPE=2
Length=145

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>emb|CDM87218.1| unnamed protein product [Triticum aestivum]
Length=176

 Score =   150 bits (378),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI R+LKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  11   AVTRSVKAGLQFPVGRIGRFLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  70

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RI+PRH+LLA+RND+ELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  71   KKSRIVPRHLLLAIRNDQELGKLLAGVTIAHGGVLPNINPVLLP  114



>sp|P02275.2|H2A1_WHEAT RecName: Full=Histone H2A.1; AltName: Full=wcH2A-9 [Triticum 
aestivum]
 dbj|BAA07279.1| protein H2A [Triticum aestivum]
 prf||2108279B histone H2A:ISOTYPE=9
Length=146

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>gb|EEC78400.1| hypothetical protein OsI_18189 [Oryza sativa Indica Group]
 gb|EEE62093.1| hypothetical protein OsJ_16877 [Oryza sativa Japonica Group]
Length=148

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 89/103 (86%), Gaps = 8/103 (8%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLE          GNAARDNK
Sbjct  26   VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLELA--------GNAARDNK  77

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  78   KNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNINPVLLP  120



>gb|EMT17582.1| Histone H2A.1 [Aegilops tauschii]
Length=147

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>ref|XP_006848587.1| hypothetical protein AMTR_s00168p00048800 [Amborella trichopoda]
 gb|ERN10168.1| hypothetical protein AMTR_s00168p00048800 [Amborella trichopoda]
Length=147

 Score =   149 bits (375),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  156  TKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNKK  335
            +KS+KAGLQFPVGRI RYLKKGRY+QR G GAPVYLAAVLEYLAAEVLELAGNAARDNKK
Sbjct  24   SKSVKAGLQFPVGRITRYLKKGRYSQRVGIGAPVYLAAVLEYLAAEVLELAGNAARDNKK  83

Query  336  TRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            +RIIPRHVLLAVRND+ELGKLL+GVTI  GGVLPNINPVLLP
Sbjct  84   SRIIPRHVLLAVRNDDELGKLLAGVTIPHGGVLPNINPVLLP  125



>gb|KJB45295.1| hypothetical protein B456_007G299000 [Gossypium raimondii]
Length=143

 Score =   148 bits (374),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +V+KS KAGLQFPVGRIARYLKKGRYAQR G GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  19   AVSKSAKAGLQFPVGRIARYLKKGRYAQRYGGGAPVYLAAVLEYLAAEVLELAGNAARDN  78

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNIN VLLP
Sbjct  79   KKNRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNINAVLLP  122



>ref|XP_006288848.1| hypothetical protein CARUB_v10002193mg [Capsella rubella]
 gb|EOA21746.1| hypothetical protein CARUB_v10002193mg [Capsella rubella]
Length=151

 Score =   149 bits (375),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKS+KAGLQFPVGRIARYLKKGRYA R G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVTKSVKAGLQFPVGRIARYLKKGRYAIRYGSGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRH+ LA+RNDEELGKLLSGVTIA+GGVLP+INPVLLP
Sbjct  88   KKNRINPRHLCLAIRNDEELGKLLSGVTIASGGVLPHINPVLLP  131



>gb|EMT06531.1| Protein H2A.6 [Aegilops tauschii]
Length=136

 Score =   148 bits (374),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI R+LKKGRYAQR G GAPVYLA+VLEYLAAE+LELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRFLKKGRYAQRVGMGAPVYLASVLEYLAAELLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLA+RND+ELGKLL+GVTIA GGVLPNINP+LLP
Sbjct  72   KKSRIIPRHLLLAIRNDQELGKLLAGVTIAHGGVLPNINPLLLP  115



>ref|XP_010455104.1| PREDICTED: probable histone H2A.5 [Camelina sativa]
Length=151

 Score =   149 bits (375),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKS+KAGLQFPVGRIARYLKKGRYA R G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  28   SVTKSVKAGLQFPVGRIARYLKKGRYAIRYGSGAPVYLAAVLEYLAAEVLELAGNAARDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRH+ LA+RNDEELGKLL GVTIA+GGVLPNINP+LLP
Sbjct  88   KKNRINPRHLCLAIRNDEELGKLLQGVTIASGGVLPNINPILLP  131



>dbj|BAJ97579.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=147

 Score =   148 bits (374),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAELLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>gb|EMS62078.1| Histone H2A [Triticum urartu]
Length=156

 Score =   149 bits (375),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLK GRYA+R GTGAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGRIGRYLKNGRYAKRVGTGAPVYLAAVLEYLAAELLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI+PRH+LLAVRND+ELG+LL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKYRIVPRHLLLAVRNDQELGRLLAGVTIAHGGVLPNINPVLLP  131



>ref|XP_006288838.1| hypothetical protein CARUB_v10002180mg [Capsella rubella]
 gb|EOA21736.1| hypothetical protein CARUB_v10002180mg [Capsella rubella]
Length=154

 Score =   149 bits (375),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+K+GLQFPVGRI RYLKKGRY++R GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  26   VSRSVKSGLQFPVGRIGRYLKKGRYSKRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  85

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELG LL GVTIA GGVLPNINP+LLP
Sbjct  86   KNRIIPRHVLLAVRNDEELGTLLKGVTIAHGGVLPNINPILLP  128



>gb|EMS68239.1| Histone H2A [Triticum urartu]
Length=155

 Score =   149 bits (375),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S+KAGLQFPVGRI RYLKKGRYAQR GTGAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  28   SVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAELLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLAVRND ELGKLL+GVTIA GGV+P INPVLLP
Sbjct  88   KKSRIIPRHLLLAVRNDAELGKLLAGVTIAHGGVVPKINPVLLP  131



>dbj|BAK00643.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=156

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>sp|Q9M531.1|H2A_EUPES RecName: Full=Histone H2A [Euphorbia esula]
 gb|AAF65769.1|AF242311_1 histone H2A [Euphorbia esula]
Length=153

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI R+LKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  24   VSRSVKAGLQFPVGRIGRFLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNK  83

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLL  458
            K RIIPRHVLLAVRNDEELGKLL+GVTIA GGVLPNINPVLL
Sbjct  84   KNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLL  125



>ref|XP_005643643.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169]
 ref|XP_005643658.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169]
 ref|XP_005643674.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169]
 ref|XP_005648175.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19099.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19114.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19130.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23631.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169]
Length=123

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS KAGLQFPVGRIARYLKKG+YA R G GAPVYLAAVLEYLAAE+LELAGNAARDN
Sbjct  13   SVSKSTKAGLQFPVGRIARYLKKGKYASRVGAGAPVYLAAVLEYLAAEILELAGNAARDN  72

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+ LAVRNDEEL KLLSGVTIA+GGVLPNI+ VLLP
Sbjct  73   KKTRIIPRHIQLAVRNDEELSKLLSGVTIASGGVLPNIHSVLLP  116



>ref|XP_003568288.1| PREDICTED: probable histone H2A.4 [Brachypodium distachyon]
Length=163

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+KAGLQFPVGRI RYLK GRYA+R GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  25   VSRSVKAGLQFPVGRIGRYLKLGRYAKRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  84

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            + RIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNINPVLLP
Sbjct  85   RNRIIPRHVLLAIRNDEELGKLLAGVTIAYGGVLPNINPVLLP  127



>ref|NP_195876.1| histone H2A 12 [Arabidopsis thaliana]
 sp|Q9LZ46.1|H2A4_ARATH RecName: Full=Probable histone H2A.4; AltName: Full=HTA12 [Arabidopsis 
thaliana]
 emb|CAB85993.1| putative protein [Arabidopsis thaliana]
 gb|AAM62739.1| histone H2A [Arabidopsis thaliana]
 gb|ABF59030.1| At5g02560 [Arabidopsis thaliana]
 gb|AED90489.1| histone H2A 12 [Arabidopsis thaliana]
Length=153

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V++S+K+GLQFPVGRI RYLKKGRY++R GTGAPVYLAAVLEYLAAEVLELAGNAARDNK
Sbjct  25   VSRSVKSGLQFPVGRIGRYLKKGRYSKRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNK  84

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RIIPRHVLLAVRNDEELG LL GVTIA GGVLPNINP+LLP
Sbjct  85   KNRIIPRHVLLAVRNDEELGTLLKGVTIAHGGVLPNINPILLP  127



>ref|XP_001769677.1| histone H2A [Physcomitrella patens]
 gb|EDQ65478.1| histone H2A [Physcomitrella patens]
Length=148

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKS KAGLQFPVGR+ RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNA+RDN
Sbjct  16   SVTKSAKAGLQFPVGRLGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNASRDN  75

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+ LA+RNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  76   KKSRIIPRHIQLAIRNDEELGKLLSGVTIAYGGVLPNIHSVLLP  119



>dbj|BAJ96803.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVG I RYLKKGRYA+R GTGAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  28   SVTRSVKAGLQFPVGSIGRYLKKGRYAKRVGTGAPVYLAAVLEYLAAELLELAGNAAKDN  87

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RI+PRH+LLAVRND+ELG+LL+GVTIA GGVLPNINPVLLP
Sbjct  88   KKSRIVPRHLLLAVRNDQELGRLLAGVTIAHGGVLPNINPVLLP  131



>emb|CDY05567.1| BnaA02g31240D [Brassica napus]
Length=157

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KS+KAGLQFPVGRIARYLKKGRYA R G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSVKAGLQFPVGRIARYLKKGRYAVRYGSGAPVYLAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRH+ LA+RNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  83   KKNRINPRHLCLAIRNDEELGKLLHGVTIASGGVLPNINPVLLP  126



>dbj|BAK04939.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=147

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAE+LELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAELLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTR+IPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRVIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>ref|XP_010493993.1| PREDICTED: probable histone H2A.5 [Camelina sativa]
Length=150

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKS+KAGLQFPVGRIARYLKKGRYA R G+GAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  27   SVTKSVKAGLQFPVGRIARYLKKGRYAIRYGSGAPVYLAAVLEYLAAEVLELAGNAARDN  86

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK RI PRH+ LA+RNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  87   KKNRINPRHLCLAIRNDEELGKLLQGVTIASGGVLPNINPVLLP  130



>gb|ACG24751.1| histone H2A [Zea mays]
Length=150

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV++S +AGLQFPV R+ RYLKKGRYAQR GTGAPVYLAAVLEYLAAEVLELAGNAARDN
Sbjct  26   SVSRSSRAGLQFPVSRVGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDN  85

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRHVLLA+RNDEELGKLL+GVTIA GGVLPNI+ VLLP
Sbjct  86   KKTRIIPRHVLLAIRNDEELGKLLTGVTIAHGGVLPNIHTVLLP  129



>ref|XP_008454292.1| PREDICTED: probable histone H2A.5 [Cucumis melo]
Length=141

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  153  VTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDNK  332
            V+KS+KAGLQFPVGRI RYLKKGRYA+R   GAP+YLAAVLEYLAAEVLELAGNAARDNK
Sbjct  18   VSKSVKAGLQFPVGRIGRYLKKGRYAKRTAAGAPIYLAAVLEYLAAEVLELAGNAARDNK  77

Query  333  KTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            K RI PRHVLLAVRNDEELGKLL GVTIA+GGVLPNINPVLLP
Sbjct  78   KNRINPRHVLLAVRNDEELGKLLQGVTIASGGVLPNINPVLLP  120



>ref|XP_009120510.1| PREDICTED: probable histone H2A.7 [Brassica rapa]
Length=148

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SV+KSIKAGLQFPVGRI R+LKKGRYAQR G GAPVY+AAVLEYLAAEVLELAGNAARDN
Sbjct  23   SVSKSIKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDN  82

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+LLA+RNDEE GKLLSGVTIA GGVLPNIN VLLP
Sbjct  83   KKSRIIPRHLLLAIRNDEEPGKLLSGVTIAHGGVLPNINSVLLP  126



>dbj|BAJ95629.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=148

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            +VT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  12   AVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PNIN VLLP
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLP  115



>ref|XP_001764943.1| histone H2A [Physcomitrella patens]
 gb|EDQ70159.1| histone H2A [Physcomitrella patens]
Length=148

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVTKS KAGLQFPVGR+ RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNA+RDN
Sbjct  16   SVTKSAKAGLQFPVGRLGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNASRDN  75

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KK+RIIPRH+ LA+RNDEELGKLLSGVTIA GGVLPNI+ VLLP
Sbjct  76   KKSRIIPRHIQLAIRNDEELGKLLSGVTIAYGGVLPNIHSVLLP  119



>gb|EMT24733.1| Protein H2A.6 [Aegilops tauschii]
Length=146

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  150  SVTKSIKAGLQFPVGRIARYLKKGRYAQRCGTGAPvylaavleylaaevlelaGNAARDN  329
            SVT+S+KAGLQFPVGRI RYLKKGRYAQR G+GAPVYLAAVLEYLAAEVLELAGNAA+DN
Sbjct  12   SVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDN  71

Query  330  KKTRIIPRHVLLAVRNDEELGKLLSGVTIAAGGVLPNINPVLLP  461
            KKTRIIPRH+LLAVRND+ELG+LL+GVTIA GGV+PN NPVL P
Sbjct  72   KKTRIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNTNPVLPP  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000