BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G16

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008453712.1|  PREDICTED: transmembrane and coiled-coil dom...    149   3e-38   Cucumis melo [Oriental melon]
ref|XP_004234544.1|  PREDICTED: transmembrane and coiled-coil dom...    146   4e-37   Solanum lycopersicum
ref|XP_006343378.1|  PREDICTED: transmembrane and coiled-coil dom...    144   3e-36   Solanum tuberosum [potatoes]
ref|XP_004164664.1|  PREDICTED: transmembrane and coiled-coil dom...    143   6e-36   
ref|XP_010317300.1|  PREDICTED: uncharacterized protein LOC104646015    139   1e-35   
ref|XP_010446814.1|  PREDICTED: transmembrane and coiled-coil dom...    140   4e-35   Camelina sativa [gold-of-pleasure]
gb|EYU24080.1|  hypothetical protein MIMGU_mgv1a002505mg                140   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_009615488.1|  PREDICTED: transmembrane and coiled-coil dom...    140   5e-35   Nicotiana tomentosiformis
ref|XP_007157950.1|  hypothetical protein PHAVU_002G111800g             140   6e-35   Phaseolus vulgaris [French bean]
gb|KDO71092.1|  hypothetical protein CISIN_1g006082mg                   139   6e-35   Citrus sinensis [apfelsine]
ref|NP_001078500.2|  uncharacterized protein                            139   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KDO71087.1|  hypothetical protein CISIN_1g006082mg                   139   1e-34   Citrus sinensis [apfelsine]
ref|XP_006466894.1|  PREDICTED: transmembrane and coiled-coil dom...    139   2e-34   
ref|XP_006425555.1|  hypothetical protein CICLE_v10025097mg             139   2e-34   
ref|XP_010437365.1|  PREDICTED: transmembrane and coiled-coil dom...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010432190.1|  PREDICTED: transmembrane and coiled-coil dom...    138   6e-34   
ref|XP_010033460.1|  PREDICTED: transmembrane and coiled-coil dom...    137   1e-33   Eucalyptus grandis [rose gum]
gb|KCW53100.1|  hypothetical protein EUGRSUZ_J02394                     137   1e-33   Eucalyptus grandis [rose gum]
ref|XP_006412018.1|  hypothetical protein EUTSA_v10024597mg             135   3e-33   
ref|XP_009757145.1|  PREDICTED: transmembrane and coiled-coil dom...    135   3e-33   Nicotiana sylvestris
ref|XP_011090424.1|  PREDICTED: transmembrane and coiled-coil dom...    135   4e-33   Sesamum indicum [beniseed]
ref|XP_009600609.1|  PREDICTED: transmembrane and coiled-coil dom...    135   5e-33   Nicotiana tomentosiformis
gb|EYU31146.1|  hypothetical protein MIMGU_mgv1a002490mg                134   6e-33   Erythranthe guttata [common monkey flower]
ref|XP_009789372.1|  PREDICTED: transmembrane and coiled-coil dom...    134   9e-33   Nicotiana sylvestris
gb|KFK30255.1|  hypothetical protein AALP_AA7G237500                    134   9e-33   Arabis alpina [alpine rockcress]
emb|CAN59788.1|  hypothetical protein VITISV_012480                     132   4e-32   Vitis vinifera
ref|XP_007046758.1|  Transmembrane and coiled-coil domain-contain...    132   4e-32   
gb|KDP46691.1|  hypothetical protein JCGZ_06479                         132   4e-32   Jatropha curcas
ref|XP_011100949.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    132   4e-32   Sesamum indicum [beniseed]
ref|XP_010649079.1|  PREDICTED: transmembrane and coiled-coil dom...    132   5e-32   Vitis vinifera
ref|XP_010649080.1|  PREDICTED: transmembrane and coiled-coil dom...    132   5e-32   
ref|XP_006283267.1|  hypothetical protein CARUB_v10004298mg             130   3e-31   Capsella rubella
gb|KJB43386.1|  hypothetical protein B456_007G197400                    129   6e-31   Gossypium raimondii
ref|XP_009146060.1|  PREDICTED: transmembrane and coiled-coil dom...    129   7e-31   Brassica rapa
ref|XP_003612113.1|  Transmembrane and coiled-coil domain-contain...    126   1e-30   
gb|AES95070.2|  transmembrane and coiled-coil protein                   126   5e-30   Medicago truncatula
ref|XP_003612112.1|  Transmembrane and coiled-coil domain-contain...    126   6e-30   
gb|KHG22516.1|  Transmembrane and coiled-coil domain-containing 4       125   7e-30   Gossypium arboreum [tree cotton]
ref|XP_004512102.1|  PREDICTED: transmembrane and coiled-coil dom...    123   3e-29   
ref|XP_002533809.1|  conserved hypothetical protein                     124   3e-29   Ricinus communis
ref|XP_006340700.1|  PREDICTED: transmembrane and coiled-coil dom...    124   5e-29   Solanum tuberosum [potatoes]
ref|XP_004287838.1|  PREDICTED: transmembrane and coiled-coil dom...    123   7e-29   Fragaria vesca subsp. vesca
ref|XP_004512101.1|  PREDICTED: transmembrane and coiled-coil dom...    122   8e-29   
ref|XP_004512100.1|  PREDICTED: transmembrane and coiled-coil dom...    122   1e-28   Cicer arietinum [garbanzo]
ref|XP_006573571.1|  PREDICTED: transmembrane and coiled-coil dom...    121   1e-28   
emb|CDP01935.1|  unnamed protein product                                122   2e-28   Coffea canephora [robusta coffee]
ref|XP_003517195.1|  PREDICTED: transmembrane and coiled-coil dom...    121   4e-28   Glycine max [soybeans]
ref|XP_007156109.1|  hypothetical protein PHAVU_003G259400g             120   1e-27   Phaseolus vulgaris [French bean]
gb|KHN41681.1|  Transmembrane and coiled-coil domain-containing p...    119   2e-27   Glycine soja [wild soybean]
ref|XP_003548861.1|  PREDICTED: transmembrane and coiled-coil dom...    119   2e-27   Glycine max [soybeans]
ref|XP_008241785.1|  PREDICTED: transmembrane and coiled-coil dom...    119   2e-27   Prunus mume [ume]
ref|XP_009411496.1|  PREDICTED: transmembrane and coiled-coil dom...    118   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX69212.1|  BnaC01g02410D                                          116   1e-26   
ref|XP_011025906.1|  PREDICTED: transmembrane and coiled-coil dom...    117   2e-26   Populus euphratica
ref|XP_007204629.1|  hypothetical protein PRUPE_ppa002119mg             116   3e-26   Prunus persica
ref|XP_010526787.1|  PREDICTED: transmembrane and coiled-coil dom...    115   5e-26   Tarenaya hassleriana [spider flower]
ref|XP_004146487.1|  PREDICTED: transmembrane and coiled-coil dom...    115   5e-26   
ref|XP_003520272.1|  PREDICTED: transmembrane and coiled-coil dom...    114   8e-26   Glycine max [soybeans]
ref|XP_011015560.1|  PREDICTED: transmembrane and coiled-coil dom...    114   2e-25   Populus euphratica
ref|XP_006380790.1|  hypothetical protein POPTR_0007s13750g             112   6e-25   
ref|XP_006409198.1|  hypothetical protein EUTSA_v10022586mg             112   6e-25   Eutrema salsugineum [saltwater cress]
ref|XP_008372754.1|  PREDICTED: transmembrane and coiled-coil dom...    112   9e-25   Malus domestica [apple tree]
ref|XP_009378211.1|  PREDICTED: transmembrane and coiled-coil dom...    112   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_009338652.1|  PREDICTED: transmembrane and coiled-coil dom...    112   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_003629356.1|  hypothetical protein MTR_8g076240                  109   1e-24   
ref|XP_002310840.1|  hypothetical protein POPTR_0007s13750g             111   1e-24   
emb|CDX75561.1|  BnaA01g01410D                                          110   1e-24   
ref|XP_010263882.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    110   3e-24   
ref|XP_010113393.1|  hypothetical protein L484_026725                   109   8e-24   
ref|XP_010679841.1|  PREDICTED: transmembrane and coiled-coil dom...    108   1e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN36057.1|  Transmembrane and coiled-coil domain-containing p...    107   2e-23   Glycine soja [wild soybean]
ref|XP_010933754.1|  PREDICTED: uncharacterized membrane protein ...    104   2e-22   
ref|XP_010526790.1|  PREDICTED: transmembrane and coiled-coil dom...    104   3e-22   Tarenaya hassleriana [spider flower]
ref|XP_009112467.1|  PREDICTED: transmembrane and coiled-coil dom...    104   4e-22   Brassica rapa
ref|XP_010933753.1|  PREDICTED: transmembrane and coiled-coil dom...    103   4e-22   
ref|XP_006297154.1|  hypothetical protein CARUB_v10013157mg             103   5e-22   
ref|XP_010933752.1|  PREDICTED: transmembrane and coiled-coil dom...    103   6e-22   
ref|XP_006297155.1|  hypothetical protein CARUB_v10013157mg             103   7e-22   Capsella rubella
ref|XP_010933751.1|  PREDICTED: transmembrane and coiled-coil dom...    103   7e-22   Elaeis guineensis
ref|XP_004509335.1|  PREDICTED: transmembrane and coiled-coil dom...    103   9e-22   Cicer arietinum [garbanzo]
gb|KFK40188.1|  hypothetical protein AALP_AA3G341700                    101   4e-21   Arabis alpina [alpine rockcress]
gb|KFK40189.1|  hypothetical protein AALP_AA3G341700                    101   4e-21   Arabis alpina [alpine rockcress]
ref|XP_006829156.1|  hypothetical protein AMTR_s00001p00269860          100   7e-21   Amborella trichopoda
ref|XP_010271492.1|  PREDICTED: transmembrane and coiled-coil dom...    100   8e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010271491.1|  PREDICTED: transmembrane and coiled-coil dom...    100   8e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010489507.1|  PREDICTED: transmembrane and coiled-coil dom...  99.8    2e-20   
gb|EPS66741.1|  hypothetical protein M569_08033                       99.4    2e-20   Genlisea aurea
ref|XP_010489505.1|  PREDICTED: transmembrane and coiled-coil dom...  99.4    2e-20   
ref|XP_010489506.1|  PREDICTED: transmembrane and coiled-coil dom...  99.4    2e-20   
ref|XP_008796876.1|  PREDICTED: uncharacterized membrane protein ...  97.1    8e-20   
ref|XP_008796875.1|  PREDICTED: transmembrane and coiled-coil dom...  97.1    1e-19   Phoenix dactylifera
ref|XP_010413917.1|  PREDICTED: transmembrane and coiled-coil dom...  96.3    2e-19   
ref|XP_010467612.1|  PREDICTED: transmembrane and coiled-coil dom...  95.1    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010061018.1|  PREDICTED: transmembrane and coiled-coil dom...  94.7    7e-19   Eucalyptus grandis [rose gum]
gb|KCW67917.1|  hypothetical protein EUGRSUZ_F01619                   94.7    8e-19   Eucalyptus grandis [rose gum]
ref|NP_001132355.1|  uncharacterized protein LOC100193799             94.0    1e-18   Zea mays [maize]
gb|AAO42809.1|  At2g18100                                             93.6    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558988.1|  PREDICTED: transmembrane and coiled-coil dom...  93.6    2e-18   Brachypodium distachyon [annual false brome]
ref|NP_179401.2|  uncharacterized protein                             93.6    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAD20116.1|  unknown protein                                       93.6    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AFW89821.1|  putative DUF26 domain receptor-like protein kinase    92.0    5e-18   
ref|XP_004986015.1|  PREDICTED: transmembrane and coiled-coil dom...  92.0    6e-18   Setaria italica
gb|ACN33345.1|  unknown                                               92.0    6e-18   Zea mays [maize]
ref|XP_008658122.1|  PREDICTED: uncharacterized protein LOC100193...  92.0    7e-18   Zea mays [maize]
gb|AFW89818.1|  putative DUF26 domain receptor-like protein kinase    92.0    8e-18   
gb|AFW89820.1|  putative DUF26 domain receptor-like protein kinase    91.7    1e-17   
gb|AFW89819.1|  putative DUF26 domain receptor-like protein kinase    91.7    1e-17   
gb|KJB29622.1|  hypothetical protein B456_005G110800                  90.9    1e-17   Gossypium raimondii
gb|KJB29619.1|  hypothetical protein B456_005G110800                  90.5    2e-17   Gossypium raimondii
gb|KJB29620.1|  hypothetical protein B456_005G110800                  90.5    2e-17   Gossypium raimondii
gb|KJB29621.1|  hypothetical protein B456_005G110800                  90.5    2e-17   Gossypium raimondii
ref|NP_001048731.1|  Os03g0112800                                     90.5    2e-17   
gb|EAY88253.1|  hypothetical protein OsI_09705                        90.5    2e-17   Oryza sativa Indica Group [Indian rice]
gb|ABF93615.1|  expressed protein                                     90.5    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465997.1|  hypothetical protein SORBIDRAFT_01g049760        90.1    3e-17   
ref|XP_002884114.1|  hypothetical protein ARALYDRAFT_480715           89.7    4e-17   
ref|XP_007017689.1|  Transmembrane and coiled-coil domain-contain...  89.4    6e-17   
ref|XP_004291817.1|  PREDICTED: transmembrane and coiled-coil dom...  89.4    6e-17   Fragaria vesca subsp. vesca
ref|XP_007017690.1|  Transmembrane and coiled-coil domain-contain...  89.4    6e-17   
emb|CDY30329.1|  BnaA09g09480D                                        89.4    9e-17   Brassica napus [oilseed rape]
gb|KHG10124.1|  Transmembrane and coiled-coil domain-containing 4     88.6    9e-17   Gossypium arboreum [tree cotton]
ref|XP_010317700.1|  PREDICTED: transmembrane and coiled-coil dom...  87.8    2e-16   Solanum lycopersicum
gb|EMT20138.1|  hypothetical protein F775_14016                       87.0    3e-16   
ref|XP_008221322.1|  PREDICTED: transmembrane and coiled-coil dom...  86.7    4e-16   Prunus mume [ume]
ref|XP_007226229.1|  hypothetical protein PRUPE_ppa016746mg           86.3    6e-16   
dbj|BAJ94309.1|  predicted protein                                    85.5    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY53279.1|  BnaC09g09640D                                        84.7    2e-15   Brassica napus [oilseed rape]
ref|XP_009420791.1|  PREDICTED: transmembrane and coiled-coil dom...  83.6    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH36226.1|  transmembrane and coiled-coil protein                 83.2    5e-15   Medicago truncatula
ref|XP_003603726.1|  Transmembrane and coiled-coil domain-contain...  83.2    6e-15   Medicago truncatula
ref|XP_004982627.1|  PREDICTED: transmembrane and coiled-coil dom...  82.8    8e-15   Setaria italica
gb|AFW89817.1|  putative DUF26 domain receptor-like protein kinase    81.6    1e-14   
gb|AFW89816.1|  putative DUF26 domain receptor-like protein kinase    81.6    1e-14   
ref|XP_004500958.1|  PREDICTED: transmembrane and coiled-coil dom...  81.6    2e-14   Cicer arietinum [garbanzo]
ref|XP_008366768.1|  PREDICTED: uncharacterized protein LOC103430409  80.9    3e-14   
ref|XP_009335556.1|  PREDICTED: transmembrane and coiled-coil dom...  81.3    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_002464384.1|  hypothetical protein SORBIDRAFT_01g017280        78.6    2e-13   
ref|XP_008668853.1|  PREDICTED: putative DUF726-domain family pro...  78.2    3e-13   
ref|NP_001130514.1|  putative DUF726-domain family protein            78.2    3e-13   Zea mays [maize]
ref|XP_008668907.1|  PREDICTED: putative DUF726-domain family pro...  78.2    3e-13   
gb|KHN00498.1|  Transmembrane and coiled-coil domain-containing p...  77.4    5e-13   Glycine soja [wild soybean]
gb|EMT23841.1|  hypothetical protein F775_21532                       76.6    9e-13   
ref|XP_002510477.1|  conserved hypothetical protein                   75.9    2e-12   
gb|AAG13564.1|AC073867_10  hypothetical protein                       72.8    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574182.1|  PREDICTED: transmembrane and coiled-coil dom...  74.3    5e-12   Brachypodium distachyon [annual false brome]
ref|NP_001176237.1|  Os10g0512100                                     72.0    3e-11   
gb|EAY79183.1|  hypothetical protein OsI_34294                        72.0    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006661949.1|  PREDICTED: transmembrane and coiled-coil dom...  70.9    7e-11   Oryza brachyantha
ref|XP_009112468.1|  PREDICTED: transmembrane and coiled-coil dom...  70.1    1e-10   Brassica rapa
gb|KHN09111.1|  Transmembrane and coiled-coil domain-containing p...  67.4    1e-09   Glycine soja [wild soybean]
ref|XP_003527670.1|  PREDICTED: transmembrane and coiled-coil dom...  67.0    1e-09   
ref|XP_008778296.1|  PREDICTED: uncharacterized protein LOC103698100  65.5    2e-09   Phoenix dactylifera
gb|ACN33374.1|  unknown                                               64.7    3e-09   Zea mays [maize]
ref|XP_006650970.1|  PREDICTED: transmembrane and coiled-coil dom...  65.1    5e-09   
ref|XP_010934561.1|  PREDICTED: transmembrane and coiled-coil dom...  65.1    6e-09   
ref|XP_010934563.1|  PREDICTED: transmembrane and coiled-coil dom...  64.7    7e-09   
ref|XP_010934560.1|  PREDICTED: transmembrane and coiled-coil dom...  64.7    8e-09   Elaeis guineensis
ref|XP_010934564.1|  PREDICTED: transmembrane and coiled-coil dom...  63.2    2e-08   
ref|XP_010317701.1|  PREDICTED: transmembrane and coiled-coil dom...  62.4    4e-08   
ref|XP_006343380.1|  PREDICTED: transmembrane and coiled-coil dom...  60.8    1e-07   Solanum tuberosum [potatoes]
ref|XP_002968294.1|  hypothetical protein SELMODRAFT_170005           57.0    2e-06   
ref|XP_002976085.1|  hypothetical protein SELMODRAFT_104378           57.0    2e-06   Selaginella moellendorffii
ref|XP_009615489.1|  PREDICTED: transmembrane and coiled-coil dom...  55.5    8e-06   Nicotiana tomentosiformis
ref|XP_009615490.1|  PREDICTED: transmembrane and coiled-coil dom...  53.1    4e-05   Nicotiana tomentosiformis
ref|XP_006343379.1|  PREDICTED: transmembrane and coiled-coil dom...  49.3    1e-04   
ref|XP_007136056.1|  hypothetical protein PHAVU_009G014300g           52.0    1e-04   Phaseolus vulgaris [French bean]
ref|XP_009757146.1|  PREDICTED: transmembrane and coiled-coil dom...  51.6    1e-04   Nicotiana sylvestris
ref|XP_009757147.1|  PREDICTED: transmembrane and coiled-coil dom...  49.7    6e-04   Nicotiana sylvestris



>ref|XP_008453712.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Cucumis melo]
Length=666

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +LAPTQRYA+ AL  LAL+QAQIHQTRPLG P D  +   ++R SS S SSSDSVSEDP+
Sbjct  6    LLAPTQRYASGALFALALHQAQIHQTRPLGFPDD--DARAEERTSSCSGSSSDSVSEDPE  63

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+SS LLRPVF+FLEID  AW+GLEETAG+G A  H+GAFLRLLSE   D SSE++E
Sbjct  64   LWVHESSGLLRPVFRFLEIDSSAWSGLEETAGSGTAKHHIGAFLRLLSE-DNDNSSEMIE  122

Query  500  REITLANSIDSMASSIEKTVDLESEKEKLREYENE  604
            +E+ L+ S+D +A ++EK +     KEK REYE+E
Sbjct  123  QELALSKSVDGIAENMEKNIISSQSKEKYREYEDE  157



>ref|XP_004234544.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Solanum lycopersicum]
Length=661

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 119/156 (76%), Gaps = 6/156 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L PT RYAA AL GLAL+QAQIHQT PLG P    E+       S S SS+DSVS+DPQ
Sbjct  6    MLTPTHRYAAGALFGLALHQAQIHQTCPLGFPDTPPEE------RSSSCSSADSVSDDPQ  59

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+SS+LLRP+FKFLEID  AW+GLEETA + P   HVGAFLRLLSE S D SSE  +
Sbjct  60   LWVHESSALLRPIFKFLEIDDKAWSGLEETAASTPPKHHVGAFLRLLSEESDDGSSEAAD  119

Query  500  REITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+ LAN +D+MASS+EKT D ES++EK REY++EC
Sbjct  120  MELALANGVDAMASSMEKTSDDESKEEKRREYKHEC  155



>ref|XP_006343378.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Solanum tuberosum]
Length=661

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 118/156 (76%), Gaps = 6/156 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L PT RYAA AL GLAL+QAQIHQT PLG P    E+       S S SS+DSVS+DPQ
Sbjct  6    MLPPTHRYAAGALFGLALHQAQIHQTCPLGFPDTPPEE------RSSSGSSADSVSDDPQ  59

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+SS+LLRP+FKFLEID  AW+GLEETA + P   HVGAFLRLLSE S D SSE  +
Sbjct  60   LWVHESSALLRPIFKFLEIDDKAWSGLEETAASTPPKHHVGAFLRLLSEESDDGSSEAAD  119

Query  500  REITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+ LAN +D+MASS+E+T D ES +EK REY++EC
Sbjct  120  MELALANGVDAMASSMERTSDNESNEEKRREYKHEC  155



>ref|XP_004164664.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cucumis sativus]
 gb|KGN53277.1| hypothetical protein Csa_4G043930 [Cucumis sativus]
Length=673

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             LAPTQRYA  AL  LAL+QAQIHQTRPLG   D  +   ++R SS S SSSDSVSEDP+
Sbjct  19   FLAPTQRYATGALFALALHQAQIHQTRPLGFSDD--DARAEERTSSCSGSSSDSVSEDPE  76

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+SS+LLRPVF+FLEID  AW+GLEETAG+G A  H+GAFLRLLSE   + SSE++E
Sbjct  77   LWVHESSALLRPVFRFLEIDSAAWSGLEETAGSGTAKHHIGAFLRLLSE-DNENSSEMIE  135

Query  500  REITLANSIDSMASSIEKTVDLESEKEKLREYENE  604
            +E+ L+ S+D++  ++EK +     KEK REYE+E
Sbjct  136  QELALSKSVDAIEENMEKNIISSQSKEKYREYEDE  170



>ref|XP_010317300.1| PREDICTED: uncharacterized protein LOC104646015 [Solanum lycopersicum]
Length=344

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 115/157 (73%), Gaps = 9/157 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L P QRYAA AL GLAL+QA IHQT PLG PSD      +DRIS+GSS+ S S  EDPQL
Sbjct  6    LTPMQRYAAGALFGLALHQAHIHQTCPLGFPSD-----EEDRISNGSSNDSVS--EDPQL  58

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  496
            WVH+SS LLRP+FKFLEID  AW+GLEETAG+     HVGA LR L  SE   ++S E  
Sbjct  59   WVHESSGLLRPIFKFLEIDKKAWSGLEETAGSSSPKHHVGALLRSLSVSEEGAESSKEAA  118

Query  497  EREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            ++E+ LA +ID+MASS+E+T    S+KEK REYE++C
Sbjct  119  DKELDLAKAIDAMASSMERTSHNVSKKEKQREYEHKC  155



>ref|XP_010446814.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=672

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL  +AL QAQI+QT+PLG+PS  ++D   D     + SS DSVS+DP L
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPSAEDDD-GGDEERRSNCSSGDSVSDDPSL  66

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + DAS E++E+
Sbjct  67   WVHETSCLLRPVFRCLEIDSPAWLGLEQTACSTPAKHHIGAFTRLLSEEASDASVEMVEQ  126

Query  503  EITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            E+ LA + DSM  +I+ +V ++++KEK +EYENEC
Sbjct  127  EMALAKAADSMVYNIQSSVSIDAKKEKHQEYENEC  161



>gb|EYU24080.1| hypothetical protein MIMGU_mgv1a002505mg [Erythranthe guttata]
Length=665

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 4/157 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L PTQ+Y A AL  +AL+Q QIHQT  LG+P DG     ++R+SSGS S+SDS  EDPQ
Sbjct  8    MLTPTQKYGAGALFAMALHQTQIHQTIQLGLP-DGGGGAAEERLSSGSGSNSDS--EDPQ  64

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+SS LLRP+FKFLEID  AW GLEETA   PAN H GAFLRLL + + D SSE  E
Sbjct  65   LWVHESSGLLRPIFKFLEIDGSAWLGLEETAACSPANNHFGAFLRLLVDENRDVSSETAE  124

Query  500  REITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
            +E+ L   ID+M++S+EK+  + +S+KEK REYE  C
Sbjct  125  KEVALVKGIDAMSASMEKSPAEHDSKKEKQREYETAC  161



>ref|XP_009615488.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana tomentosiformis]
Length=662

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 124/156 (79%), Gaps = 4/156 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L PT +YAA AL+GL L+QAQIHQT PLG PSD  + L+++R  S + SSSDSVS+DP 
Sbjct  5    MLTPTHKYAAGALIGLGLHQAQIHQTCPLGFPSD--DSLSEER--SSNGSSSDSVSDDPH  60

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+SS+LLRP+FKFLEID  AW+GLEETA + P   HVGAFLRLLSE S D SSE  +
Sbjct  61   LWVHESSALLRPIFKFLEIDEKAWSGLEETAASTPPKHHVGAFLRLLSEESSDDSSEAAD  120

Query  500  REITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+ LAN +D+MASS+E+T D ESEKEK REY+NEC
Sbjct  121  MELALANGVDAMASSMERTSDNESEKEKRREYKNEC  156



>ref|XP_007157950.1| hypothetical protein PHAVU_002G111800g [Phaseolus vulgaris]
 gb|ESW29944.1| hypothetical protein PHAVU_002G111800g [Phaseolus vulgaris]
Length=665

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 116/156 (74%), Gaps = 7/156 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL GLAL QAQIHQT PLG+ +D   D   D   S  +SS  +VSEDP L
Sbjct  7    LTPTQRYAAGALFGLALNQAQIHQTHPLGLSTD---DFPSD---SEKTSSKLAVSEDPNL  60

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH+  +LLRPVFK+L+IDP+AW+GLEETAG+  A+RHVG FLRLLSE  GD  S+  ++
Sbjct  61   WVHEHHALLRPVFKYLDIDPVAWSGLEETAGSSSASRHVGPFLRLLSEDFGDDCSQRSDK  120

Query  503  EITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            E+ L+ ++D+M  S+E   + L S++EKLREYE++C
Sbjct  121  ELALSGAVDAMVLSLENNSESLRSKREKLREYEHQC  156



>gb|KDO71092.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
Length=609

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L+PTQRYAA AL  +AL+QAQ +QTRPLG+PS+ + ++ +    S SSSSSDSV+EDP+
Sbjct  6    FLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMER----SSSSSSSDSVAEDPK  61

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH++S LLRPVF+FL+ID  AW+GLEETAG  PA  H+GAFLRLLSE +GD S++  +
Sbjct  62   LWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSD  121

Query  500  REITLANSIDSMASSIEKTVDL-ESEKEKLREYENEC  607
            +E  L+ ++D+ A S+E   +  +S+KEK REYENEC
Sbjct  122  QEFALSKAVDATAVSLEADSETSKSKKEKHREYENEC  158



>ref|NP_001078500.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86635.1| uncharacterized protein AT4G36210 [Arabidopsis thaliana]
Length=672

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL  +AL QAQI+QT+PLG P+  ++D   D     + SS DSVS+DP L
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGTPAAEDDD-GGDEERRSNCSSGDSVSDDPSL  66

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + DAS+E++E+
Sbjct  67   WVHETSGLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEEANDASAEMVEQ  126

Query  503  EITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            E+ LA + D+M  SI+ +V ++++KEK +EYENEC
Sbjct  127  EMALAKAADAMVHSIQCSVSIDAKKEKHQEYENEC  161



>gb|KDO71087.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
 gb|KDO71088.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
 gb|KDO71089.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
Length=662

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L+PTQRYAA AL  +AL+QAQ +QTRPLG+PS+ + ++ +    S SSSSSDSV+EDP+
Sbjct  6    FLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMER----SSSSSSSDSVAEDPK  61

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH++S LLRPVF+FL+ID  AW+GLEETAG  PA  H+GAFLRLLSE +GD S++  +
Sbjct  62   LWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSD  121

Query  500  REITLANSIDSMASSIEKTVDL-ESEKEKLREYENEC  607
            +E  L+ ++D+ A S+E   +  +S+KEK REYENEC
Sbjct  122  QEFALSKAVDATAVSLEADSETSKSKKEKHREYENEC  158



>ref|XP_006466894.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Citrus sinensis]
 ref|XP_006466895.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Citrus sinensis]
 ref|XP_006466896.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Citrus sinensis]
 ref|XP_006466897.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X4 [Citrus sinensis]
 ref|XP_006466898.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X5 [Citrus sinensis]
Length=662

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L+PTQRYAA AL  +AL+QAQ +QTRPLG+PS+ + ++ +    S SSSSSDSV+EDP+
Sbjct  6    FLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMER----SSSSSSSDSVAEDPE  61

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH++S LLRPVF+FL+ID  AW+GLEETAG  PA  H+GAFLRLLSE +GD S++  +
Sbjct  62   LWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSD  121

Query  500  REITLANSIDSMASSIEKTVDL-ESEKEKLREYENEC  607
            +E  L+ ++D+ A S+E   +  +S+KEK REYENEC
Sbjct  122  QEFALSKAVDATAVSLEADSETSKSKKEKHREYENEC  158



>ref|XP_006425555.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
 ref|XP_006425556.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
 gb|ESR38795.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
 gb|ESR38796.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
Length=662

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 5/157 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L+PTQRYAA AL  +AL+QAQ +QTRPLG+PS+ + ++ +      SSSSSDSV+EDP+
Sbjct  6    FLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMERSS----SSSSSDSVAEDPE  61

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH++S LLRPVF+FL+ID  AW+GLEETAG  PA  H+GAFLRLLSE +GD S++  +
Sbjct  62   LWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSD  121

Query  500  REITLANSIDSMASSIEKTVDL-ESEKEKLREYENEC  607
            +E  L+ ++D+ A S+E   +  +S+KEK REYENEC
Sbjct  122  QEFALSKAVDATAVSLEADSETSKSKKEKHREYENEC  158



>ref|XP_010437365.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=672

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 117/155 (75%), Gaps = 1/155 (1%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL  +AL QAQI+QT+PLG+PS  ++D  ++     + SS DSVS+DP L
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPSAEDDDGGEEE-RRSNCSSGDSVSDDPGL  66

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + DAS E++E+
Sbjct  67   WVHETSCLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEAASDASVEMVEQ  126

Query  503  EITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            E+ LA + D+M  +I+ ++ ++++KEK +EYENEC
Sbjct  127  EMALAKAADAMVYNIQSSLSIDAKKEKHQEYENEC  161



>ref|XP_010432190.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=729

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 117/155 (75%), Gaps = 1/155 (1%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL  +AL QAQI+QT+PLG+PS  ++D  ++     + SS DSVS+DP L
Sbjct  65   LTPTQRYAAGALFAIALNQAQINQTQPLGIPSAEDDDGGEEE-RRSNCSSGDSVSDDPSL  123

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + DAS E++E+
Sbjct  124  WVHETSCLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEEASDASVEMVEQ  183

Query  503  EITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            E+ LA + D+M  +I+ ++ ++++KEK +EYENEC
Sbjct  184  EMALAKAADAMVYNIQSSLSIDAKKEKHQEYENEC  218



>ref|XP_010033460.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Eucalyptus grandis]
 gb|KCW53099.1| hypothetical protein EUGRSUZ_J02394 [Eucalyptus grandis]
Length=675

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 113/163 (69%), Gaps = 7/163 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED------LTQDRIssgsssssds  301
             L+PTQRYAA AL  LAL+QAQIHQ RPLG  +  +ED        +    S SS   DS
Sbjct  8    FLSPTQRYAAGALFALALHQAQIHQARPLGSFAASDEDDGDGASGERTSSGSSSSGGGDS  67

Query  302  vsEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA  481
            VSEDP LWVH+S+ LL PVF+FL+I+  AW GLEETAG+ PA  HVGAFLRLLSE   D 
Sbjct  68   VSEDPDLWVHESAGLLLPVFRFLDINQAAWLGLEETAGSSPAKHHVGAFLRLLSEDCADD  127

Query  482  SSEVLEREITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
            +SE LE++  LA +IDSMA S+E      +S+KEK REYE+EC
Sbjct  128  TSERLEQQFALAKAIDSMALSMETNPASFQSKKEKHREYEHEC  170



>gb|KCW53100.1| hypothetical protein EUGRSUZ_J02394 [Eucalyptus grandis]
Length=702

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 113/163 (69%), Gaps = 7/163 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED------LTQDRIssgsssssds  301
             L+PTQRYAA AL  LAL+QAQIHQ RPLG  +  +ED        +    S SS   DS
Sbjct  8    FLSPTQRYAAGALFALALHQAQIHQARPLGSFAASDEDDGDGASGERTSSGSSSSGGGDS  67

Query  302  vsEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA  481
            VSEDP LWVH+S+ LL PVF+FL+I+  AW GLEETAG+ PA  HVGAFLRLLSE   D 
Sbjct  68   VSEDPDLWVHESAGLLLPVFRFLDINQAAWLGLEETAGSSPAKHHVGAFLRLLSEDCADD  127

Query  482  SSEVLEREITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
            +SE LE++  LA +IDSMA S+E      +S+KEK REYE+EC
Sbjct  128  TSERLEQQFALAKAIDSMALSMETNPASFQSKKEKHREYEHEC  170



>ref|XP_006412018.1| hypothetical protein EUTSA_v10024597mg [Eutrema salsugineum]
 gb|ESQ53471.1| hypothetical protein EUTSA_v10024597mg [Eutrema salsugineum]
Length=676

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 120/161 (75%), Gaps = 8/161 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED------LTQDRIssgsssssdsv  304
            L PTQRYAA AL  +AL QAQI+QT+PLG+P+  ++D       ++DR    +SSS DSV
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPAAKDDDEECENRRSEDR--KSNSSSGDSV  65

Query  305  sEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  484
            S+DP LWVH+ S LLRPVF+ L+I P AW GLEETA + PA  H+GAF RLLSE + DAS
Sbjct  66   SDDPGLWVHEKSGLLRPVFRCLDIQPSAWLGLEETANSSPAKHHIGAFTRLLSEEASDAS  125

Query  485  SEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            +E++E+E+ LA + D+M  SI+ ++ ++++KEK +EYENEC
Sbjct  126  AEMMEQEMALAKAADAMVHSIQSSLSVDAKKEKHQEYENEC  166



>ref|XP_009757145.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana sylvestris]
Length=678

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 122/156 (78%), Gaps = 4/156 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            IL PT +YAA AL GL+L+QAQIHQT PLG P D  + L+++R  S + SSSDSVS+DP 
Sbjct  5    ILTPTHKYAAGALFGLSLHQAQIHQTCPLGFPPD--DSLSEER--SSNGSSSDSVSDDPH  60

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+SS+LLRP+FKFLEID  AW+GLEETA + P   HVGAFLRLLSE S D SSE  +
Sbjct  61   LWVHESSALLRPIFKFLEIDEKAWSGLEETAASTPPKHHVGAFLRLLSEESSDDSSEAAD  120

Query  500  REITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+ LAN +D+M SS+E+T D ESEKEK REY++EC
Sbjct  121  MELALANGVDAMVSSMERTSDNESEKEKRREYKHEC  156



>ref|XP_011090424.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Sesamum indicum]
 ref|XP_011090425.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Sesamum indicum]
Length=672

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 99/138 (72%), Gaps = 6/138 (4%)
 Frame = +2

Query  206  IHQTRPLGVPS---DGNEDLTQDRIssgsssssdsvsEDPQLWVHQSSSLLRPVFKFLEI  376
            +HQ  PLG PS   D   D  ++R    +SSSSD VS+DPQLWVHQS+ LLRPVFKFLEI
Sbjct  29   LHQIHPLGFPSHDDDDGSDPPEER--VSTSSSSDFVSDDPQLWVHQSAGLLRPVFKFLEI  86

Query  377  DPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASSIEKT  556
            D  AW  LEET    PA  HVGAFLRLLSE SG+ S E++++E+ LA +ID+M  S+EK+
Sbjct  87   DSRAWGALEETVAYSPAKHHVGAFLRLLSEESGNISEEIVDKELALAAAIDAMCLSMEKS  146

Query  557  V-DLESEKEKLREYENEC  607
              D +S+KEK REYEN C
Sbjct  147  PDDYKSKKEKQREYENAC  164



>ref|XP_009600609.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana tomentosiformis]
Length=661

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 114/157 (73%), Gaps = 9/157 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L P QRYAA AL GLAL+QAQIHQT PLG PSD  ED   DRIS+ SSS S S  E PQL
Sbjct  6    LTPMQRYAAGALFGLALHQAQIHQTSPLGFPSD--ED---DRISNSSSSDSVS--EGPQL  58

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  496
            WV++S  LLRP+F+FLEID  AW GLEETAG+     HVGAFLR L  SE  GD  SE  
Sbjct  59   WVNESCGLLRPLFQFLEIDKKAWPGLEETAGSSSPKHHVGAFLRSLSVSEEGGDTFSEAA  118

Query  497  EREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            E+E+ LA +ID+M SS+EKT+D  S++EK  EYE+EC
Sbjct  119  EKELDLAKAIDAMTSSMEKTLDNVSKQEKREEYEHEC  155



>gb|EYU31146.1| hypothetical protein MIMGU_mgv1a002490mg [Erythranthe guttata]
Length=667

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 111/159 (70%), Gaps = 3/159 (2%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDL--TQDRIssgsssssdsvsED  313
            +L PTQRYAA AL  LAL+QAQ HQT PLG PS  +ED           SSSSSD+VS+D
Sbjct  1    MLTPTQRYAAGALFSLALHQAQEHQTSPLGFPSHQDEDGGGESSEERVSSSSSSDAVSDD  60

Query  314  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEV  493
             QLWVHQSS LLRPVFKFLEID  AW GLEETA   P+  HVGAFLRLL+E + D S   
Sbjct  61   TQLWVHQSSGLLRPVFKFLEIDSRAWGGLEETAAYSPSKHHVGAFLRLLAEETSDVSEGA  120

Query  494  LEREITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
             E E+ L NSI++M+ S+E T  D ES+KEK REYE  C
Sbjct  121  AEMELALMNSIEAMSLSMENTPADYESKKEKQREYEQAC  159



>ref|XP_009789372.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana sylvestris]
Length=661

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 116/158 (73%), Gaps = 11/158 (7%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L P QRYAA AL GLAL+QAQIHQT PLG PSD  ED   DRIS+ SSS S S  E PQL
Sbjct  6    LTPMQRYAAGALFGLALHQAQIHQTSPLGFPSD--ED---DRISNSSSSDSVS--EGPQL  58

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLS---EGSGDASSEV  493
            WV++S  LLRPVF+FLEID  AW GLEETAG+     HVGAFLR LS   EGS D  SE 
Sbjct  59   WVNESCGLLRPVFQFLEIDKKAWPGLEETAGSSSPKHHVGAFLRPLSVSEEGS-DTFSEP  117

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+E+ LA +ID+MASS+EKT+D  S++EK  EYE+EC
Sbjct  118  AEKELDLAKAIDAMASSMEKTLDNVSKQEKREEYEHEC  155



>gb|KFK30255.1| hypothetical protein AALP_AA7G237500 [Arabis alpina]
Length=671

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L  TQRYAA AL  +AL QAQI+QT+PLG+P+  N+D   D     +SSS DSVS+DP L
Sbjct  8    LTSTQRYAAGALFAIALNQAQINQTQPLGIPASENDDEDGDN-RRSNSSSGDSVSDDPHL  66

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH++S LLRPVF+ LEI+  AW GLEETA + PA  H+GAF RLLSE + DAS E++E 
Sbjct  67   WVHETSGLLRPVFRCLEIESSAWLGLEETANSSPAKHHIGAFTRLLSEEASDASKEMIEL  126

Query  503  EITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            E+ LA + D+M  SI+ ++ ++++KEK +EYENEC
Sbjct  127  EMALAKAADAMVQSIQSSLSIDAKKEKHQEYENEC  161



>emb|CAN59788.1| hypothetical protein VITISV_012480 [Vitis vinifera]
Length=670

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 8/157 (5%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L PTQRYAA ALLGLAL QAQIHQTRPLG   + +E ++          SSDSVSEDPQ
Sbjct  4    FLTPTQRYAAGALLGLALQQAQIHQTRPLGSSIEEDERISSGS-------SSDSVSEDPQ  56

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH++S LLRPVFK L+I+  AWTGLEETAG+ PA  HVGAFLRL+SE S ++S+++ +
Sbjct  57   LWVHENSGLLRPVFKSLKIENKAWTGLEETAGSSPAKHHVGAFLRLISEESAESSADMKD  116

Query  500  REITLANSIDSMASSIEKTVDLE-SEKEKLREYENEC  607
             E+ L+ ++D M  S+E T +   S+KEK REYEN+C
Sbjct  117  AELALSKAVDVMELSMETTSETSMSKKEKHREYENKC  153



>ref|XP_007046758.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 ref|XP_007046759.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 gb|EOX90915.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 gb|EOX90916.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
Length=670

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 117/156 (75%), Gaps = 3/156 (2%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             LAPTQRYAA AL  +A++QAQ+HQTRPLG+P++  +D         SSSSSDSVSEDP+
Sbjct  8    FLAPTQRYAAGALFAIAVHQAQMHQTRPLGLPTE--DDDPSSEERMSSSSSSDSVSEDPE  65

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH +S LLRP+F+FL+ID  AW GLEETAG+ PA  HVGAFLRLL+E S D SSE L+
Sbjct  66   LWVHGNSGLLRPIFRFLDIDSAAWLGLEETAGSSPAKHHVGAFLRLLAEESEDGSSERLD  125

Query  500  REITLANSIDSMASSIEKTVD-LESEKEKLREYENE  604
            +E+ L+ ++D+M   +E   +  + +KEK REYE+E
Sbjct  126  QEVALSKAVDTMTLGMETNSESSKVKKEKHREYEHE  161



>gb|KDP46691.1| hypothetical protein JCGZ_06479 [Jatropha curcas]
Length=609

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L+ TQ+YAA AL  +A++QAQIHQ++PLG  +D N    + RISS SS+SSDSVSEDP 
Sbjct  10   LLSSTQKYAAGALFAIAVHQAQIHQSQPLGFFTDDNPTEEEQRISSSSSNSSDSVSEDPD  69

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+ S LLRPVF+FL+++  AW GLEETAG+ PA  H+G FLRLLSE   DA+S   +
Sbjct  70   LWVHKYSGLLRPVFRFLDVESAAWHGLEETAGSSPAKHHIGPFLRLLSEDGNDANSHSSD  129

Query  500  REITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
            +E+ L+ ++D M+ ++E      E +KEK REYE+EC
Sbjct  130  QELALSKAVDVMSQTMETNYASSEQKKEKHREYEHEC  166



>ref|XP_011100949.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4-like [Sesamum indicum]
Length=661

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 114/159 (72%), Gaps = 8/159 (5%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLG-VPSDGNEDLTQDRIssgsssssdsvsEDP  316
            +L P Q+YAA AL  LAL+Q QIHQT PLG +PS  ++     R+ S   SS+DSVSEDP
Sbjct  7    MLTPKQKYAAGALFALALHQVQIHQTLPLGFLPSAPDQ-----RVFSAIDSSTDSVSEDP  61

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPAN-RHVGAFLRLLSEGSGDASSEV  493
             LW HQSS LLRPVFKFLEID   W GLEETA +  A+ RHVGAFLR L + SGD SSE 
Sbjct  62   HLWAHQSSGLLRPVFKFLEIDNKEWAGLEETATHSSADRRHVGAFLRQLMDESGDMSSEA  121

Query  494  LEREITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
             E+E+++AN ID+M+  ++KT  + +S+KEK REYE  C
Sbjct  122  AEKEVSVANGIDAMSLGMQKTPAEFDSKKEKQREYEQAC  160



>ref|XP_010649079.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Vitis vinifera]
 emb|CBI17412.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 8/157 (5%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L PTQRYAA ALLGLAL QAQIHQTRPLG   + +E ++          SSDSVSEDPQ
Sbjct  4    FLTPTQRYAAGALLGLALQQAQIHQTRPLGSSIEEDERISSGS-------SSDSVSEDPQ  56

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH++S LLRPVFK L+I+  AWTGLEETAG+ PA  HVGAFLRL+SE S ++S+++ +
Sbjct  57   LWVHENSGLLRPVFKSLKIENKAWTGLEETAGSSPAKHHVGAFLRLISEESAESSADMKD  116

Query  500  REITLANSIDSMASSIEKTVDLE-SEKEKLREYENEC  607
             E+ L+ ++D M  S+E T +   S+KEK REYEN+C
Sbjct  117  AELALSKAVDVMELSMETTSETSMSKKEKHREYENKC  153



>ref|XP_010649080.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Vitis vinifera]
Length=662

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 8/157 (5%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L PTQRYAA ALLGLAL QAQIHQTRPLG   + +E ++          SSDSVSEDPQ
Sbjct  4    FLTPTQRYAAGALLGLALQQAQIHQTRPLGSSIEEDERISSGS-------SSDSVSEDPQ  56

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH++S LLRPVFK L+I+  AWTGLEETAG+ PA  HVGAFLRL+SE S ++S+++ +
Sbjct  57   LWVHENSGLLRPVFKSLKIENKAWTGLEETAGSSPAKHHVGAFLRLISEESAESSADMKD  116

Query  500  REITLANSIDSMASSIEKTVDLE-SEKEKLREYENEC  607
             E+ L+ ++D M  S+E T +   S+KEK REYEN+C
Sbjct  117  AELALSKAVDVMELSMETTSETSMSKKEKHREYENKC  153



>ref|XP_006283267.1| hypothetical protein CARUB_v10004298mg [Capsella rubella]
 gb|EOA16165.1| hypothetical protein CARUB_v10004298mg [Capsella rubella]
Length=672

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA+AL  +AL QAQI+QT+PLG+P+   +D   D     +SSS DSVS+DP L
Sbjct  8    LTPTQRYAASALFAIALNQAQINQTQPLGIPASDVDD-GADEERRSNSSSGDSVSDDPSL  66

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + +AS E++E+
Sbjct  67   WVHETSGLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEEASEASVEMVEQ  126

Query  503  EITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            EI LA + D+M  SI+ ++ + ++KEK +EYENEC
Sbjct  127  EIALAKAADAMVHSIQSSLSINAKKEKHQEYENEC  161



>gb|KJB43386.1| hypothetical protein B456_007G197400 [Gossypium raimondii]
Length=671

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L PTQRY A AL   A+ QAQIHQTRPLG+P + +   T +R  + SSSS++SVS+DP 
Sbjct  8    FLTPTQRYGAGALFAFAVNQAQIHQTRPLGLPFEDDHHSTGER--TSSSSSNESVSDDPD  65

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWV++ S LLRPVF+FL+ID  AW GLEETAG   A  HVGAF+RL++E S + SSE LE
Sbjct  66   LWVNERSGLLRPVFRFLDIDSAAWLGLEETAGTSRATNHVGAFMRLIAEQSEEGSSERLE  125

Query  500  REITLANSIDSMASSIEKTVD-LESEKEKLREYENE  604
            +EI L+ ++D+MA S+E   +  + +KEK R+YE E
Sbjct  126  QEIALSKAVDAMAFSMETNSESSQVKKEKSRKYEQE  161



>ref|XP_009146060.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Brassica rapa]
Length=677

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 118/161 (73%), Gaps = 8/161 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE------DLTQDRIssgsssssdsv  304
            L PTQRYAA AL  +AL QAQI+QT+PLG+P+  ++      D +++R    + SS DSV
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPAAPDDDDDKECDRSEER--RSNCSSGDSV  65

Query  305  sEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  484
            S+DP LWVH++S LLRPVF+ L+ID  AW GLEETA + PA  H+GAF RLLSE + +AS
Sbjct  66   SDDPNLWVHETSGLLRPVFRCLDIDSSAWLGLEETANSSPAKHHIGAFTRLLSEEASEAS  125

Query  485  SEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E++E+E+ LA + D+M  SI  ++ ++++KEK +EYENEC
Sbjct  126  VEMVEQEMALAKAADAMVHSIRSSLSIDAKKEKHQEYENEC  166



>ref|XP_003612113.1| Transmembrane and coiled-coil domain-containing protein [Medicago 
truncatula]
Length=447

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 8/156 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL GLAL+QAQ+HQT PLG+ +D       D  S  SS+S+ +V EDP L
Sbjct  16   LTPTQRYAAGALFGLALHQAQLHQTHPLGLSTD-------DFPSPSSSTSTGAVFEDPDL  68

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +++ L++
Sbjct  69   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSVATRHVGPFLRLLSEEYDDDNAKRLDQ  128

Query  503  EITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            E+ L+ ++D++  S+EK  +   S+++KLREYE+EC
Sbjct  129  ELALSEAVDALVLSLEKNSESSRSKRKKLREYEHEC  164



>gb|AES95070.2| transmembrane and coiled-coil protein [Medicago truncatula]
Length=672

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 8/156 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL GLAL+QAQ+HQT PLG+ +D       D  S  SS+S+ +V EDP L
Sbjct  16   LTPTQRYAAGALFGLALHQAQLHQTHPLGLSTD-------DFPSPSSSTSTGAVFEDPDL  68

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +++ L++
Sbjct  69   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSVATRHVGPFLRLLSEEYDDDNAKRLDQ  128

Query  503  EITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            E+ L+ ++D++  S+EK  +   S+++KLREYE+EC
Sbjct  129  ELALSEAVDALVLSLEKNSESSRSKRKKLREYEHEC  164



>ref|XP_003612112.1| Transmembrane and coiled-coil domain-containing protein [Medicago 
truncatula]
Length=717

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 8/156 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL GLAL+QAQ+HQT PLG+ +D       D  S  SS+S+ +V EDP L
Sbjct  16   LTPTQRYAAGALFGLALHQAQLHQTHPLGLSTD-------DFPSPSSSTSTGAVFEDPDL  68

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +++ L++
Sbjct  69   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSVATRHVGPFLRLLSEEYDDDNAKRLDQ  128

Query  503  EITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            E+ L+ ++D++  S+EK  +   S+++KLREYE+EC
Sbjct  129  ELALSEAVDALVLSLEKNSESSRSKRKKLREYEHEC  164



>gb|KHG22516.1| Transmembrane and coiled-coil domain-containing 4 [Gossypium 
arboreum]
Length=619

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 112/156 (72%), Gaps = 4/156 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L PTQRY A AL   A+ QAQIHQT PLG+P D +   T +R  + SSSS++SVS+DP 
Sbjct  8    FLTPTQRYGAGALFAFAVNQAQIHQTHPLGLPFDDHHS-TGER--TSSSSSNESVSDDPD  64

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWV++ S LLRPVF+FL+ID  AW GLEETAG   A  HVGAF+RL++E S + SSE LE
Sbjct  65   LWVNERSGLLRPVFRFLDIDSAAWLGLEETAGTSRATNHVGAFMRLIAEQSEEGSSERLE  124

Query  500  REITLANSIDSMASSIEKTVD-LESEKEKLREYENE  604
            +EI L+ ++D+MA S+E   +  + +KEK R+YE E
Sbjct  125  QEIALSKAVDAMAFSMETNSESSQVKKEKSRKYEQE  160



>ref|XP_004512102.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Cicer arietinum]
Length=515

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 114/156 (73%), Gaps = 9/156 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L+ TQRYAA ALLGLAL+Q+Q+HQT PLG        L+ D   S SS ++ +VSEDP+L
Sbjct  9    LSSTQRYAAGALLGLALHQSQLHQTHPLG--------LSPDEFPSPSSPTTVAVSEDPEL  60

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +S+ L+ 
Sbjct  61   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSFATRHVGPFLRLLSEEFDDDNSQRLDE  120

Query  503  EITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            E+ L+ ++D++  S+EK  +   +++EKLREYE++C
Sbjct  121  ELALSEAVDALVVSLEKNSESSRAKREKLREYEHQC  156



>ref|XP_002533809.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28578.1| conserved hypothetical protein [Ricinus communis]
Length=713

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 115/164 (70%), Gaps = 8/164 (5%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQ---DRIssgsssssdsvsE  310
             L+PTQRYAA AL  +AL+QAQ HQTRPLG   D +    Q   DR S  SS+SSDSVSE
Sbjct  24   FLSPTQRYAAGALFAIALHQAQTHQTRPLGFSPDVDPTEPQQQGDRTSCSSSNSSDSVSE  83

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS----GD  478
            DP LWVH++  LLRPVF+FLEID  AW GLEETAG+ PA  HVGAFLRLL+E +      
Sbjct  84   DPDLWVHETLGLLRPVFRFLEIDSNAWHGLEETAGSSPAKYHVGAFLRLLAENNDDDNAS  143

Query  479  ASSEVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            +S    ++E+ L+ ++D M+ ++E  TV  +S+KEK +EYE EC
Sbjct  144  SSQSSSDQELALSKAVDVMSQNMETATVSFQSKKEKHKEYEYEC  187



>ref|XP_006340700.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Solanum tuberosum]
Length=679

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 115/157 (73%), Gaps = 9/157 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L P QRYAA AL GLAL+QA IHQT PLG PSD      +DRIS+GSS+ S S  +DPQL
Sbjct  26   LTPMQRYAAGALFGLALHQAHIHQTCPLGFPSD-----EEDRISNGSSNDSVS--DDPQL  78

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  496
            WVH+SS LLRP+FKFLEID  AW+GLEETAG+     HVGA LR L  SE   ++SSE  
Sbjct  79   WVHESSGLLRPIFKFLEIDKKAWSGLEETAGSSSPKHHVGALLRSLSVSEEGAESSSEAE  138

Query  497  EREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            ++E+ LA +ID+MASS+E+T    S+KEK  EYE++C
Sbjct  139  DKELDLAKAIDAMASSMERTSHNVSKKEKQCEYEHKC  175



>ref|XP_004287838.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Fragaria vesca subsp. vesca]
Length=689

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 114/161 (71%), Gaps = 10/161 (6%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L PTQRY A AL   AL+QAQIHQTRPLG+ +   +  T DR  + S SS+DSVS+DP 
Sbjct  7    FLTPTQRYGAGALFAFALHQAQIHQTRPLGLLTH-EDSTTLDR--TTSCSSADSVSDDPL  63

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA--SSEV  493
            LW++  S LL PVF+FLEIDP AW+GL+ETA + PA+ HVGAFLRLL+E  GD    SE 
Sbjct  64   LWINDKSGLLPPVFRFLEIDPAAWSGLQETAASSPASNHVGAFLRLLAEAGGDEKNGSEN  123

Query  494  LEREITLANSIDSMASSIEKTVDLES---EKEKLREYENEC  607
             ++++ L+ ++D+MA S+E+  D ES   +KEK  EYE EC
Sbjct  124  ADQQLALSRAVDAMARSMEQ--DSESSKFKKEKQVEYEQEC  162



>ref|XP_004512101.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Cicer arietinum]
Length=609

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 114/156 (73%), Gaps = 9/156 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L+ TQRYAA ALLGLAL+Q+Q+HQT PLG        L+ D   S SS ++ +VSEDP+L
Sbjct  9    LSSTQRYAAGALLGLALHQSQLHQTHPLG--------LSPDEFPSPSSPTTVAVSEDPEL  60

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +S+ L+ 
Sbjct  61   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSFATRHVGPFLRLLSEEFDDDNSQRLDE  120

Query  503  EITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            E+ L+ ++D++  S+EK  +   +++EKLREYE++C
Sbjct  121  ELALSEAVDALVVSLEKNSESSRAKREKLREYEHQC  156



>ref|XP_004512100.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Cicer arietinum]
Length=666

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 114/156 (73%), Gaps = 9/156 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L+ TQRYAA ALLGLAL+Q+Q+HQT PLG        L+ D   S SS ++ +VSEDP+L
Sbjct  9    LSSTQRYAAGALLGLALHQSQLHQTHPLG--------LSPDEFPSPSSPTTVAVSEDPEL  60

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +S+ L+ 
Sbjct  61   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSFATRHVGPFLRLLSEEFDDDNSQRLDE  120

Query  503  EITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            E+ L+ ++D++  S+EK  +   +++EKLREYE++C
Sbjct  121  ELALSEAVDALVVSLEKNSESSRAKREKLREYEHQC  156



>ref|XP_006573571.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Glycine max]
Length=536

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 112/159 (70%), Gaps = 11/159 (7%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L  TQRYAA AL GLAL+QAQ+HQT PLG+ +D   D   D      +SS+ +VSE P L
Sbjct  8    LTGTQRYAAGALFGLALHQAQLHQTHPLGLSTD---DFPSD----SETSSTLAVSEHPNL  60

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSE---GSGDASSEV  493
            WVH +S LLRPV K+L+I+  AW+GLEETAG   A+RHVG FLRLLSE      D SS+ 
Sbjct  61   WVHHNSGLLRPVLKYLDINSAAWSGLEETAGFSSASRHVGPFLRLLSEDFDDDDDDSSQR  120

Query  494  LEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            L++E+ L+ ++D+M  S+EK  + L S +EKLREYEN+C
Sbjct  121  LDQELALSEAVDAMVHSLEKNSESLVSRREKLREYENQC  159



>emb|CDP01935.1| unnamed protein product [Coffea canephora]
Length=656

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L+PTQRYAA AL GLAL+Q+QI QT  LG  +D +   T DR +S  SSSSDSV++DPQ
Sbjct  12   MLSPTQRYAAGALFGLALHQSQILQTSQLG-SNDDDAGPTHDR-TSSGSSSSDSVADDPQ  69

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVHQSS LLRP+FK+L++D  AW+GLEET+   P   HVGAFLRLLSE +GD SSE  +
Sbjct  70   LWVHQSSHLLRPIFKYLDLDSKAWSGLEETSACTPVKHHVGAFLRLLSEETGDRSSEAAD  129

Query  500  REITLANSIDSMASSIEKT-VDLESEK  577
            +E+ L+  +D+MASS E + VD ES+K
Sbjct  130  KELALSRGVDAMASSFESSPVDYESKK  156



>ref|XP_003517195.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Glycine max]
Length=667

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 112/159 (70%), Gaps = 11/159 (7%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L  TQRYAA AL GLAL+QAQ+HQT PLG+ +D   D   D      +SS+ +VSE P L
Sbjct  8    LTGTQRYAAGALFGLALHQAQLHQTHPLGLSTD---DFPSD----SETSSTLAVSEHPNL  60

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSE---GSGDASSEV  493
            WVH +S LLRPV K+L+I+  AW+GLEETAG   A+RHVG FLRLLSE      D SS+ 
Sbjct  61   WVHHNSGLLRPVLKYLDINSAAWSGLEETAGFSSASRHVGPFLRLLSEDFDDDDDDSSQR  120

Query  494  LEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            L++E+ L+ ++D+M  S+EK  + L S +EKLREYEN+C
Sbjct  121  LDQELALSEAVDAMVHSLEKNSESLVSRREKLREYENQC  159



>ref|XP_007156109.1| hypothetical protein PHAVU_003G259400g [Phaseolus vulgaris]
 gb|ESW28103.1| hypothetical protein PHAVU_003G259400g [Phaseolus vulgaris]
Length=668

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 115/157 (73%), Gaps = 6/157 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L+PTQRYAA AL GLAL++AQ++QT PL +P        +    + SSSSSDSVSEDP 
Sbjct  11   LLSPTQRYAAGALFGLALHEAQLNQTNPLPLPVT-----EESEQRTSSSSSSDSVSEDPD  65

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH +S LLRPVFKFLEID  AW GLEETAG+  A  HVG FLRLLS+   D SS+ L+
Sbjct  66   LWVHNNSGLLRPVFKFLEIDSAAWLGLEETAGSSSATHHVGPFLRLLSQELDDGSSQTLD  125

Query  500  REITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            +E+ L++++D +   +++ ++  ES++E LREYEN+C
Sbjct  126  QELALSSAVDGITHEMQQNLESSESKREMLREYENQC  162



>gb|KHN41681.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=677

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = +2

Query  152  TQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQLWVH  331
            TQRYAA AL GLAL++A ++QT PL +P+  +    + R SS S SSSDSVSEDP LWVH
Sbjct  19   TQRYAAGALFGLALHEAHLNQTNPLPLPASEDSLSEEQRTSSSSGSSSDSVSEDPDLWVH  78

Query  332  QSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREIT  511
             +S LLRPVFKFL+ID  AW+GLEETAG+  A  HVG FLRLLS+   D SS+ L++E  
Sbjct  79   SNSGLLRPVFKFLDIDSAAWSGLEETAGSSSATHHVGPFLRLLSQELDDGSSQRLDQERA  138

Query  512  LANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            L++++D +A  + +  +  ES++EKLREYE++C
Sbjct  139  LSSAVDGIALDMRRNSESSESKREKLREYEHQC  171



>ref|XP_003548861.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=676

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = +2

Query  152  TQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQLWVH  331
            TQRYAA AL GLAL++A ++QT PL +P+  +    + R SS S SSSDSVSEDP LWVH
Sbjct  18   TQRYAAGALFGLALHEAHLNQTNPLPLPASEDSLSEEQRTSSSSGSSSDSVSEDPDLWVH  77

Query  332  QSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREIT  511
             +S LLRPVFKFL+ID  AW+GLEETAG+  A  HVG FLRLLS+   D SS+ L++E  
Sbjct  78   SNSGLLRPVFKFLDIDSAAWSGLEETAGSSSATHHVGPFLRLLSQELDDGSSQRLDQERA  137

Query  512  LANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            L++++D +A  + +  +  ES++EKLREYE++C
Sbjct  138  LSSAVDGIALDMRRNSESSESKREKLREYEHQC  170



>ref|XP_008241785.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Prunus mume]
Length=713

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L PTQRYAA AL   AL+QAQIHQT PL + S   E   +    + S SS+DSVS+ P+
Sbjct  6    FLTPTQRYAAGALFAFALHQAQIHQTHPLRLSSGEEESTEE---RTSSVSSADSVSDGPE  62

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA---SSE  490
            LWVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E  GD     S+
Sbjct  63   LWVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGGDGDKDGSQ  122

Query  491  VLEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
              ++E+ L+ ++D+MA S+EKT +  +S+KEK REYENEC
Sbjct  123  SADQELALSRTVDAMALSMEKTSESSQSKKEKHREYENEC  162



>ref|XP_009411496.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Musa acuminata subsp. malaccensis]
Length=685

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 107/155 (69%), Gaps = 2/155 (1%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L PT RYAA ALL LAL QAQIHQTRPLG   D  +   Q R S+GS++SS+   +DP+
Sbjct  5    LLNPTHRYAAGALLALALRQAQIHQTRPLGY--DDPDPDAQGRCSTGSATSSEGGGDDPE  62

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LW H+S  LLRPVF+FL+IDP AW+GLEETA +  A  H+GA+LR++ E   ++SSE  E
Sbjct  63   LWTHESCGLLRPVFRFLDIDPKAWSGLEETAASSMAKHHIGAYLRIIFEEDIESSSEKYE  122

Query  500  REITLANSIDSMASSIEKTVDLESEKEKLREYENE  604
            +E+TLA ++D+MA S+E         E+   Y+ E
Sbjct  123  QELTLAEAVDAMAVSLEAACSSGGTSEEHHNYDKE  157



>emb|CDX69212.1| BnaC01g02410D [Brassica napus]
Length=634

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 107/150 (71%), Gaps = 3/150 (2%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssd--svsEDP  316
            L PTQRYAA AL  +AL QAQI+QT+PLG+P+  ++D   DR     S+ S   SVS+DP
Sbjct  9    LTPTQRYAAGALFAIALNQAQINQTQPLGIPAALDDDEECDRSEERRSNCSSGDSVSDDP  68

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
             LWVH++S LLRPVF+ L+ID  AW GLEETA + PA  H+GAF RLLSE + +AS E++
Sbjct  69   NLWVHETSGLLRPVFRCLDIDSSAWLGLEETANSSPAKHHIGAFTRLLSEEASEASVEMV  128

Query  497  EREITLANSIDSMASSIEKTVDLESEKEKL  586
            E+E+ LA + D+M +  E++ D  +E+E L
Sbjct  129  EQEMALAKAADAMVNDKEES-DAAAERESL  157



>ref|XP_011025906.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Populus euphratica]
Length=681

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 113/158 (72%), Gaps = 6/158 (4%)
 Frame = +2

Query  152  TQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDPQLW  325
            TQRYAA AL  +AL+QAQIHQTRPLG+  D +E  + T    S  + SSSDSVSEDP LW
Sbjct  16   TQRYAAGALFAIALHQAQIHQTRPLGLSHDDSEQEERTSCSSSHSNGSSSDSVSEDPDLW  75

Query  326  VHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASSEVL  496
            +H++S LLRPVF+FLE++ +AWTGLEETAG  PA  HVGAFLRLL   S  +  +SS+  
Sbjct  76   IHENSGLLRPVFRFLEVESVAWTGLEETAGGSPAKHHVGAFLRLLSEESGNASSSSSQSS  135

Query  497  EREITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
            ++E+ L+ ++D M  ++    V  +S+KEK +EYE +C
Sbjct  136  DQEVALSKAVDVMEETMGANPVSSQSKKEKHKEYETQC  173



>ref|XP_007204629.1| hypothetical protein PRUPE_ppa002119mg [Prunus persica]
 gb|EMJ05828.1| hypothetical protein PRUPE_ppa002119mg [Prunus persica]
Length=713

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 7/160 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L PTQRYAA AL   AL+QAQIHQT PL + S   E   +    + S SS+DSVS+ P+
Sbjct  6    FLTPTQRYAAGALFAFALHQAQIHQTHPLRLSSGEEESTEE---RTSSVSSADSVSDGPE  62

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA---SSE  490
            LWVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E   D     S+
Sbjct  63   LWVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGDDGDKDGSQ  122

Query  491  VLEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
              ++E+ L+ ++D+MA S+EKT +  +S+KEK REYENEC
Sbjct  123  SADQELALSRTVDAMALSMEKTSESSQSKKEKHREYENEC  162



>ref|XP_010526787.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526788.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526789.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Tarenaya hassleriana]
Length=693

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 111/161 (69%), Gaps = 6/161 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVP------SDGNEDLTQDRIssgsssssdsv  304
            L PTQRYAA AL  +A+ QAQI QT+PLG P        G  +  +    S S SS+DSV
Sbjct  8    LTPTQRYAAGALFAIAVNQAQIPQTQPLGSPVADEDDEGGGGESRRSGERSSSGSSNDSV  67

Query  305  sEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  484
            SEDP LWVH+ S LLRPVF+ L ID  AW GLEETAG+ PA  HVGAF+RLLSE + D S
Sbjct  68   SEDPGLWVHECSGLLRPVFRGLHIDSSAWNGLEETAGSSPAKHHVGAFMRLLSEEASDVS  127

Query  485  SEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            SE+ E+E  LA ++D+M  S+E +V +ES+KE  + YE+EC
Sbjct  128  SEMAEKEEALAKAVDAMVRSMESSVSVESKKEIRKGYEDEC  168



>ref|XP_004146487.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cucumis sativus]
Length=673

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             LAPTQRYA  AL  LAL+QAQIHQTRPLG   D      ++R SS S SSSDSVSEDP+
Sbjct  19   FLAPTQRYATGALFALALHQAQIHQTRPLGFSDDDAR--AEERTSSCSGSSSDSVSEDPE  76

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+SS+LLRPVF+FLEID  AW+G++           +  FLRLLSE   + SSE++E
Sbjct  77   LWVHESSALLRPVFRFLEIDSAAWSGMKVVVSLKKKKNLLSQFLRLLSE-DNENSSEMIE  135

Query  500  REITLANSIDSMASSIEKTVDLESEKEKLREYENE  604
            +E+ L+ S+D++  ++EK +     KEK REYE+E
Sbjct  136  QELALSKSVDAIEENMEKNIISSQSKEKYREYEDE  170



>ref|XP_003520272.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=680

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 119/158 (75%), Gaps = 2/158 (1%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVP-SDGNEDLTQDRIssgsssssdsvsEDP  316
             L+PTQRYAAAAL GLAL++A ++QT P  +P S+ +  +++ R S+ SSS SDSVS+DP
Sbjct  15   FLSPTQRYAAAALFGLALHEAHLNQTSPFPLPASEDSLSVSEQRTSNSSSSGSDSVSDDP  74

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
             LWVH +S LLRPVFKFL+ID  AW+GLEETAG+  A  HVG FLRLLS+   D SS+ L
Sbjct  75   DLWVHSNSGLLRPVFKFLDIDSAAWSGLEETAGSSSATHHVGPFLRLLSQELDDGSSQRL  134

Query  497  EREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            ++E  L++++D +A  ++ K+   E ++EKLREYE++C
Sbjct  135  DQERALSSAVDGIALDMQRKSESSECKREKLREYEHQC  172



>ref|XP_011015560.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Populus euphratica]
Length=681

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (71%), Gaps = 6/158 (4%)
 Frame = +2

Query  152  TQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDPQLW  325
            TQRYAA AL  +AL+QAQIHQTRPLG+  D +E  + T    S  + SSSDSVSE P LW
Sbjct  16   TQRYAAGALFAIALHQAQIHQTRPLGLSHDDSEQEERTSCSSSHSNGSSSDSVSEAPDLW  75

Query  326  VHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASSEVL  496
            +H++S LLRPVF+FLE++ +AWTGLEETAG  PA  HVGAFLRLL   S  +  +SS+  
Sbjct  76   IHENSGLLRPVFRFLEVESVAWTGLEETAGGSPAKHHVGAFLRLLSEESGNASSSSSQSS  135

Query  497  EREITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
            ++E+ L+ ++D M  ++    V  +S+KEK +EYE +C
Sbjct  136  DQEVALSKAVDVMEETMGANPVSSQSKKEKHKEYETQC  173



>ref|XP_006380790.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
 gb|ERP58587.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
Length=621

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 112/158 (71%), Gaps = 6/158 (4%)
 Frame = +2

Query  152  TQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDPQLW  325
            TQRYAA AL  +AL+QAQIHQTRPLG+  D +E  + T    S  + SSSDSVSEDP LW
Sbjct  16   TQRYAAGALFAIALHQAQIHQTRPLGLFHDDSEQEERTSCSSSHSNGSSSDSVSEDPDLW  75

Query  326  VHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASSEVL  496
            +H++S LLRPVF+FLE++ +AWTGLEETAG  PA  HVGAFLRLL   S  +  +SS+  
Sbjct  76   IHENSGLLRPVFRFLEVESVAWTGLEETAGGSPAKHHVGAFLRLLSEESGDASSSSSQSS  135

Query  497  EREITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
            ++E  L+ ++D M  ++    V  +S+KEK +EYE +C
Sbjct  136  DQEFALSKAVDVMEETMGANPVSSQSKKEKHKEYETQC  173



>ref|XP_006409198.1| hypothetical protein EUTSA_v10022586mg [Eutrema salsugineum]
 gb|ESQ50651.1| hypothetical protein EUTSA_v10022586mg [Eutrema salsugineum]
Length=660

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 106/160 (66%), Gaps = 9/160 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPS--DGNEDLTQDRIssgsssssdsvsEDP  316
            L P+QRYAA+AL  +AL QAQI QT+PLG+PS   G +D    R    SS   D +SED 
Sbjct  8    LTPSQRYAASALFAIALNQAQISQTKPLGIPSTDHGGDDGESIR----SSGGGDPISEDA  63

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD--ASSE  490
             LWVH+ S LLRPVF+ L+ID   W GLEE A +  A  H+GA ++LLSE + D    SE
Sbjct  64   DLWVHEVSGLLRPVFRCLQIDSSVWHGLEEIAASSLAKDHIGALIKLLSEDASDDNGCSE  123

Query  491  VLEREITLANSIDSMASSIEK-TVDLESEKEKLREYENEC  607
            ++E+E  LA   ++M  SI++ +V +E++KEK  EYENEC
Sbjct  124  MVEKETALAKGAEAMVQSIQRGSVSVEAKKEKHVEYENEC  163



>ref|XP_008372754.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Malus domestica]
Length=713

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 7/159 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL   AL+QAQIHQTRPL + S   E   +      S SS+DSVS+DP L
Sbjct  7    LTPTQRYAAGALFAFALHQAQIHQTRPLRLSSQEEESTEERT---SSVSSADSVSDDPDL  63

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS---GDASSEV  493
            WVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E     G  +SE 
Sbjct  64   WVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGGRDGKDASEN  123

Query  494  LEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
             ++E+ L+  ID+MASS+EK  +  +S+ EK REYENEC
Sbjct  124  SDQELALSKGIDAMASSMEKDHESSQSKMEKHREYENEC  162



>ref|XP_009378211.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Pyrus x bretschneideri]
Length=713

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 7/159 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL   AL+QAQIHQTRPL + S   E   +      S SS+DSVS+DP L
Sbjct  7    LTPTQRYAAGALFAFALHQAQIHQTRPLRLSSQEEESTEERT---SSVSSADSVSDDPDL  63

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS---GDASSEV  493
            WVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E     G  +SE 
Sbjct  64   WVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGGRDGKDASEN  123

Query  494  LEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
             ++E+ L+  ID+MASS+EK  +  +S+ EK REYENEC
Sbjct  124  SDQELALSKGIDAMASSMEKDHESSQSKMEKHREYENEC  162



>ref|XP_009338652.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Pyrus x bretschneideri]
Length=713

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 7/159 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL   AL+QAQIHQTRPL + S   E   +      S SS+DSVS+DP L
Sbjct  7    LTPTQRYAAGALFAFALHQAQIHQTRPLRLSSQEEESTEERT---SSVSSADSVSDDPDL  63

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS---GDASSEV  493
            WVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E     G  +SE 
Sbjct  64   WVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGGRDGKDASEN  123

Query  494  LEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
             ++E+ L+  ID+MASS+EK  +  +S+ EK REYENEC
Sbjct  124  SDQELALSKGIDAMASSMEKDHESSQSKMEKHREYENEC  162



>ref|XP_003629356.1| hypothetical protein MTR_8g076240 [Medicago truncatula]
 gb|AET03832.1| transmembrane protein, putative [Medicago truncatula]
Length=409

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 116/160 (73%), Gaps = 4/160 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L+ TQRYAAAAL GL+L+ +QI+QTR L +P+  +     +RISS SSSSSDSVS+DP 
Sbjct  12   FLSSTQRYAAAALFGLSLHDSQINQTRILPLPASDDSISNINRISSSSSSSSDSVSDDPH  71

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEV--  493
            LWVH  S LLRPVFKFL+ID  AW GLEETAG+  A  HVG F+RLLS+ S D S+E   
Sbjct  72   LWVHHHSGLLRPVFKFLDIDSSAWYGLEETAGSPSATHHVGPFMRLLSQESDDNSAESAQ  131

Query  494  -LEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
             LE+E+ L+ ++D++   +EK +    S++E++ EYE++C
Sbjct  132  RLEQELALSKAVDAIVLEMEKNLQPSNSKRERINEYEHQC  171



>ref|XP_002310840.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
 gb|EEE91290.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
Length=681

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 112/158 (71%), Gaps = 6/158 (4%)
 Frame = +2

Query  152  TQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDPQLW  325
            TQRYAA AL  +AL+QAQIHQTRPLG+  D +E  + T    S  + SSSDSVSEDP LW
Sbjct  16   TQRYAAGALFAIALHQAQIHQTRPLGLFHDDSEQEERTSCSSSHSNGSSSDSVSEDPDLW  75

Query  326  VHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASSEVL  496
            +H++S LLRPVF+FLE++ +AWTGLEETAG  PA  HVGAFLRLL   S  +  +SS+  
Sbjct  76   IHENSGLLRPVFRFLEVESVAWTGLEETAGGSPAKHHVGAFLRLLSEESGDASSSSSQSS  135

Query  497  EREITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
            ++E  L+ ++D M  ++    V  +S+KEK +EYE +C
Sbjct  136  DQEFALSKAVDVMEETMGANPVSSQSKKEKHKEYETQC  173



>emb|CDX75561.1| BnaA01g01410D [Brassica napus]
Length=592

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 104/152 (68%), Gaps = 5/152 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL  +AL QAQI+QT+PLG+P+  ++D  +D  SSG S S     +DP L
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPAAPDDDDDKDNCSSGDSVS-----DDPNL  62

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH++S LLRPVF+ L+ID  AW GLEETA + PA  H+GAF RLLSE + +AS E++E+
Sbjct  63   WVHETSGLLRPVFRCLDIDSSAWLGLEETANSSPAKHHIGAFTRLLSEEASEASVEMVEQ  122

Query  503  EITLANSIDSMASSIEKTVDLESEKEKLREYE  598
            E+ LA + D+M  S    V L  +++    YE
Sbjct  123  EMALAKAADAMVKSKADVVLLSHQRKINVLYE  154



>ref|XP_010263882.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4-like [Nelumbo nucifera]
Length=675

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 115/162 (71%), Gaps = 11/162 (7%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLG--VPSDGNEDLTQDRIssgsssssdsvsED  313
            IL PTQRYAA ALL LAL+QAQIHQT PL   +PSD  +D  ++R  + S SS+DSV+ED
Sbjct  7    ILTPTQRYAAGALLSLALHQAQIHQT-PLASLLPSD--DDTAEER--TSSGSSTDSVTED  61

Query  314  PQ---LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  484
            P    LW+HQ+ +LLRPVF+FL+IDP AWTGLEETA + PA   VGAF RLLSE + + S
Sbjct  62   PHISHLWIHQNFALLRPVFRFLQIDPKAWTGLEETARSSPAKHRVGAFFRLLSEDNDETS  121

Query  485  SEVLEREITLANSIDSMASSIEKT-VDLESEKEKLREYENEC  607
            SE L++E+ LA ++D+   S+  + V  E+  EK  E E+ C
Sbjct  122  SERLDQELALAKAVDATEMSMGISPVSSEATIEKHHEDEHAC  163



>ref|XP_010113393.1| hypothetical protein L484_026725 [Morus notabilis]
 gb|EXC35400.1| hypothetical protein L484_026725 [Morus notabilis]
Length=663

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 110/156 (71%), Gaps = 7/156 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L PTQRYAA AL  LAL+QAQ++QTRPLG   +  +D         S  S+DSV+  P L
Sbjct  7    LTPTQRYAAGALFALALHQAQVNQTRPLGSDDESADD------RPSSCGSTDSVANHPDL  60

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVH+ S L+RPVF+FLEI+ +AW+GLEETAG+ PA  HVGAFLRLL+E +   +S+  ++
Sbjct  61   WVHELSGLVRPVFRFLEIESVAWSGLEETAGSSPAKHHVGAFLRLLAEENDGTTSQNSDQ  120

Query  503  EITLANSIDSMASSIEKTVDLESEKEKL-REYENEC  607
            E+ L+ ++D+M  S+EK+ +    K++  REYE+EC
Sbjct  121  ELALSRAVDAMWRSMEKSSESSESKKEKHREYESEC  156



>ref|XP_010679841.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Beta vulgaris subsp. vulgaris]
Length=671

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 117/159 (74%), Gaps = 4/159 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDG-NEDLTQD---RIssgsssssdsvs  307
             L+PT+RYAA  L GLAL+QA IHQ+RPLG+     N+D+  D   RIS+GSSSSSDSVS
Sbjct  5    FLSPTERYAAGTLFGLALHQAHIHQSRPLGLHHQHQNDDVEFDDHHRISNGSSSSSDSVS  64

Query  308  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASS  487
            EDP LWVH  SSLLRP+ KFL+I+  AW+G+EET+G   A RHVGAFLRLLSE   ++SS
Sbjct  65   EDPHLWVHPHSSLLRPILKFLQIESTAWSGIEETSGASGATRHVGAFLRLLSEEREESSS  124

Query  488  EVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENE  604
            E  ++E+ LA  +D M +S++ + D  ++++K REY  E
Sbjct  125  EKKDQELALAKGVDCMKASMDSSTDFATKRDKQREYAQE  163



>gb|KHN36057.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=628

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 108/158 (68%), Gaps = 10/158 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L  TQRYAA AL GLAL+QAQ+HQT PLG+ +D   D   D      +SS+ +VSE P L
Sbjct  8    LTGTQRYAAGALFGLALHQAQLHQTHPLGLSTD---DFPSD----SETSSTLAVSEHPNL  60

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLR--LLSEGSGDASSEVL  496
            WVH +S LLRPV K+L+I+  AW+GLEETAG   A+RHVG FLR         D SS+ L
Sbjct  61   WVHHNSGLLRPVLKYLDINSAAWSGLEETAGFSSASRHVGPFLRLLSEDFDDDDDSSQRL  120

Query  497  EREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            ++E+ L+ ++D+M  S+EK  + L S +EKLREYEN+C
Sbjct  121  DQELALSEAVDAMVHSLEKNSESLVSRREKLREYENQC  158



>ref|XP_010933754.1| PREDICTED: uncharacterized membrane protein YFL034W-like isoform 
X4 [Elaeis guineensis]
Length=541

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGV--PSDGNEDLTQDRIssgsssssdsvsEDP  316
            L+PTQRYAA ALL LAL QAQIHQT+PL    P  G+ D      +S S+SSS+   +  
Sbjct  7    LSPTQRYAAGALLALALRQAQIHQTQPLDDDDPDAGSRDRCSSASASSSTSSSEGDGDSC  66

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
             LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE  
Sbjct  67   HLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDEKSSERF  126

Query  497  EREITLANSIDSMASSIEKTV-DLESEKEKLREYENE  604
            E+E+ LA ++D+M  S+E ++   E  KEK  ++E +
Sbjct  127  EKELALAKAVDAMVMSLEASLTSAEESKEKDHKHERD  163



>ref|XP_010526790.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Tarenaya hassleriana]
Length=690

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 108/161 (67%), Gaps = 9/161 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVP------SDGNEDLTQDRIssgsssssdsv  304
            L PTQRYAA AL  +A+ QAQI QT+PLG P        G  +  +    S S SS+DSV
Sbjct  8    LTPTQRYAAGALFAIAVNQAQIPQTQPLGSPVADEDDEGGGGESRRSGERSSSGSSNDSV  67

Query  305  sEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  484
            SEDP LWVH+ S LLRPVF+ L ID  AW GLEETAG+ PA  H   F+RLLSE + D S
Sbjct  68   SEDPGLWVHECSGLLRPVFRGLHIDSSAWNGLEETAGSSPAKHH---FMRLLSEEASDVS  124

Query  485  SEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            SE+ E+E  LA ++D+M  S+E +V +ES+KE  + YE+EC
Sbjct  125  SEMAEKEEALAKAVDAMVRSMESSVSVESKKEIRKGYEDEC  165



>ref|XP_009112467.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Brassica rapa]
Length=656

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 104/158 (66%), Gaps = 8/158 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvs--EDP  316
            L P+QRYAA+ALL +AL QAQI QT+PLG+    N D   D   S    +S   S  +D 
Sbjct  8    LTPSQRYAASALLAIALNQAQISQTKPLGIS---NTDHGGDNGGSEHGVTSGGDSVPQDE  64

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
             LWVH+ S LLRPVF+ L+ID  AW G+EE A + PA  H+GA ++LLS+   D S +++
Sbjct  65   DLWVHEVSGLLRPVFRCLQIDSSAWHGIEEIAASSPAKPHIGALIKLLSD--DDGSGDMV  122

Query  497  EREITLANSIDSMASSIEK-TVDLESEKEKLREYENEC  607
            E+E  LA + ++M   I++ +V +E++KEK  EYENEC
Sbjct  123  EKETALAKAAEAMVQGIQQGSVSVEAKKEKHLEYENEC  160



>ref|XP_010933753.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Elaeis guineensis]
Length=622

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGV--PSDGNEDLTQDRIssgsssssdsvsEDP  316
            L+PTQRYAA ALL LAL QAQIHQT+PL    P  G+ D      +S S+SSS+   +  
Sbjct  7    LSPTQRYAAGALLALALRQAQIHQTQPLDDDDPDAGSRDRCSSASASSSTSSSEGDGDSC  66

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
             LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE  
Sbjct  67   HLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDEKSSERF  126

Query  497  EREITLANSIDSMASSIEKTV-DLESEKEKLREYENE  604
            E+E+ LA ++D+M  S+E ++   E  KEK  ++E +
Sbjct  127  EKELALAKAVDAMVMSLEASLTSAEESKEKDHKHERD  163



>ref|XP_006297154.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
 gb|EOA30052.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
Length=626

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 100/169 (59%), Gaps = 26/169 (15%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED---LTQDRIssgsssssdsvsED  313
            + P+QRYAA+AL  +AL QAQI QTRPL +P+  + D   ++ D                
Sbjct  8    MTPSQRYAASALFAIALNQAQISQTRPLEIPATTDHDGEPISSD------------GDTI  55

Query  314  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD-----  478
              LWVH+ S LLRPVF+ L+ID  AW GLEE A +  A  H+GAF++LLSE + +     
Sbjct  56   SDLWVHEVSGLLRPVFRCLQIDSSAWHGLEEIAASSQAKDHIGAFIKLLSEDASNDDDDD  115

Query  479  -----ASSEVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
                  SSE++E+E  LA + D+M  +I   TV +E++ EK  EYENEC
Sbjct  116  DDDDDDSSEMVEKETALAKAADAMVQNIRSSTVSVEAKMEKHVEYENEC  164



>ref|XP_010933752.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Elaeis guineensis]
Length=633

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGV--PSDGNEDLTQDRIssgsssssdsvsEDP  316
            L+PTQRYAA ALL LAL QAQIHQT+PL    P  G+ D      +S S+SSS+   +  
Sbjct  7    LSPTQRYAAGALLALALRQAQIHQTQPLDDDDPDAGSRDRCSSASASSSTSSSEGDGDSC  66

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
             LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE  
Sbjct  67   HLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDEKSSERF  126

Query  497  EREITLANSIDSMASSIEKTV-DLESEKEKLREYENE  604
            E+E+ LA ++D+M  S+E ++   E  KEK  ++E +
Sbjct  127  EKELALAKAVDAMVMSLEASLTSAEESKEKDHKHERD  163



>ref|XP_006297155.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
 gb|EOA30053.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
Length=661

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 100/169 (59%), Gaps = 26/169 (15%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED---LTQDRIssgsssssdsvsED  313
            + P+QRYAA+AL  +AL QAQI QTRPL +P+  + D   ++ D                
Sbjct  8    MTPSQRYAASALFAIALNQAQISQTRPLEIPATTDHDGEPISSD------------GDTI  55

Query  314  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD-----  478
              LWVH+ S LLRPVF+ L+ID  AW GLEE A +  A  H+GAF++LLSE + +     
Sbjct  56   SDLWVHEVSGLLRPVFRCLQIDSSAWHGLEEIAASSQAKDHIGAFIKLLSEDASNDDDDD  115

Query  479  -----ASSEVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
                  SSE++E+E  LA + D+M  +I   TV +E++ EK  EYENEC
Sbjct  116  DDDDDDSSEMVEKETALAKAADAMVQNIRSSTVSVEAKMEKHVEYENEC  164



>ref|XP_010933751.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Elaeis guineensis]
Length=673

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGV--PSDGNEDLTQDRIssgsssssdsvsEDP  316
            L+PTQRYAA ALL LAL QAQIHQT+PL    P  G+ D      +S S+SSS+   +  
Sbjct  7    LSPTQRYAAGALLALALRQAQIHQTQPLDDDDPDAGSRDRCSSASASSSTSSSEGDGDSC  66

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
             LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE  
Sbjct  67   HLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDEKSSERF  126

Query  497  EREITLANSIDSMASSIEKTV-DLESEKEKLREYENE  604
            E+E+ LA ++D+M  S+E ++   E  KEK  ++E +
Sbjct  127  EKELALAKAVDAMVMSLEASLTSAEESKEKDHKHERD  163



>ref|XP_004509335.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cicer arietinum]
Length=697

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 117/161 (73%), Gaps = 6/161 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
             L+PTQRYAAAAL GL+L+++Q++QTR L +P+  ++ L+ +  +S SSSS+DSVS+DP 
Sbjct  12   FLSPTQRYAAAALFGLSLHESQVNQTRSLLLPAS-DDSLSNNERTSTSSSSNDSVSDDPD  70

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD----ASS  487
            LWVH  S LLR VFKFL+ID  AW GLEETAG+  +  HVG F+RLLS+ S D     S+
Sbjct  71   LWVHHHSGLLRSVFKFLDIDSSAWYGLEETAGSSSSTHHVGPFMRLLSQDSDDDGSAESA  130

Query  488  EVLEREITLANSIDSMASSIEKTVDL-ESEKEKLREYENEC  607
            + L++E+ L+ ++D++   IEK +    S++E++ EYE+ C
Sbjct  131  QRLDQELALSKAVDALLLDIEKNLQTSNSKRERIHEYEHRC  171



>gb|KFK40188.1| hypothetical protein AALP_AA3G341700 [Arabis alpina]
Length=633

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 105/164 (64%), Gaps = 9/164 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDG-NEDLTQDRIssgsssssdsvsEDP-  316
            L P+QRYAA+AL  +AL QAQI QT+ LG+P+   N+   ++R+     S+  S  +DP 
Sbjct  12   LTPSQRYAASALFAIALNQAQISQTKLLGIPTTSVNDGEPENRLIREPISTGSSNGDDPI  71

Query  317  ----QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSG--D  478
                  WVH+ S LLRPVF+ L+ID  AW GLEE A + PA  H+G+ ++LL+E +   D
Sbjct  72   SDEADFWVHEVSGLLRPVFRCLQIDSSAWHGLEEIAASSPAKHHIGSLIKLLAEDASETD  131

Query  479  ASSEVLEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
             SSE  E+E  LA + ++M  +I++  + +E++ EK  EYENEC
Sbjct  132  DSSEKEEKETALAKAAEAMVQNIKQGSESVEAKMEKHVEYENEC  175



>gb|KFK40189.1| hypothetical protein AALP_AA3G341700 [Arabis alpina]
Length=636

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 105/164 (64%), Gaps = 9/164 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDG-NEDLTQDRIssgsssssdsvsEDP-  316
            L P+QRYAA+AL  +AL QAQI QT+ LG+P+   N+   ++R+     S+  S  +DP 
Sbjct  12   LTPSQRYAASALFAIALNQAQISQTKLLGIPTTSVNDGEPENRLIREPISTGSSNGDDPI  71

Query  317  ----QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSG--D  478
                  WVH+ S LLRPVF+ L+ID  AW GLEE A + PA  H+G+ ++LL+E +   D
Sbjct  72   SDEADFWVHEVSGLLRPVFRCLQIDSSAWHGLEEIAASSPAKHHIGSLIKLLAEDASETD  131

Query  479  ASSEVLEREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
             SSE  E+E  LA + ++M  +I++  + +E++ EK  EYENEC
Sbjct  132  DSSEKEEKETALAKAAEAMVQNIKQGSESVEAKMEKHVEYENEC  175



>ref|XP_006829156.1| hypothetical protein AMTR_s00001p00269860 [Amborella trichopoda]
 gb|ERM96572.1| hypothetical protein AMTR_s00001p00269860 [Amborella trichopoda]
Length=674

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 89/136 (65%), Gaps = 4/136 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L  TQRYAA AL+GLAL QAQIHQTRPLG P +   +  ++              E  QL
Sbjct  6    LNSTQRYAAGALMGLALRQAQIHQTRPLGFPPN---NDEEEESHHHHDDLHVLPEELSQL  62

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA-SSEVLE  499
            W H +  L+RP+F+FL+IDPIAWTGLEETA +  A  H+GAFLRLLSE + D  SSE +E
Sbjct  63   WTHPNYGLVRPIFRFLDIDPIAWTGLEETALSSSAKHHIGAFLRLLSEENCDKDSSEKIE  122

Query  500  REITLANSIDSMASSI  547
            +E  L+ ++D+   S+
Sbjct  123  QEFALSKAVDAATMSL  138



>ref|XP_010271492.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Nelumbo nucifera]
Length=669

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L P QRYAA ALL LAL+QAQIHQ R   +P   +E+ T  R  + +   SDS SE+PQL
Sbjct  7    LTPKQRYAAGALLALALHQAQIHQARLFILP---DEETTNGR--TNNGRGSDSPSEEPQL  61

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            W+H++S LLRPVF+ LEID   W  LEETA   PA  HVGA LRLLS+ +G+ SSE L++
Sbjct  62   WIHENSGLLRPVFRSLEIDCEDWPRLEETARFSPAKDHVGALLRLLSKENGETSSERLDQ  121

Query  503  EITLANSIDSMASSIE-KTVDLESEKE-KLREYENEC  607
            E+ L  ++D+M   ++ K V  E ++E K  EYE +C
Sbjct  122  ELALTKAVDAMEMKMQTKIVSSEGKREVKHLEYEQKC  158



>ref|XP_010271491.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nelumbo nucifera]
Length=670

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L P QRYAA ALL LAL+QAQIHQ R   +P   +E+ T  R  + +   SDS SE+PQL
Sbjct  7    LTPKQRYAAGALLALALHQAQIHQARLFILP---DEETTNGR--TNNGRGSDSPSEEPQL  61

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            W+H++S LLRPVF+ LEID   W  LEETA   PA  HVGA LRLLS+ +G+ SSE L++
Sbjct  62   WIHENSGLLRPVFRSLEIDCEDWPRLEETARFSPAKDHVGALLRLLSKENGETSSERLDQ  121

Query  503  EITLANSIDSMASSIE-KTVDLESEKE-KLREYENEC  607
            E+ L  ++D+M   ++ K V  E ++E K  EYE +C
Sbjct  122  ELALTKAVDAMEMKMQTKIVSSEGKREVKHLEYEQKC  158



>ref|XP_010489507.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Camelina sativa]
Length=660

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 108/163 (66%), Gaps = 8/163 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPS----DGNEDLTQDRIssgsssssdsvsE  310
            + P+QRYAA+AL  +AL QAQI QT+PLG+P+    DG++  +++R  S SS     +S+
Sbjct  1    MTPSQRYAASALFAIALNQAQISQTKPLGIPATTDHDGDDGESENRRESISSDGDIPISD  60

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDA  481
            D  LWVH+ S LLRPVF+ L+ID  AW GLE+ A +  A  H+GAF++LL        D 
Sbjct  61   DADLWVHEVSGLLRPVFRCLQIDSSAWHGLEKIAASSQAKDHIGAFVKLLSEDVSNDDDD  120

Query  482  SSEVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            SSE++E+E  LA + ++M  +I   +V +E++ EK  E+ENEC
Sbjct  121  SSEMVEKETALAKAAEAMDQNIRSSSVSVEAKMEKHVEFENEC  163



>gb|EPS66741.1| hypothetical protein M569_08033, partial [Genlisea aurea]
Length=659

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = +2

Query  206  IHQTRPLGVPSDGNEDL-TQDRIssgsssssdsvsEDPQLWVHQSSSLLRPVFKFLEIDP  382
            IHQ  PLG  +D ++    +    S SSSS DSVS+DPQLWVH SS LLRPVF++L+ID 
Sbjct  19   IHQISPLGFHTDSDDGPERRSDERSSSSSSGDSVSDDPQLWVHPSSCLLRPVFRYLDIDR  78

Query  383  IAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASSIEKT-V  559
             AW GLEET+   PA  H+GAFLRLL+E SG+AS E  E E+ L   +D MAS++E +  
Sbjct  79   RAWEGLEETSAASPAKNHIGAFLRLLAEESGEASEEAAEEELALVKGVDGMASTMEDSHS  138

Query  560  DLESEKEKLREYENEC  607
            D ES KEK REYE+ C
Sbjct  139  DDESLKEKQREYEHAC  154



>ref|XP_010489505.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Camelina sativa]
Length=663

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 108/163 (66%), Gaps = 8/163 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPS----DGNEDLTQDRIssgsssssdsvsE  310
            + P+QRYAA+AL  +AL QAQI QT+PLG+P+    DG++  +++R  S SS     +S+
Sbjct  1    MTPSQRYAASALFAIALNQAQISQTKPLGIPATTDHDGDDGESENRRESISSDGDIPISD  60

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDA  481
            D  LWVH+ S LLRPVF+ L+ID  AW GLE+ A +  A  H+GAF++LL        D 
Sbjct  61   DADLWVHEVSGLLRPVFRCLQIDSSAWHGLEKIAASSQAKDHIGAFVKLLSEDVSNDDDD  120

Query  482  SSEVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            SSE++E+E  LA + ++M  +I   +V +E++ EK  E+ENEC
Sbjct  121  SSEMVEKETALAKAAEAMDQNIRSSSVSVEAKMEKHVEFENEC  163



>ref|XP_010489506.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Camelina sativa]
Length=661

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 108/163 (66%), Gaps = 8/163 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPS----DGNEDLTQDRIssgsssssdsvsE  310
            + P+QRYAA+AL  +AL QAQI QT+PLG+P+    DG++  +++R  S SS     +S+
Sbjct  1    MTPSQRYAASALFAIALNQAQISQTKPLGIPATTDHDGDDGESENRRESISSDGDIPISD  60

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDA  481
            D  LWVH+ S LLRPVF+ L+ID  AW GLE+ A +  A  H+GAF++LL        D 
Sbjct  61   DADLWVHEVSGLLRPVFRCLQIDSSAWHGLEKIAASSQAKDHIGAFVKLLSEDVSNDDDD  120

Query  482  SSEVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            SSE++E+E  LA + ++M  +I   +V +E++ EK  E+ENEC
Sbjct  121  SSEMVEKETALAKAAEAMDQNIRSSSVSVEAKMEKHVEFENEC  163



>ref|XP_008796876.1| PREDICTED: uncharacterized membrane protein YFL034W-like isoform 
X2 [Phoenix dactylifera]
Length=557

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 4/151 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSD---GNEDLTQDRIssgsssssdsvsED  313
            L+PTQ+YAA ALL LAL QAQI QT+PL    D   G  D      +S S+SSS+   +D
Sbjct  23   LSPTQKYAAGALLALALRQAQIQQTQPLDDDDDPDAGTRDRCSSASASSSTSSSEGGGDD  82

Query  314  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEV  493
              LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE 
Sbjct  83   SSLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDENSSER  142

Query  494  LEREITLANSIDSMASSIEKTV-DLESEKEK  583
             E+E+ LA ++D+M  S+E  +   E  KEK
Sbjct  143  FEKELALAKAVDAMVMSLEAALTSAEESKEK  173



>ref|XP_008796875.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Phoenix dactylifera]
Length=690

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 4/151 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSD---GNEDLTQDRIssgsssssdsvsED  313
            L+PTQ+YAA ALL LAL QAQI QT+PL    D   G  D      +S S+SSS+   +D
Sbjct  23   LSPTQKYAAGALLALALRQAQIQQTQPLDDDDDPDAGTRDRCSSASASSSTSSSEGGGDD  82

Query  314  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEV  493
              LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE 
Sbjct  83   SSLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDENSSER  142

Query  494  LEREITLANSIDSMASSIEKTV-DLESEKEK  583
             E+E+ LA ++D+M  S+E  +   E  KEK
Sbjct  143  FEKELALAKAVDAMVMSLEAALTSAEESKEK  173



>ref|XP_010413917.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=661

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            + P+QRYAA+AL  +AL QAQI QT+PLG+P+  + D   D     SS     +S+D  L
Sbjct  8    MTPSQRYAASALFAIALNQAQISQTKPLGIPATTDHD--GDDGEPISSDGDIPISDDADL  65

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  496
            WVH+ S LLRPVF+ L+ID  AW GLEE A +  +  H+GAF++LL       D SSE++
Sbjct  66   WVHEVSGLLRPVFRCLQIDTSAWHGLEEIAASSQSKDHIGAFIKLLSEDVSDDDDSSEMV  125

Query  497  EREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            E+E  LA + ++M  +I   +V +E++ EK  E+ENEC
Sbjct  126  EKETALAKAAEAMGQNIRSSSVSVEAKMEKHVEFENEC  163



>ref|XP_010467612.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=661

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            + P+QRYAA+ALL +AL QAQI QT PLG+P+  + D   D     SS     +S+D  L
Sbjct  8    MTPSQRYAASALLAIALNQAQISQTTPLGIPATTDHD--GDDGEPISSDGDIPISDDADL  65

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  496
            WVH+ S LLRPVF+ L+ID  AW GLEE A +  A  H+GAF++LL       D SSE++
Sbjct  66   WVHEVSGLLRPVFRCLQIDTSAWHGLEEIAASSQAKDHIGAFIKLLSEDASDDDDSSEMV  125

Query  497  EREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            E+E  LA + ++M  +I   +V +E++ EK  E+ENEC
Sbjct  126  EKETALAKAAEAMGQNIRSSSVSVEAKMEKHVEFENEC  163



>ref|XP_010061018.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Eucalyptus grandis]
Length=668

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 97/157 (62%), Gaps = 7/157 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsss-ssdsvsEDP  316
            IL  TQRYAAA L  LAL+ +Q HQTRP    SD    L ++ I  G S     S SE P
Sbjct  5    ILTATQRYAAAGLFALALHHSQRHQTRP----SDALAPLEEEPIGRGVSVDRGASASERP  60

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASSEV  493
            +LW+H  S LLRPVF+F ++D  +W GL+ETAG+    R HVGAFLRLL E   +   E 
Sbjct  61   ELWIHGGSGLLRPVFRFFKVDERSWDGLKETAGSSSQVRHHVGAFLRLLVEDGEETCPER  120

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENE  604
             ++E+ LA ++D+M  S+E +   E +K + REYE E
Sbjct  121  TDKELALAKAVDAMVLSVETSPVYEEDK-RSREYEKE  156



>gb|KCW67917.1| hypothetical protein EUGRSUZ_F01619 [Eucalyptus grandis]
Length=669

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 97/157 (62%), Gaps = 7/157 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsss-ssdsvsEDP  316
            IL  TQRYAAA L  LAL+ +Q HQTRP    SD    L ++ I  G S     S SE P
Sbjct  5    ILTATQRYAAAGLFALALHHSQRHQTRP----SDALAPLEEEPIGRGVSVDRGASASERP  60

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASSEV  493
            +LW+H  S LLRPVF+F ++D  +W GL+ETAG+    R HVGAFLRLL E   +   E 
Sbjct  61   ELWIHGGSGLLRPVFRFFKVDERSWDGLKETAGSSSQVRHHVGAFLRLLVEDGEETCPER  120

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENE  604
             ++E+ LA ++D+M  S+E +   E +K + REYE E
Sbjct  121  TDKELALAKAVDAMVLSVETSPVYEEDK-RSREYEKE  156



>ref|NP_001132355.1| uncharacterized protein LOC100193799 [Zea mays]
 gb|ACF81166.1| unknown [Zea mays]
Length=650

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 92/158 (58%), Gaps = 3/158 (2%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  316
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SSS    +   
Sbjct  5    LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSSGSDTTSGA  64

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  493
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  65   GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  124

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            LE+EI LA ++D M  S+      +   +  R+Y   C
Sbjct  125  LEQEIALAKAVDVMVMSLGSDTAPDENIKDERKYSTAC  162



>gb|AAO42809.1| At2g18100 [Arabidopsis thaliana]
 dbj|BAE99624.1| hypothetical protein [Arabidopsis thaliana]
Length=656

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 104/161 (65%), Gaps = 15/161 (9%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGN--EDLTQDRIssgsssssdsvsEDP  316
            L P+QRYAA+AL  +AL QAQI Q++PLG+P+ G+  E ++ D         SD +S++ 
Sbjct  8    LTPSQRYAASALFAIALNQAQISQSKPLGIPATGSTGEPISSD---------SDPISDEA  58

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASS  487
             LWVH+ S LLRPV + L+ID  AW GLEE A +  A  H+GAF++LL        D SS
Sbjct  59   DLWVHEVSGLLRPVLRCLQIDSSAWHGLEEIAASTQAKDHIGAFIKLLSEDVSDDDDDSS  118

Query  488  EVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            E++E+E  LA + D+M  +I   ++ +ES+ EK  E+ENEC
Sbjct  119  EMVEKETALAKAADAMDQNIRSSSLSVESKMEKHVEFENEC  159



>ref|XP_003558988.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Brachypodium distachyon]
Length=634

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 94/149 (63%), Gaps = 3/149 (2%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssds--vsEDP  316
            L PTQRYAA ALL LAL QAQIHQ+  LG PS        +R S  SSS+      + D 
Sbjct  5    LTPTQRYAAGALLALALRQAQIHQSVLLGSPSASASASDDERASGSSSSAGSGEDAAADA  64

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
            +LW H S  LLRPVF+FLEIDP AW GLEETA +  A  H+GAFLR++ E  G++SS   
Sbjct  65   ELWTHDSRGLLRPVFRFLEIDPAAWAGLEETAASPEAKHHIGAFLRIIFEEDGESSSHES  124

Query  497  EREITLANSIDSMASSIEK-TVDLESEKE  580
            ++E+ LA  +D M  S+   TV  E+ KE
Sbjct  125  DQELALAKGVDVMIMSLASDTVVDETVKE  153



>ref|NP_179401.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC06726.1| uncharacterized protein AT2G18100 [Arabidopsis thaliana]
Length=656

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 104/161 (65%), Gaps = 15/161 (9%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGN--EDLTQDRIssgsssssdsvsEDP  316
            L P+QRYAA+AL  +AL QAQI Q++PLG+P+ G+  E ++ D         SD +S++ 
Sbjct  8    LTPSQRYAASALFAIALNQAQISQSKPLGIPATGSTGEPISSD---------SDPISDEA  58

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASS  487
             LWVH+ S LLRPV + L+ID  AW GLEE A +  A  H+GAF++LL        D SS
Sbjct  59   DLWVHEVSGLLRPVLRCLQIDSSAWHGLEEIAASTQAKDHIGAFIKLLSEDVSDDDDDSS  118

Query  488  EVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            E++E+E  LA + D+M  +I   ++ +ES+ EK  E+ENEC
Sbjct  119  EMVEKETALAKAADAMDQNIRSSSLSVESKMEKHVEFENEC  159



>gb|AAD20116.1| unknown protein [Arabidopsis thaliana]
Length=655

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 104/161 (65%), Gaps = 15/161 (9%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGN--EDLTQDRIssgsssssdsvsEDP  316
            L P+QRYAA+AL  +AL QAQI Q++PLG+P+ G+  E ++ D         SD +S++ 
Sbjct  8    LTPSQRYAASALFAIALNQAQISQSKPLGIPATGSTGEPISSD---------SDPISDEA  58

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASS  487
             LWVH+ S LLRPV + L+ID  AW GLEE A +  A  H+GAF++LL        D SS
Sbjct  59   DLWVHEVSGLLRPVLRCLQIDSSAWHGLEEIAASTQAKDHIGAFIKLLSEDVSDDDDDSS  118

Query  488  EVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            E++E+E  LA + D+M  +I   ++ +ES+ EK  E+ENEC
Sbjct  119  EMVEKETALAKAADAMDQNIRSSSLSVESKMEKHVEFENEC  159



>gb|AFW89821.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=626

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 95/159 (60%), Gaps = 5/159 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  316
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  493
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  494  LEREITLANSIDSMASSI-EKTVDLESEKEKLREYENEC  607
            LE+EI LA ++D M  S+   T   E+ K++ + Y   C
Sbjct  432  LEQEIALAKAVDVMVMSLGSDTAPDENIKDEFK-YSTAC  469



>ref|XP_004986015.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Setaria italica]
Length=681

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LW H S  LLRPVF+FLEIDP AW GLEETA +  A  H+GAFLR++ E  G++SS+ LE
Sbjct  106  LWTHDSRGLLRPVFRFLEIDPKAWAGLEETAASTEAKHHIGAFLRIIFEEDGESSSDRLE  165

Query  500  REITLANSIDSMASSI  547
            +E  LA ++D M  S+
Sbjct  166  QEHALAKAVDVMVMSL  181



>gb|ACN33345.1| unknown [Zea mays]
Length=647

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 95/159 (60%), Gaps = 5/159 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  316
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  5    LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  64

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  493
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  65   GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  124

Query  494  LEREITLANSIDSMASSI-EKTVDLESEKEKLREYENEC  607
            LE+EI LA ++D M  S+   T   E+ K++ + Y   C
Sbjct  125  LEQEIALAKAVDVMVMSLGSDTAPDENIKDEFK-YSTAC  162



>ref|XP_008658122.1| PREDICTED: uncharacterized protein LOC100193799 isoform X1 [Zea 
mays]
Length=647

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 95/159 (60%), Gaps = 5/159 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  316
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  5    LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  64

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  493
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  65   GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  124

Query  494  LEREITLANSIDSMASSI-EKTVDLESEKEKLREYENEC  607
            LE+EI LA ++D M  S+   T   E+ K++ + Y   C
Sbjct  125  LEQEIALAKAVDVMVMSLGSDTAPDENIKDEFK-YSTAC  162



>gb|AFW89818.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=709

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 95/159 (60%), Gaps = 5/159 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  316
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  493
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  494  LEREITLANSIDSMASSI-EKTVDLESEKEKLREYENEC  607
            LE+EI LA ++D M  S+   T   E+ K++ + Y   C
Sbjct  432  LEQEIALAKAVDVMVMSLGSDTAPDENIKDEFK-YSTAC  469



>gb|AFW89820.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=853

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 95/159 (60%), Gaps = 5/159 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  316
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  493
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  494  LEREITLANSIDSMASSI-EKTVDLESEKEKLREYENEC  607
            LE+EI LA ++D M  S+   T   E+ K++ + Y   C
Sbjct  432  LEQEIALAKAVDVMVMSLGSDTAPDENIKDEFK-YSTAC  469



>gb|AFW89819.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=954

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 95/159 (60%), Gaps = 5/159 (3%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  316
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  493
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  494  LEREITLANSIDSMASSI-EKTVDLESEKEKLREYENEC  607
            LE+EI LA ++D M  S+   T   E+ K++ + Y   C
Sbjct  432  LEQEIALAKAVDVMVMSLGSDTAPDENIKDEFK-YSTAC  469



>gb|KJB29622.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=579

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  316
            +L+ TQ+YAA+AL  +AL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFAVALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  493
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+E+ L  ++D+   S+E ++ L  + +K  +YE  C
Sbjct  121  REKELALLKAVDATMLSMESSLVLSEDSDKSCDYETHC  158



>gb|KJB29619.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=615

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  316
            +L+ TQ+YAA+AL  +AL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFAVALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  493
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+E+ L  ++D+   S+E ++ L  + +K  +YE  C
Sbjct  121  REKELALLKAVDATMLSMESSLVLSEDSDKSCDYETHC  158



>gb|KJB29620.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=666

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  316
            +L+ TQ+YAA+AL  +AL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFAVALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  493
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+E+ L  ++D+   S+E ++ L  + +K  +YE  C
Sbjct  121  REKELALLKAVDATMLSMESSLVLSEDSDKSCDYETHC  158



>gb|KJB29621.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=671

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  316
            +L+ TQ+YAA+AL  +AL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFAVALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  493
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+E+ L  ++D+   S+E ++ L  + +K  +YE  C
Sbjct  121  REKELALLKAVDATMLSMESSLVLSEDSDKSCDYETHC  158



>ref|NP_001048731.1| Os03g0112800 [Oryza sativa Japonica Group]
 gb|ABF93614.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10645.1| Os03g0112800 [Oryza sativa Japonica Group]
 gb|EAZ25332.1| hypothetical protein OsJ_09144 [Oryza sativa Japonica Group]
 dbj|BAG94661.1| unnamed protein product [Oryza sativa Japonica Group]
Length=661

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSE  490
            D  LW H S  LLRPVF+FLEIDP AW+GLEETA +  A  H+GAFLR++ E  G++SS+
Sbjct  70   DADLWTHDSHGLLRPVFRFLEIDPKAWSGLEETAASSEAKHHIGAFLRIIFEEDGESSSD  129

Query  491  VLEREITLANSIDSMASSI  547
               +E+ LA  +D M  S+
Sbjct  130  RSVQELALAKGVDVMVMSL  148



>gb|EAY88253.1| hypothetical protein OsI_09705 [Oryza sativa Indica Group]
Length=661

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSE  490
            D  LW H S  LLRPVF+FLEIDP AW+GLEETA +  A  H+GAFLR++ E  G++SS+
Sbjct  70   DADLWTHDSHGLLRPVFRFLEIDPKAWSGLEETAASSEAKHHIGAFLRIIFEEDGESSSD  129

Query  491  VLEREITLANSIDSMASSI  547
               +E+ LA  +D M  S+
Sbjct  130  RSVQELALAKGVDVMVMSL  148



>gb|ABF93615.1| expressed protein [Oryza sativa Japonica Group]
Length=689

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSE  490
            D  LW H S  LLRPVF+FLEIDP AW+GLEETA +  A  H+GAFLR++ E  G++SS+
Sbjct  70   DADLWTHDSHGLLRPVFRFLEIDPKAWSGLEETAASSEAKHHIGAFLRIIFEEDGESSSD  129

Query  491  VLEREITLANSIDSMASSI  547
               +E+ LA  +D M  S+
Sbjct  130  RSVQELALAKGVDVMVMSL  148



>ref|XP_002465997.1| hypothetical protein SORBIDRAFT_01g049760 [Sorghum bicolor]
 gb|EER92995.1| hypothetical protein SORBIDRAFT_01g049760 [Sorghum bicolor]
Length=652

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 98/159 (62%), Gaps = 9/159 (6%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGV----PSDGNEDLTQDRIssgsssssdsvsE  310
            L PTQRYAA ALL LAL QAQIHQ+ PLG     P   +E+       S SS+++ S   
Sbjct  5    LTPTQRYAAGALLALALRQAQIHQSAPLGSGSTDPGPDDEERASSASGSSSSTATISSGS  64

Query  311  DPQ----LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD  478
            D      LW H S  LLRPVF+FLEI+P+AW G+EETA +  A  H+GAFLR+L E   +
Sbjct  65   DTASGAGLWTHDSRGLLRPVFRFLEIEPMAWAGIEETAASPDAKHHIGAFLRILFEEDSE  124

Query  479  ASSEVLEREITLANSIDSMASSIEK-TVDLESEKEKLRE  592
            +SS+ L +E  LA ++D M  S+   TV  E  KE+ ++
Sbjct  125  SSSDRLSQESPLAKAVDVMVMSMSSDTVPDEKIKEESKD  163



>ref|XP_002884114.1| hypothetical protein ARALYDRAFT_480715 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60373.1| hypothetical protein ARALYDRAFT_480715 [Arabidopsis lyrata subsp. 
lyrata]
Length=667

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 101/163 (62%), Gaps = 8/163 (5%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPS----DGNEDLTQDRIssgsssssdsvsE  310
            L P+QRYAA+AL  +AL QAQI QT+  G+P+     GN +          SS  D +S+
Sbjct  8    LTPSQRYAASALFAIALNQAQISQTKLFGIPAIDHGGGNGESENSHTREPISSDGDPISD  67

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDA  481
            D  LWVH+ S L+RPVF+ L+ID  AW GLEE + +  A  H+GAF++LL        D 
Sbjct  68   DADLWVHEVSGLIRPVFRCLQIDSSAWHGLEEISASTQAKDHIGAFIKLLSEDVSDDDDN  127

Query  482  SSEVLEREITLANSIDSMASSIE-KTVDLESEKEKLREYENEC  607
            SS+++E+E  LA + ++M  +I   +V +E++ EK  E+ENEC
Sbjct  128  SSDMVEKETALAKAAEAMVQNIRSSSVSVEAKMEKHVEFENEC  170



>ref|XP_007017689.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 gb|EOY14914.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
Length=653

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  316
            IL+PTQ+YAA+AL  LAL+ +Q+ Q RP    ++    +  + I  G+S+       D P
Sbjct  5    ILSPTQKYAASALFALALHHSQVRQKRP----TNALVSMKDEPIGEGASTHKTLSVSDHP  60

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  493
            QLW+H++S LL PVF+ + ++  AW GL+ETAG +  A  HVG+FL LLSE + +AS E 
Sbjct  61   QLWIHENSGLLLPVFRLMGVEDQAWDGLKETAGVSTQARHHVGSFLTLLSEETDEASEER  120

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+E+ L  ++D+   SIE ++ +  + ++ R+YE +C
Sbjct  121  REKELALLKAVDATMLSIESSLAVSEDIDRSRDYEIKC  158



>ref|XP_004291817.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Fragaria vesca subsp. vesca]
Length=721

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 95/158 (60%), Gaps = 5/158 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L  TQRYAA AL  LAL+Q QIHQT+PL       E+   D +  G + S     +DP 
Sbjct  41   VLTQTQRYAAGALFALALHQTQIHQTKPLNALLPLEEETINDGVGIGRTVSVS---DDPG  97

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGD-ASSEV  493
            LW+H+SS LL PV +FL ++  +W GL+ETAG+    R HVGAFL LL E + + AS+E 
Sbjct  98   LWIHESSGLLYPVLRFLGVEDKSWKGLKETAGSSSQVRHHVGAFLTLLKEETAEVASAEK  157

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+E+ L  ++D+M  S E       ++ +  EYE +C
Sbjct  158  SEKEVALTKTVDTMVRSEESADAHLVDRSENYEYEAKC  195



>ref|XP_007017690.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
2 [Theobroma cacao]
 gb|EOY14915.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
2 [Theobroma cacao]
Length=668

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  316
            IL+PTQ+YAA+AL  LAL+ +Q+ Q RP    ++    +  + I  G+S+       D P
Sbjct  5    ILSPTQKYAASALFALALHHSQVRQKRP----TNALVSMKDEPIGEGASTHKTLSVSDHP  60

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  493
            QLW+H++S LL PVF+ + ++  AW GL+ETAG +  A  HVG+FL LLSE + +AS E 
Sbjct  61   QLWIHENSGLLLPVFRLMGVEDQAWDGLKETAGVSTQARHHVGSFLTLLSEETDEASEER  120

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+E+ L  ++D+   SIE ++ +  + ++ R+YE +C
Sbjct  121  REKELALLKAVDATMLSIESSLAVSEDIDRSRDYEIKC  158



>emb|CDY30329.1| BnaA09g09480D [Brassica napus]
Length=1407

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 5/138 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVP-SDGNEDLTQDRIssgsssssdsvsEDPQ  319
            L P+QRYAA+AL  +AL QAQI QT+PLG+  +D   D     +   S   S    ED  
Sbjct  806  LTPSQRYAASALFAIALNQAQISQTKPLGISNTDHGGDNGDSELGVTSGGDSVPQDED--  863

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LW+H+ S LLRPVF+ L+ID  AW G+EE AG+ PA  H+GA ++LLS+   D S +++E
Sbjct  864  LWIHEVSGLLRPVFRCLQIDSSAWHGIEEIAGSSPAKHHMGALIKLLSD--DDGSGDMVE  921

Query  500  REITLANSIDSMASSIEK  553
            +E  LA + ++M   I++
Sbjct  922  KETALAKAAEAMVQGIQQ  939



>gb|KHG10124.1| Transmembrane and coiled-coil domain-containing 4 [Gossypium 
arboreum]
 gb|KHG17468.1| Transmembrane and coiled-coil domain-containing 4 [Gossypium 
arboreum]
Length=648

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  316
            +L+ TQ+YAA+AL  LAL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFALALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  493
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  494  LEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+E+ L  ++D+   S+E ++ L  + +K  +YE  C
Sbjct  121  REKELALLKAVDATMLSMESSLVLSEDSDKNCDYETHC  158



>ref|XP_010317700.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Solanum lycopersicum]
Length=631

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 96/156 (62%), Gaps = 36/156 (23%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            +L PT RYAA AL GLAL+QAQIHQT PLG P    E+       S S SS+DSVS+DPQ
Sbjct  6    MLTPTHRYAAGALFGLALHQAQIHQTCPLGFPDTPPEE------RSSSCSSADSVSDDPQ  59

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LWVH+SS+LLRP+FK                              LLSE S D SSE  +
Sbjct  60   LWVHESSALLRPIFK------------------------------LLSEESDDGSSEAAD  89

Query  500  REITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E+ LAN +D+MASS+EKT D ES++EK REY++EC
Sbjct  90   MELALANGVDAMASSMEKTSDDESKEEKRREYKHEC  125



>gb|EMT20138.1| hypothetical protein F775_14016 [Aegilops tauschii]
Length=623

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 95/157 (61%), Gaps = 10/157 (6%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVP----SDGNEDLTQDRIssgsssssdsvs  307
            +L PTQRYAA ALL LAL QAQIHQ+  LG P    +D  E  +     SGSSSS+    
Sbjct  5    LLTPTQRYAAGALLALALRQAQIHQSVLLGSPLTSAADDEERASSASGGSGSSSSTGGSG  64

Query  308  EDPQ-----LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS  472
            ED +     LW H S  LLRPVF+FLEIDP AW GLEETA +  A  H+GAFLR++ +  
Sbjct  65   EDAEAAAKALWTHDSRGLLRPVFRFLEIDPAAWPGLEETAASPEAKHHIGAFLRMIFQED  124

Query  473  GDASSEVLEREITLANSIDSMASSIEK-TVDLESEKE  580
             ++S +  ++E  LA  +D M  S+   T   E+ KE
Sbjct  125  AESSPDKSDQEHALAKGVDVMVMSLSSDTAKDETTKE  161



>ref|XP_008221322.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Prunus mume]
Length=707

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 101/160 (63%), Gaps = 8/160 (5%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLG--VPSDGNEDLTQDRIssgsssssdsvsED  313
            IL PT +YAA AL  LAL+Q+QIHQ RP    +PS   E +++      S   + SVS++
Sbjct  41   ILIPTHKYAAGALFALALHQSQIHQARPSTPPLPSLEKETISEG----ASIGKTVSVSDN  96

Query  314  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDA-SS  487
              LW+H++S L+ PVF+FL +D  +W G++ETAG+    R HVGA + LLSEG+ D  SS
Sbjct  97   SDLWIHENSGLIYPVFRFLGVDEQSWKGIKETAGSSSQVRHHVGALMTLLSEGTTDGPSS  156

Query  488  EVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            E  ++E  L  ++D+MA S E+++   +E     EYE +C
Sbjct  157  EKTDKECALTKTVDAMALSEEESLVHSAENPVDSEYEAKC  196



>ref|XP_007226229.1| hypothetical protein PRUPE_ppa016746mg [Prunus persica]
 gb|EMJ27428.1| hypothetical protein PRUPE_ppa016746mg [Prunus persica]
Length=671

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 100/160 (63%), Gaps = 8/160 (5%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLG--VPSDGNEDLTQDRIssgsssssdsvsED  313
            IL PT +YAA AL  LAL+Q+QIHQ RP    +PS   E +++      S   + SVS++
Sbjct  5    ILTPTHKYAAGALFALALHQSQIHQARPSTPPLPSLEKETISEG----ASIGKTVSVSDN  60

Query  314  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDA-SS  487
              LW+H++S L+ PVF+FL +D  +W G++ETAG+    R HVGA + LLSEG+ D  SS
Sbjct  61   SDLWIHENSGLIYPVFRFLGVDEQSWKGIKETAGSSSQVRHHVGALMTLLSEGTTDGPSS  120

Query  488  EVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            E  ++E  L  ++D+MA S E++    +E     EYE +C
Sbjct  121  EKTDKECALTKTVDAMALSEEESSVHSAENPVDSEYEAKC  160



>dbj|BAJ94309.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=657

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +2

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  499
            LW H S  LLRPVF+FLEIDP AW GLEETA +  A  H+GAFLR++ E   ++SS+  +
Sbjct  77   LWTHDSRGLLRPVFRFLEIDPAAWPGLEETAASPEAKHHIGAFLRMIFEEDAESSSDSQD  136

Query  500  REITLANSIDSMASSI--EKTVDLESEKE  580
            +E  LA  +D M  S+  +  +D  S KE
Sbjct  137  QEHALAKGVDVMVMSLSSDTAMDESSTKE  165



>emb|CDY53279.1| BnaC09g09640D [Brassica napus]
Length=634

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 92/137 (67%), Gaps = 6/137 (4%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  322
            L P+QRYAA+ALL +AL QAQI QT+PL V   G ++   +    G +S  DS+S+D  L
Sbjct  8    LTPSQRYAASALLAIALNQAQISQTKPL-VTDHGRDNGDSEH---GLTSGGDSISQDEDL  63

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            WVHQ S LLRPVF+ L+ID  AW G+EE A + PA  H+GA ++LLS+   D S +++E+
Sbjct  64   WVHQVSGLLRPVFRCLQIDSSAWHGIEEIAASSPAKPHIGALIKLLSD--NDGSGDMVEK  121

Query  503  EITLANSIDSMASSIEK  553
            E  LA + ++M   I++
Sbjct  122  ETALAKAAEAMVQGIQQ  138



>ref|XP_009420791.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Musa acuminata subsp. malaccensis]
Length=642

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
            +LW HQS  LLRPVF+FLEID   W  LEETA +    RH+  FLR + + +G ASSE  
Sbjct  54   RLWTHQSRGLLRPVFRFLEIDSNVWAELEETALSSSPERHIDGFLRTIFDCNG-ASSEKS  112

Query  497  EREITLANSIDSMASSIEKTVD-LESEKEKLREYENEC  607
            ++E+  A ++DSMA S++   D  E  K + +E  N C
Sbjct  113  DQEVAFAKAVDSMALSLQTDADPAEGSKTQQQELNNRC  150



>gb|KEH36226.1| transmembrane and coiled-coil protein [Medicago truncatula]
Length=598

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 69/104 (66%), Gaps = 5/104 (5%)
 Frame = +2

Query  308  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDAS  484
            ++P+LW+H +S LL PVF+FLE+D  AW GL+ETAG+    R H+G F ++LSE  GDAS
Sbjct  56   DNPELWIHDNSGLLLPVFRFLEVDEQAWHGLKETAGSSSQFRHHLGDFFKVLSE-EGDAS  114

Query  485  S-EVLEREITLANSIDSMASSIEKTVD--LESEKEKLREYENEC  607
            S + L++E  L N++D+  +S++   D      ++K R  +N C
Sbjct  115  SKDRLDKEAALTNAVDATEASMKSIADSSCRGHEQKTRSEDNLC  158



>ref|XP_003603726.1| Transmembrane and coiled-coil domain-containing protein [Medicago 
truncatula]
 gb|AES73977.1| transmembrane and coiled-coil protein [Medicago truncatula]
Length=663

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 69/104 (66%), Gaps = 5/104 (5%)
 Frame = +2

Query  308  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDAS  484
            ++P+LW+H +S LL PVF+FLE+D  AW GL+ETAG+    R H+G F ++LSE  GDAS
Sbjct  56   DNPELWIHDNSGLLLPVFRFLEVDEQAWHGLKETAGSSSQFRHHLGDFFKVLSE-EGDAS  114

Query  485  S-EVLEREITLANSIDSMASSIEKTVD--LESEKEKLREYENEC  607
            S + L++E  L N++D+  +S++   D      ++K R  +N C
Sbjct  115  SKDRLDKEAALTNAVDATEASMKSIADSSCRGHEQKTRSEDNLC  158



>ref|XP_004982627.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Setaria italica]
Length=619

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 4/93 (4%)
 Frame = +2

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  490
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  59   LWTHESRGLLRPVLRFLEIDPKAWAGVEKTAASSDPKHHIGAFLRKVVEDEDDDEKARSE  118

Query  491  VLEREITLANSIDSMASSIEKTVDLESEKEKLR  589
              ++E+ LA ++D+MA  +E ++ +ES  E L+
Sbjct  119  RSDQELALAKAVDAMAMGLESSI-VESAAEALK  150



>gb|AFW89817.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=534

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 80/128 (63%), Gaps = 3/128 (2%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  316
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  493
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  494  LEREITLA  517
            LE+EI LA
Sbjct  432  LEQEIALA  439



>gb|AFW89816.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=506

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 84/138 (61%), Gaps = 3/138 (2%)
 Frame = +2

Query  143  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  316
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  493
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  494  LEREITLANSIDSMASSI  547
            LE+EI LA +    A +I
Sbjct  432  LEQEIALAITGGLAAPAI  449



>ref|XP_004500958.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cicer arietinum]
Length=662

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 95/159 (60%), Gaps = 8/159 (5%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            IL P Q YAAAAL  +AL+Q+QIHQ      P  G  D     I   SS S     ++P+
Sbjct  7    ILLPAQTYAAAALFAIALHQSQIHQGLTPASPRAGGGDAPTPSIVDASSVS-----DNPE  61

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASSEVL  496
            LW++++S LL P+F+FL +D  AW GL+ETAG+   +R H+  F +LLSE     S+E L
Sbjct  62   LWINENSGLLWPIFRFLGVDEKAWHGLKETAGSSSQSRHHLRDFFKLLSEEGDAISTERL  121

Query  497  EREITLANSIDSMASSIEKTVD--LESEKEKLREYENEC  607
            ++E  LAN+ID+  + ++KT D      ++K R  ++ C
Sbjct  122  DKEAALANAIDATEAGMKKTADSSCGGHEQKTRSKDDFC  160



>ref|XP_008366768.1| PREDICTED: uncharacterized protein LOC103430409 [Malus domestica]
Length=504

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 11/161 (7%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTR----PLGVPSDGNEDLTQDRIssgsssssdsvs  307
            IL PT +YAA AL  LAL+Q+Q+HQTR    PL  PS   E + +      S   S SVS
Sbjct  43   ILTPTHKYAAGALFALALHQSQVHQTRQSTPPL--PSLKEETIGEG----ASVGKSVSVS  96

Query  308  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDAS  484
            ++  LWVH++S LL P+F+FL +D  +W GL+ETAG+    R HVGAFL LLSE +   S
Sbjct  97   DNDGLWVHENSGLLYPIFRFLGVDDQSWKGLKETAGSSSQVRHHVGAFLTLLSEEADVPS  156

Query  485  SEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E  ++E  L  ++D+M  + E +    +EK    EYE +C
Sbjct  157  EEKSDKERALTKTVDAMVLTEEDSPASSAEKPVNAEYEAKC  197



>ref|XP_009335556.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Pyrus x bretschneideri]
Length=712

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 11/161 (7%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTR----PLGVPSDGNEDLTQDRIssgsssssdsvs  307
            IL PT +YAA AL  LAL+Q+Q+HQTR    PL  PS   E + +      S   S SVS
Sbjct  43   ILTPTHKYAAGALFALALHQSQVHQTRQSTPPL--PSLKEETIGEG----ASVGKSVSVS  96

Query  308  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDAS  484
            ++  LWVH++S LL P+F+FL +D  +W GL+ETAG+    R HVGAFL LLSE +   S
Sbjct  97   DNDGLWVHENSGLLYPIFRFLGVDDQSWKGLKETAGSSSQVRHHVGAFLTLLSEEADVPS  156

Query  485  SEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
             E  ++E  L  ++D+M  + E +    +EK    EYE +C
Sbjct  157  EEKTDKERALTKTVDAMVLTEEDSPASSAEKPVNAEYEAKC  197



>ref|XP_002464384.1| hypothetical protein SORBIDRAFT_01g017280 [Sorghum bicolor]
 gb|EER91382.1| hypothetical protein SORBIDRAFT_01g017280 [Sorghum bicolor]
Length=578

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 3/83 (4%)
 Frame = +2

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  490
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  58   LWTHESRGLLRPVLRFLEIDPKAWVGVEKTAASSDPKHHIGAFLRKVIEDEDDDDKARSE  117

Query  491  VLEREITLANSIDSMASSIEKTV  559
              ++E+ LA ++D+MA  +E  V
Sbjct  118  RSDQELALAKAVDAMAMGLECGV  140



>ref|XP_008668853.1| PREDICTED: putative DUF726-domain family protein isoform X1 [Zea 
mays]
Length=621

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = +2

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  490
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  58   LWTHESRGLLRPVLRFLEIDPKAWVGVEKTAASSDPKHHIGAFLRKVFEDEDDDEKARSE  117

Query  491  VLEREITLANSIDSMASSIEKTVDLESEKEKLR  589
              + E+ LA ++D+MA  +E    + S  E LR
Sbjct  118  RSDHELALAKAVDAMAMGLESG-GVGSVAEALR  149



>ref|NP_001130514.1| putative DUF726-domain family protein [Zea mays]
 gb|ACF78760.1| unknown [Zea mays]
 tpg|DAA49326.1| TPA: putative DUF726-domain family protein [Zea mays]
Length=624

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = +2

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  490
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  58   LWTHESRGLLRPVLRFLEIDPKAWVGVEKTAASSDPKHHIGAFLRKVFEDEDDDEKARSE  117

Query  491  VLEREITLANSIDSMASSIEKTVDLESEKEKLR  589
              + E+ LA ++D+MA  +E    + S  E LR
Sbjct  118  RSDHELALAKAVDAMAMGLESG-GVGSVAEALR  149



>ref|XP_008668907.1| PREDICTED: putative DUF726-domain family protein isoform X2 [Zea 
mays]
Length=605

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = +2

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  490
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  58   LWTHESRGLLRPVLRFLEIDPKAWVGVEKTAASSDPKHHIGAFLRKVFEDEDDDEKARSE  117

Query  491  VLEREITLANSIDSMASSIEKTVDLESEKEKLR  589
              + E+ LA ++D+MA  +E    + S  E LR
Sbjct  118  RSDHELALAKAVDAMAMGLESG-GVGSVAEALR  149



>gb|KHN00498.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=608

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +2

Query  365  FLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASS  544
            F  ID  AW+GLEETAG+  A  HVG FLRLLS+   D SS+ L++E  L++++D +A  
Sbjct  17   FSNIDSAAWSGLEETAGSSSATHHVGPFLRLLSQELDDGSSQRLDQERALSSAVDGIALD  76

Query  545  IE-KTVDLESEKEKLREYENEC  607
            ++ K+   E ++EKLREYE++C
Sbjct  77   MQRKSESSECKREKLREYEHQC  98



>gb|EMT23841.1| hypothetical protein F775_21532 [Aegilops tauschii]
Length=610

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 52/90 (58%), Gaps = 6/90 (7%)
 Frame = +2

Query  308  EDPQ---LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD  478
            +DP    LW H S  LLRPV +FLEIDP AW G+E+TA       H+GAFLR + E   D
Sbjct  53   DDPDGRDLWTHDSRGLLRPVLRFLEIDPKAWPGVEKTAATSEPKHHIGAFLRKVFEDEDD  112

Query  479  ASSEVLER---EITLANSIDSMASSIEKTV  559
                  +R   E+ LA ++D+MA  +E  V
Sbjct  113  GEKAAADRSDLELALAKAVDAMAMGLENDV  142



>ref|XP_002510477.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52664.1| conserved hypothetical protein [Ricinus communis]
Length=624

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 95/155 (61%), Gaps = 4/155 (3%)
 Frame = +2

Query  140  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  319
            IL PTQ+YAAAAL  LAL+Q+Q+HQTRP       NE+  +  I+     S     ++P 
Sbjct  5    ILTPTQKYAAAALFSLALHQSQVHQTRPSNSLKPLNEEAIEGVITFSDKFSVS---DNPH  61

Query  320  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASSEVL  496
            LW+H++S LL P+ + L +D  AW GL+ETAG+    R H+GAFL+LLSE S    SE  
Sbjct  62   LWIHENSGLLLPILRLLGVDDQAWDGLKETAGSSSQVRHHIGAFLKLLSEESEGTCSERS  121

Query  497  EREITLANSIDSMASSIEKTVDLESEKEKLREYEN  601
            +REI L N++++ A ++E +     E E  +  +N
Sbjct  122  DREIALTNTVNATALTLENSTASPEETENHQTTQN  156



>gb|AAG13564.1|AC073867_10 hypothetical protein [Oryza sativa Japonica Group]
Length=306

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASS  487
             LW H S  LLRPV +FLEID  AW G+E TA       H+GAFLR + E   D   A++
Sbjct  60   HLWTHDSHGLLRPVLRFLEIDHKAWPGVETTAATSEPKHHIGAFLRKVFEDEDDGEAAAA  119

Query  488  EVLEREITLANSIDSMASSIEKTV  559
            E  E+E+ LA ++++MA  +E  V
Sbjct  120  ERSEQELALAKAVEAMAMGLENDV  143



>ref|XP_003574182.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Brachypodium distachyon]
Length=632

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +2

Query  308  EDP---QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD  478
            +DP   +LW H+S +LL PV +FLEIDP AW G+E+TA       H+GAFLR + E   D
Sbjct  56   DDPDGRELWTHESRALLLPVLRFLEIDPKAWPGVEKTAATSDPKHHIGAFLRKVFEDEDD  115

Query  479  ASSEVLER---EITLANSIDSMASSIE  550
                  +R   E+ LA ++D+MA  +E
Sbjct  116  GEKAAADRSDLELALAKAVDAMAMGLE  142



>ref|NP_001176237.1| Os10g0512100 [Oryza sativa Japonica Group]
 gb|AAP54584.2| hypothetical protein LOC_Os10g36830 [Oryza sativa Japonica Group]
 gb|EAZ16662.1| hypothetical protein OsJ_32136 [Oryza sativa Japonica Group]
 dbj|BAH94965.1| Os10g0512100 [Oryza sativa Japonica Group]
Length=636

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASS  487
             LW H S  LLRPV +FLEID  AW G+E TA       H+GAFLR + E   D   A++
Sbjct  60   HLWTHDSHGLLRPVLRFLEIDHKAWPGVETTAATSEPKHHIGAFLRKVFEDEDDGEAAAA  119

Query  488  EVLEREITLANSIDSMASSIEKTV  559
            E  E+E+ LA ++++MA  +E  V
Sbjct  120  ERSEQELALAKAVEAMAMGLENDV  143



>gb|EAY79183.1| hypothetical protein OsI_34294 [Oryza sativa Indica Group]
Length=639

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASS  487
             LW H S  LLRPV +FLEID  AW G+E TA       H+GAFLR + E   D   A++
Sbjct  60   HLWTHDSHGLLRPVLRFLEIDHKAWPGVETTAATSEPKHHIGAFLRKVFEDEDDGEAAAA  119

Query  488  EVLEREITLANSIDSMASSIEKTV  559
            E  E+E+ LA ++++MA  +E  V
Sbjct  120  ERSEQELALAKAVEAMAMGLENDV  143



>ref|XP_006661949.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Oryza brachyantha]
Length=623

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASS  487
             LW H S  LLRPV +FLEID  AW G+E TA       H+GAFLR + E   D   A+ 
Sbjct  58   HLWTHDSHGLLRPVLRFLEIDHKAWPGVETTAATSDPKHHIGAFLRKVFEDEDDGEKAAG  117

Query  488  EVLEREITLANSIDSMASSIEKTV  559
            E  + E+ LA ++D+M   +E  V
Sbjct  118  ERSDHELALAKAVDAMVMGLENDV  141



>ref|XP_009112468.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Brassica rapa]
Length=587

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +2

Query  368  LEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASSI  547
             +ID  AW G+EE A + PA  H+GA ++LLS+   D S +++E+E  LA + ++M   I
Sbjct  13   FQIDSSAWHGIEEIAASSPAKPHIGALIKLLSD--DDGSGDMVEKETALAKAAEAMVQGI  70

Query  548  EK-TVDLESEKEKLREYENEC  607
            ++ +V +E++KEK  EYENEC
Sbjct  71   QQGSVSVEAKKEKHLEYENEC  91



>gb|KHN09111.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=630

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 64/119 (54%), Gaps = 24/119 (20%)
 Frame = +2

Query  206  IHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQLWVHQSSSLLRPVFKFLEIDPI  385
            IHQ R  G+ S  N                     +P+LW+  +S LL P+F+FL +D  
Sbjct  29   IHQIRISGIASVSN---------------------NPELWIKHNSDLLCPIFRFLGVDDQ  67

Query  386  AWTGLEETA-GNGPANRHVGAFLRLLSEGSGDASS-EVLEREITLANSIDSMASSIEKT  556
            +W GLE TA  +     H+G+FL+LLSE  GDA++ E L++E  L  +ID+ A S+  T
Sbjct  68   SWHGLEATATSSSQLGHHLGSFLQLLSE-EGDATTPEGLDKESALTKAIDASAMSMNDT  125



>ref|XP_003527670.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=630

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = +2

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETA-GNGPANRHVGAFLRLLSEGSGDASS  487
            +P+LW+  +S LL P+F+FL +D  +W GLE TA  +     H+G+FL+LLSE  GDA++
Sbjct  43   NPELWIKHNSDLLCPIFRFLGVDDQSWHGLEATATSSSQLGHHLGSFLQLLSE-EGDATT  101

Query  488  -EVLEREITLANSIDSMASSIEKT  556
             E L++E  L+ +ID+ A S+  T
Sbjct  102  PEGLDKESALSKAIDASAMSMNDT  125



>ref|XP_008778296.1| PREDICTED: uncharacterized protein LOC103698100 [Phoenix dactylifera]
Length=340

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
            QLW H+S  LLRPVF+FLEID  AW  LE+ A + PA   V  FL+ + +   +A SE  
Sbjct  117  QLWTHESHGLLRPVFRFLEIDSKAWPVLEKAAVSSPAREQVVMFLKTIFDDE-EACSERS  175

Query  497  EREITLANSIDSMASSIEKT  556
             +E  L  ++D M   ++ +
Sbjct  176  NQEFALTEAVDYMVKDLQTS  195



>gb|ACN33374.1| unknown [Zea mays]
Length=322

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 55/86 (64%), Gaps = 3/86 (3%)
 Frame = +2

Query  356  VFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDS  532
             ++FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ LE+EI LA ++D 
Sbjct  2    CYRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDRLEQEIALAKAVDV  61

Query  533  MASSI-EKTVDLESEKEKLREYENEC  607
            M  S+   T   E+ K++ + Y   C
Sbjct  62   MVMSLGSDTAPDENIKDEFK-YSTAC  86



>ref|XP_006650970.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Oryza brachyantha]
Length=615

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  365  FLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASS  544
            FLEIDP AW+GLEETA +  A  H+GAFLR++ E  G++SS+   +E+ LA  +D M  S
Sbjct  43   FLEIDPKAWSGLEETAASSEAKHHIGAFLRIIFEEDGESSSDRSLQELALAKGVDVMVMS  102

Query  545  I  547
            +
Sbjct  103  L  103



>ref|XP_010934561.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Elaeis guineensis]
Length=652

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
            QLW H+S  LL PVF+FLEID  AW  LE+ A + PA + V  FL+ + +   +ASSE  
Sbjct  117  QLWTHESHGLLHPVFRFLEIDSKAWPELEKVAVSTPARQQVVMFLKTIFDDK-EASSERS  175

Query  497  EREITLANSIDSMASSIEKT  556
             +E  L  ++DSM   ++ +
Sbjct  176  NQEFALTEAVDSMVKDLQTS  195



>ref|XP_010934563.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Elaeis guineensis]
Length=629

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
            QLW H+S  LL PVF+FLEID  AW  LE+ A + PA + V  FL+ + +   +ASSE  
Sbjct  43   QLWTHESHGLLHPVFRFLEIDSKAWPELEKVAVSTPARQQVVMFLKTIFDDK-EASSERS  101

Query  497  EREITLANSIDSMASSIEKT  556
             +E  L  ++DSM   ++ +
Sbjct  102  NQEFALTEAVDSMVKDLQTS  121



>ref|XP_010934560.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Elaeis guineensis]
Length=703

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
            QLW H+S  LL PVF+FLEID  AW  LE+ A + PA + V  FL+ + +   +ASSE  
Sbjct  117  QLWTHESHGLLHPVFRFLEIDSKAWPELEKVAVSTPARQQVVMFLKTIFDDK-EASSERS  175

Query  497  EREITLANSIDSMASSIEKT  556
             +E  L  ++DSM   ++ +
Sbjct  176  NQEFALTEAVDSMVKDLQTS  195



>ref|XP_010934564.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X4 [Elaeis guineensis]
Length=568

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +2

Query  317  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  496
            QLW H+S  LL PVF+FLEID  AW  LE+ A + PA + V  FL+ + +   +ASSE  
Sbjct  117  QLWTHESHGLLHPVFRFLEIDSKAWPELEKVAVSTPARQQVVMFLKTIFDDK-EASSERS  175

Query  497  EREITLANSIDSM  535
             +E  L  ++DSM
Sbjct  176  NQEFALTEAVDSM  188



>ref|XP_010317701.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X3 [Solanum lycopersicum]
Length=561

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  452  RLLSEGSGDASSEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            RLLSE S D SSE  + E+ LAN +D+MASS+EKT D ES++EK REY++EC
Sbjct  4    RLLSEESDDGSSEAADMELALANGVDAMASSMEKTSDDESKEEKRREYKHEC  55



>ref|XP_006343380.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Solanum tuberosum]
Length=561

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  452  RLLSEGSGDASSEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            RLLSE S D SSE  + E+ LAN +D+MASS+E+T D ES +EK REY++EC
Sbjct  4    RLLSEESDDGSSEAADMELALANGVDAMASSMERTSDNESNEEKRREYKHEC  55



>ref|XP_002968294.1| hypothetical protein SELMODRAFT_170005 [Selaginella moellendorffii]
 gb|EFJ30548.1| hypothetical protein SELMODRAFT_170005 [Selaginella moellendorffii]
Length=607

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +2

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            W  +   L + VF++L+I+  +W GLE TA +  A  H+GAFLRLLSE     +SE L  
Sbjct  52   WSSEEFGLAQHVFRYLDIEKKSWMGLETTAISPDAKHHIGAFLRLLSEEDVPTTSETLP-  110

Query  503  EITLANSIDSMASSIEKT  556
            E  LA +ID+M+  +E++
Sbjct  111  EDDLAKAIDAMSLKLEES  128



>ref|XP_002976085.1| hypothetical protein SELMODRAFT_104378 [Selaginella moellendorffii]
 gb|EFJ22990.1| hypothetical protein SELMODRAFT_104378 [Selaginella moellendorffii]
Length=607

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +2

Query  323  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  502
            W  +   L + VF++L+I+  +W GLE TA +  A  H+GAFLRLLSE     +SE L  
Sbjct  52   WSSEEFGLAQHVFRYLDIEKKSWMGLETTAISPDAKHHIGAFLRLLSEEDVPTTSETLP-  110

Query  503  EITLANSIDSMASSIEKT  556
            E  LA +ID+M+  +E++
Sbjct  111  EDDLAKAIDAMSLKLEES  128



>ref|XP_009615489.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Nicotiana tomentosiformis]
Length=565

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  485  SEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            SE  + E+ LAN +D+MASS+E+T D ESEKEK REY+NEC
Sbjct  19   SEAADMELALANGVDAMASSMERTSDNESEKEKRREYKNEC  59



>ref|XP_009615490.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Nicotiana tomentosiformis]
Length=561

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  452  RLLSEGSGDASSEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            RLLSE S D SSE  + E+ LAN +D+MASS+E+T D ESEKEK REY+NEC
Sbjct  4    RLLSEESSDDSSEAADMELALANGVDAMASSMERTSDNESEKEKRREYKNEC  55



>ref|XP_006343379.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Solanum tuberosum]
Length=565

 Score = 49.3 bits (116),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  485  SEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            SE  + E+ LAN +D+MASS+E+T D ES +EK REY++EC
Sbjct  19   SEAADMELALANGVDAMASSMERTSDNESNEEKRREYKHEC  59


 Score = 23.1 bits (48),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  388  MDWT*GNCR*WTGQSSC  438
            M WT GNC  +T ++SC
Sbjct  1    MVWTRGNCGLYTTKASC  17



>ref|XP_007136056.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
 ref|XP_007136057.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
 gb|ESW08050.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
 gb|ESW08051.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
Length=623

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +2

Query  311  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASS  487
            D  LW HQ+  LL  VF+FL +D  +W G++ETA +    R +V +FL  LSE  G  SS
Sbjct  43   DSDLWFHQNIHLLCSVFRFLGVDEDSWQGIKETACSSSHFRDNVRSFLTSLSEEGGATSS  102

Query  488  EVLEREITLANSIDSMASSIEKT  556
            E  ++E  L  ++   A ++  T
Sbjct  103  EESKKEAELTEAVHESALTLNDT  125



>ref|XP_009757146.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Nicotiana sylvestris]
Length=581

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  485  SEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            SE  + E+ LAN +D+M SS+E+T D ESEKEK REY++EC
Sbjct  19   SEAADMELALANGVDAMVSSMERTSDNESEKEKRREYKHEC  59



>ref|XP_009757147.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Nicotiana sylvestris]
Length=577

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  452  RLLSEGSGDASSEVLEREITLANSIDSMASSIEKTVDLESEKEKLREYENEC  607
            RLLSE S D SSE  + E+ LAN +D+M SS+E+T D ESEKEK REY++EC
Sbjct  4    RLLSEESSDDSSEAADMELALANGVDAMVSSMERTSDNESEKEKRREYKHEC  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800